3EU7A

Crystal structure of a palb2 / brca2 complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
333
structure length
312
Chain Sequence
NLQLVSELKNPSGSCSVDVSAMFWEGCKEPCIITACEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCSEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAGGGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLSHPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHAAAILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Partner and localizer of BRCA2
publication title Structural basis for recruitment of BRCA2 by PALB2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/antitumor protein
total genus 63
structure length 312
sequence length 333
ec nomenclature
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16756 PALB2_WD40 Partner and localizer of BRCA2 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3eu7A00
3ODTA 3FRXA 4E54B 2Z2NA 5CYKB 4IA9A 3MZLA 5FA5B 1NR0A 5CXCB 4CZXA 3OL2B 3SHFA 1SHYB 3J80g 4R7AB 5TEEA 3JZGA 2J57G 5IGOA 5HE2B 5AJAA 2IWFA 4U7AA 4E54A 5CYKA 1N6FA 3VH0A 1GG2B 5CXCA 3N0DA 1GOTB 3OL2A 4CY1A 5IJ7E 5FLXg 3RSEC 3OKTA 3KRWB 3SN6B 3EMHA 3L4MD 2I0RA 4FAND 4D6VA 3RN1D 5EALA 3I7LA 3V9FA 3PE7A 5HE1B 3EI4B 2Z2PA 3PXTD 3PVWB 2IUVA 3VA6A 3FM0A 3DM0A 4LG8A 1RI6A 1B9XA 4GGAA 4JSXC 3PVUB 1OMWB 4X60B 4I79A 3I7NA 3PXWD 4IMMA 5IC7A 3EI4A 5HE3B 4MK0B 4LG9A 5I5JA 4CI3A 3I7PA 1NEXB 4A11B 2P9SC 4XYIA 5TF2A 3SBRA 2J55H 3AL8A 3JPXA 4E5ZB 1TBGA 4J84A 3SBPA 1MG3A 5C2WB 2H9PA 2B5MA 3EU7A 2HESX 1FWXA 4GM9A 3OTTA 3AH8B 1GP2B 2AH0A 3BWSA 4CY2A 5C2VB 5JWZA 2H9MA 2XU7A 1JJUB 4ZOVA 3SFZA 5EAMA 3IJ1A 5H1MA 4FHLA 3PSCB 1R5MA 4GM3A 3CFVA 3J81g 4X3EA 4ERQA 2H9LA 2H9NA 4GM8A 5EM2B 3I2NA 3KRXB 1P22A 2EBSA 2OK6A 2AGYA 4J8BA 4FA1D 4O3TB 1A0RB 1SQ9A 5GMKn 2P9LC 3JZNA 2PM9A 4O9DA 1K32A 4PNKB 3MMYA 3RFGA 3DXKC 4GZ8A 3OKWA 3MXXA 1YFQA 2HKMA 5EMMB 2IWKA 1PI6A 4NSXA 3IJCA 2AH1A 3F3PA 1Q47A 2HJ4A 4L3GD 3I8CA 1QNIA 3I7HA 4A08A 4XYHA 5CXBA 3SMRA 4JSNC 4OWRA 5FKTA 5EMKB 4EWRA 2B5NA 2H6NA 1U4CA 3DWLC 5H14A 5EMJB 5SXMA 4ZOYA 5FKSA 4K3ID 1B9YA 5K19A 4Y5RD 3JRPA 4FAVD 4J79A 5TEFA 4Y7RA 3CFSB 5AFU3 4ES0A 2Z2OA 4PSXB 1S4UX 4QRJA 3SWSD 4FWWA 4J78A 4HDJA 3NVXA 2PM7B 5EARA 1JMXB 4GGCA 4J77A 3UVKA 3SXTD 4JSVC 1GXRA 3DXMC 2GC7A 3SLED 5EAPA 2YMUA 4JXMA 2IUPA 2H13A 2IURA 1K8KC 3MKQA 3AL8B 4CI2A 4A0BA 3SVWD 5IJ8E 2IAAA 1XKSA 2CNXA 3L4OD 4GQ1A 3UR4A 4BUJC 3VGZA 3ULEC 3IIYA 3ZWLB 3RRMC 3BG0A 4X61B 3FGBA 5FQDA 2XL3A 4J0WA 3W15A 2CN3A 4L1QD 2HJBA 2XL2A 5KDOB 2P9UC 1N6EA 5H17A 5AMSA 4FA9D 1ERJA 3JB9L 1TYQC 5GXHA 4H5JA 4JD2C 4Z8LA 3HFQA 3CIKB 4ERYA 3EI2B 4UI9R 5IGQA 5GXIA 3OKYA 4A2LA 2UZYB 4JT6C 5I5MA 2OVPB 5THAA 1L0QA 1VYHC 3I8EA 4OZUA 4FA4D 1PGUA 3EI2A 2H14A 2PM9B 5TDHB 2HYEA 4U1EI 4G56B 4A7JA 1JMZB 2P9PC 5IT9g 2MTAH 4AEZA 1MG2A 3K27A 3EI3B 3AFCA 3RMZD 4A08B 3MKSB 4JT5C 5CXBB 3SBQA 4L3HD 3UVLA 2J56H 4D0KA 5HYNB 1OLZA 2HXCA 3UKUC 3EI3A 4XEIC 3UVOA 4O1QD 4J73A 4QT8A 3BG1A 4AOWA 4CI1A 4YVDA 4O3UB 3F3FA 2G99A 4CY5A 3PXSD 4QQEA 3IJ0A 3EG6A 2TRCB 2CO0C 2CE8A 2OVQB 5FKQA 3E0CA 3OW8A 2AGZA 2YBAA 3JAMg 3EI1B 1MDAH 2BBKH 2AGLA 4FA5D 3C5MA 4J8GA 4BL0A 4JSPC 3EWEA 2O9KA 3C99A 1N6DA 1PEVA 2HKRA 2AQ5A 4L9OA 4PSWB 3AL9A 3EI1A 5GSAA 2YB8B 4A2MA 4A0BB 3P4FA 3C9CA 4ESGA 4ZN4A 4CZYA 2OK4A 2H6QA 5I5IA 3JROA 3A0FA 4O45A 2I3TA 2CO0A 4GQBB 1JOFA 3N0EA 3F3GA 2B5LA 1XIPA 3IIWA 4GQ2P 3NVNA 3MZKA 3SCYA 3UKRC 3UVNA 4TZ4A 4GGDA 4X63B 2CE9A 2W18A 3OKYB 2H47A 2I3SA 2AGXA 3GREA 2BCJB 3RFHA 4J86A 2YNOA 2P9IC 2YNNA 3IKOA 4J87A 1XHMA 2XYIA 2GNQA 3RLMD 2B4EA 5FKRA 3C75H 3RN0D 4J0XA 2PBIB 2AGWA 2IUQA 2QC5A 2P9KC 4CC9A 5K1CC 2H68A 4FB1D 3I89A 3B7FA 5EMLB 4J82A 2OJYA 2G9AA 3GFCA 4A09B 4CI8A 4PXWA 2Q7QA 1SQJA 2H6KA 5A2Qg 2PM6B 4A11A 4CZVA 3V7DB 1U2VC 2UZXB 4E5ZA 4QL1A 2YNPA 3NVQA 4H5IA 4K3JB 5C9ZB 4A0AB 4J81A 4LGNA 3SJLD 4CY3A 4A09A 4PC0A 2P9NC 5HQGA 4N14A 4KFMB 3I7OA 4BH6A 3U4YA 2I0TA 2CN2A 4ZOXA 4ZOZA 4A0AA 5HE0B 2OIZA 2H3XA 3ORVD 2OVRB 3DSMA 3I7KA 4PBYA 4PBZA 3K26A 3PSLA 2GC4A 3UVMA 4GMBA 3JZHA 5EM2A 5FXYA 5B4WA 1PBYB 4ERZA 3V5WB 2I0SA 2QXVA
chains in the Genus database with same CATH superfamily
3ODTA 3FRXA 4E54B 2Z2NA 5CYKB 4IA9A 2VDLA 3MZLA 5FA5B 2VDMA 1NR0A 1JV2A 5CXCB 3NIDA 1O6FA 4CZXA 3IUJA 3OL2B 3SHFA 1SHYB 3J80g 1E5TA 3EQ7A 4R7AB 2VDOA 5TEEA 3JZGA 2J57G 3IVMA 3QI0A 5IGOA 3IJEA 5HE2B 1QFSA 5M5UA 5AJAA 2IWFA 4U7AA 4E54A 5CYKA 2VZ1A 1N6FA 4L1MA 3VH0A 1GG2B 5CXCA 3N0DA 1GOTB 2QR5A 1VZ2A 3OL2A 4CY1A 2VC2A 3MUOA 4D9SA 5IJ7E 5FLXg 3RSEC 3OKTA 3KRWB 3SN6B 3EMHA 3L4MD 2I0RA 4FAND 4NENA 4D6VA 3RN1D 5EALA 3MUNA 3I7LA 3V9FA 5M5TA 3PE7A 5HE1B 2VDNA 3EI4B 2Z2PA 1H2YA 3PXTD 3PVWB 2IUVA 3VA6A 3FM0A 3DM0A 4LG8A 1RI6A 1B9XA 4GGAA 4JSXC 5C86A 3PVUB 1OMWB 2VZ3A 3FCSA 4X60B 4I79A 3DDUA 3I7NA 3PXWD 4IMMA 3EI4A 5IC7A 5HE3B 4MK0B 4LG9A 5I5JA 2VDRA 4CI3A 4O02A 3I7PA 2EIEA 1NEXB 4A11B 4BP9A 2P9SC 4XYIA 5TF2A 3SBRA 2J55H 3AL8A 3JPXA 4JHPC 4E5ZB 3NIFA 4Z7NA 1TBGA 4J84A 3SBPA 1GOGA 1MG3A 5C2WB 2H9PA 1H2WA 1TYEA 2B5MA 3EU7A 2HESX 1FWXA 4GM9A 3OTTA 2VDKA 3AH8B 1GP2B 2AH0A 3BWSA 4CY2A 5C2VB 5JWZA 2H9MA 2XU7A 1JJUB 4ZOVA 3IULA 3SFZA 5EAMA 3IJ1A 5H1MA 4FHLA 3IUMA 3PSCB 5M5SA 1R5MA 4GM3A 4BP8A 3CFVA 3J81g 4X3EA 4ERQA 2H9LA 2H9NA 4GM8A 3IUQA 1UTCA 5EM2B 3I2NA 3KRXB 1P22A 2EBSA 2OK6A 4UM8A 2AGYA 4J8BA 4FA1D 4O3TB 3O4HA 4NC4A 1A0RB 1SQ9A 5M5RA 5C92A 5GMKn 2P9LC 3FCUA 2PM9A 3JZNA 1K32A 4O9DA 4PNKB 3ZDZA 3MMYA 3RFGA 3DXKC 4GZ8A 3OKWA 3MXXA 1YFQA 2HKMA 5EMMB 2IWKA 1PI6A 4NSXA 3IJCA 1VE7A 3ZE2A 2AH1A 3F3PA 1Q47A 2HJ4A 4L3GD 3I8CA 1QNIA 3I7HA 4A08A 4XYHA 5CXBA 3O4IA 1UOPA 3SMRA 4JSNC 4OWRA 5FKTA 5EMKB 4EWRA 2B5NA 2H6NA 1O6GA 1YR2A 1U4CA 3DWLC 3O4GA 4BCCA 5H14A 5EMJB 5SXMA 4ZOYA 5FKSA 4K3ID 1B9YA 2WQ8A 3V4PA 5K19A 4WK2A 4Y5RD 3JRPA 3NIGA 4FAVD 4J79A 2EIDA 2HU7A 5TEFA 4Y7RA 3CFSB 5AFU3 4ES0A 3GC3B 5HDBA 2Z2OA 4DNVA 1C9IA 4PSXB 1S4UX 4QRJA 3SWSD 4FWWA 4J78A 4BCDA 1E8MA 4HDJA 3NVXA 2PM7B 5EARA 1JMXB 4GGCA 4J77A 3UVKA 3SXTD 4JSVC 1GXRA 3DXMC 2GC7A 3SLED 5EAPA 2YMUA 4JXMA 2IUPA 3IUNA 2H13A 2IURA 1K8KC 3MKQA 3AL8B 4CI2A 4A0BA 3SVWD 5IJ8E 2IAAA 1VZ3A 1XKSA 2CNXA 3L4OD 4GQ1A 3UR4A 4BUJC 3VGZA 3ULEC 3IIYA 3ZWLB 3RRMC 2VDQA 3BG0A 4IRZA 4X61B 3FGBA 5FQDA 2XL3A 4J0WA 3W15A 2CN3A 4L1QD 2HJBA 2XL2A 2VDPA 5KDOB 2P9UC 1N6EA 5H17A 5AMSA 4FA9D 1ERJA 3JB9L 1TYQC 3OF7A 4AMYA 5GXHA 4NAAA 4H5JA 4JD2C 5E6RA 4Z8LA 3HFQA 3CIKB 4ERYA 3EI2B 4UI9R 5IGQA 4AN0A 5GXIA 3OKYA 1M1XA 4A2LA 2UZYB 4JT6C 5I5MA 3T3PA 2OVPB 2XE4A 5THAA 1L0QA 1VYHC 3I8EA 1UOQA 4OZUA 4FA4D 1PGUA 3EI2A 2H14A 2PM9B 5TDHB 2HYEA 4U1EI 1H2ZA 3EQ8A 4G56B 4A7JA 4AN1A 1GOFA 1JMZB 2P9PC 3KCIA 5IT9g 2MTAH 4AEZA 1MG2A 3K27A 2EIBA 4G1EA 3EI3B 3QHYB 4Z7QA 3AFCA 3RMZD 1H2XA 4A08B 3MKSB 4JT5C 5CXBB 2XDWA 4L3HD 3SBQA 3UVLA 2EICA 2J56H 4D0KA 5HYNB 1OLZA 4MMXA 3UKUC 1T2XA 3EI3A 5M61A 4XEIC 3UVOA 4O1QD 4J73A 4QT8A 2HU5A 2HU8A 3BG1A 4AOWA 4CI1A 4YVDA 4O3UB 4BCBA 2I0SA 3F3FA 2G99A 4CY5A 3PXSD 4QQEA 3IJ0A 4MMYA 3EG6A 4NBMA 2TRCB 2CO0C 2CE8A 2OVQB 5FKQA 1JTDB 3E0CA 3OW8A 2AGZA 2YBAA 3JAMg 4O2WA 3EI1B 1MDAH 4WJKA 2BBKH 4JHNA 2AGLA 4FA5D 3C5MA 4J8GA 4BL0A 3K71A 4JSPC 2BKLA 3EWEA 3IURA 2O9KA 3C99A 1N6DA 1PEVA 2HKRA 2AQ5A 4L9OA 4PSWB 3AL9A 3EI1A 5GSAA 2XZGA 2YB8B 4A2MA 4A0BB 3P4FA 3C9CA 4ESGA 4ZN4A 4CZYA 2OK4A 3K6SA 2H6QA 4G55A 5I5IA 3JROA 1C9LA 3A0FA 4O45A 2I3TA 3ZDXA 2CO0A 4GQBB 1JOFA 3N0EA 3F3GA 2B5LA 1XIPA 3IIWA 3ZDYA 4GQ2P 1UOOA 5E6UA 3NVNA 3MZKA 1K3IA 4MMZA 3SCYA 3UKRC 3UVNA 4TZ4A 1L5GA 5M5VA 4GGDA 4X63B 1I2MB 2CE9A 4UM9A 1U8CA 2W18A 3OKYB 2H47A 2I3SA 4AMZA 2AGXA 3GREA 2BCJB 3RFHA 4J86A 3VI4A 1VE6A 2YNOA 2P9IC 2YNNA 5FFOA 4DNUA 5E6SA 3EQ9A 3IKOA 4J87A 1XHMA 2XYIA 4RE5A 2GNQA 3RLMD 2B4EA 5FKRA 3C75H 3RN0D 4J0XA 2PBIB 2AGWA 1A12A 2IUQA 2P9KC 2QC5A 5K1CC 4CC9A 4WK0A 2H68A 4FB1D 3I89A 3B7FA 3ZE1A 5EMLB 4J82A 2OJYA 2G9AA 3VI3A 3GFCA 2QZPA 3GD1I 4A09B 1GOHA 4CI8A 4PXWA 2Q7QA 1SQJA 2H6KA 5A2Qg 2PM6B 2JKXA 4A11A 4CZVA 3V7DB 1U2VC 2UZXB 4E5ZA 4QL1A 2YNPA 3NVQA 4H5IA 4K3JB 3O4JA 5C9ZB 4A0AB 3V4VA 4J81A 4LGNA 3SJLD 4CY3A 4A09A 4PC0A 3MVDK 2P9NC 5HQGA 4N14A 4QAMA 4KFMB 3I7OA 4G1MA 4WK4A 4BH6A 1BPOA 3U4YA 4RE6A 2I0TA 5FFGA 3K72A 2CN2A 4ZOXA 4ZOZA 4A0AA 5HE0B 2OIZA 4AX4A 2H3XA 3ORVD 3T3MA 2OVRB 3DSMA 4Z7OA 3I7KA 4PBYA 4PBZA 3K26A 4DNWA 3PSLA 2GC4A 3UVMA 4GMBA 3JZHA 5EM2A 5FXYA 5B4WA 3ZE0A 1QFMA 1E8NA 1PBYB 4ERZA 3V5WB 2HXCA 2QXVA
chains in the Genus database with same CATH topology
3ODTA 3FRXA 4E54B 2Z2NA 5CYKB 4IA9A 3MZLA 5FA5B 1NR0A 5CXCB 4CZXA 3OL2B 3SHFA 1SHYB 3J80g 4R7AB 5TEEA 3JZGA 2J57G 5IGOA 5HE2B 5AJAA 2IWFA 4U7AA 4E54A 5CYKA 1N6FA 3VH0A 1GG2B 5CXCA 3N0DA 1GOTB 3OL2A 4CY1A 5IJ7E 5FLXg 3RSEC 3OKTA 3KRWB 3SN6B 3EMHA 3L4MD 2I0RA 4FAND 4D6VA 3RN1D 5EALA 3I7LA 3V9FA 3PE7A 5HE1B 3EI4B 2Z2PA 3PXTD 3PVWB 2IUVA 3VA6A 3FM0A 3DM0A 4LG8A 1RI6A 1B9XA 4GGAA 4JSXC 3PVUB 1OMWB 4X60B 4I79A 3I7NA 3PXWD 4IMMA 5IC7A 3EI4A 5HE3B 4MK0B 4LG9A 5I5JA 4CI3A 3I7PA 1NEXB 4A11B 2P9SC 4XYIA 5TF2A 3SBRA 2J55H 3AL8A 3JPXA 4E5ZB 1TBGA 4J84A 3SBPA 1MG3A 5C2WB 2H9PA 2B5MA 3EU7A 2HESX 1FWXA 4GM9A 3OTTA 3AH8B 1GP2B 2AH0A 3BWSA 4CY2A 5C2VB 5JWZA 2H9MA 2XU7A 1JJUB 4ZOVA 3SFZA 5EAMA 3IJ1A 5H1MA 4FHLA 3PSCB 1R5MA 4GM3A 3CFVA 3J81g 4X3EA 4ERQA 2H9LA 2H9NA 4GM8A 5EM2B 3I2NA 3KRXB 1P22A 2EBSA 2OK6A 2AGYA 4J8BA 4FA1D 4O3TB 1A0RB 1SQ9A 5GMKn 2P9LC 3JZNA 2PM9A 4O9DA 1K32A 4PNKB 3MMYA 3RFGA 3DXKC 4GZ8A 3OKWA 3MXXA 1YFQA 2HKMA 5EMMB 2IWKA 1PI6A 4NSXA 3IJCA 2AH1A 3F3PA 1Q47A 2HJ4A 4L3GD 3I8CA 1QNIA 3I7HA 4A08A 4XYHA 5CXBA 3SMRA 4JSNC 4OWRA 5FKTA 5EMKB 4EWRA 2B5NA 2H6NA 1U4CA 3DWLC 5H14A 5EMJB 5SXMA 4ZOYA 5FKSA 4K3ID 1B9YA 5K19A 4Y5RD 3JRPA 4FAVD 4J79A 5TEFA 4Y7RA 3CFSB 5AFU3 4ES0A 2Z2OA 4PSXB 1S4UX 4QRJA 3SWSD 4FWWA 4J78A 4HDJA 3NVXA 2PM7B 5EARA 1JMXB 4GGCA 4J77A 3UVKA 3SXTD 4JSVC 1GXRA 3DXMC 2GC7A 3SLED 5EAPA 2YMUA 4JXMA 2IUPA 2H13A 2IURA 1K8KC 3MKQA 3AL8B 4CI2A 4A0BA 3SVWD 5IJ8E 2IAAA 1XKSA 2CNXA 3L4OD 4GQ1A 3UR4A 4BUJC 3VGZA 3ULEC 3IIYA 3ZWLB 3RRMC 3BG0A 4X61B 3FGBA 5FQDA 2XL3A 4J0WA 3W15A 2CN3A 4L1QD 2HJBA 2XL2A 5KDOB 2P9UC 1N6EA 5H17A 5AMSA 4FA9D 1ERJA 3JB9L 1TYQC 5GXHA 4H5JA 4JD2C 4Z8LA 3HFQA 3CIKB 4ERYA 3EI2B 4UI9R 5IGQA 5GXIA 3OKYA 4A2LA 2UZYB 4JT6C 5I5MA 2OVPB 5THAA 1L0QA 1VYHC 3I8EA 4OZUA 4FA4D 1PGUA 3EI2A 2H14A 2PM9B 5TDHB 2HYEA 4U1EI 4G56B 4A7JA 1JMZB 2P9PC 5IT9g 2MTAH 4AEZA 1MG2A 3K27A 3EI3B 3AFCA 3RMZD 4A08B 3MKSB 4JT5C 5CXBB 3SBQA 4L3HD 3UVLA 2J56H 4D0KA 5HYNB 1OLZA 2HXCA 3UKUC 3EI3A 4XEIC 3UVOA 4O1QD 4J73A 4QT8A 3BG1A 4AOWA 4CI1A 4YVDA 4O3UB 3F3FA 2G99A 4CY5A 3PXSD 4QQEA 3IJ0A 3EG6A 2TRCB 2CO0C 2CE8A 2OVQB 5FKQA 3E0CA 3OW8A 2AGZA 2YBAA 3JAMg 3EI1B 1MDAH 2BBKH 2AGLA 4FA5D 3C5MA 4J8GA 4BL0A 4JSPC 3EWEA 2O9KA 3C99A 1N6DA 1PEVA 2HKRA 2AQ5A 4L9OA 4PSWB 3AL9A 3EI1A 5GSAA 2YB8B 4A2MA 4A0BB 3P4FA 3C9CA 4ESGA 4ZN4A 4CZYA 2OK4A 2H6QA 5I5IA 3JROA 3A0FA 4O45A 2I3TA 2CO0A 4GQBB 1JOFA 3N0EA 3F3GA 2B5LA 1XIPA 3IIWA 4GQ2P 3NVNA 3MZKA 3SCYA 3UKRC 3UVNA 4TZ4A 4GGDA 4X63B 2CE9A 2W18A 3OKYB 2H47A 2I3SA 2AGXA 3GREA 2BCJB 3RFHA 4J86A 2YNOA 2P9IC 2YNNA 3IKOA 4J87A 1XHMA 2XYIA 2GNQA 3RLMD 2B4EA 5FKRA 3C75H 3RN0D 4J0XA 2PBIB 2AGWA 2IUQA 2QC5A 2P9KC 4CC9A 5K1CC 2H68A 4FB1D 3I89A 3B7FA 5EMLB 4J82A 2OJYA 2G9AA 3GFCA 4A09B 4CI8A 4PXWA 2Q7QA 1SQJA 2H6KA 5A2Qg 2PM6B 4A11A 4CZVA 3V7DB 1U2VC 2UZXB 4E5ZA 4QL1A 2YNPA 3NVQA 4H5IA 4K3JB 5C9ZB 4A0AB 4J81A 4LGNA 3SJLD 4CY3A 4A09A 4PC0A 2P9NC 5HQGA 4N14A 4KFMB 3I7OA 4BH6A 3U4YA 2I0TA 2CN2A 4ZOXA 4ZOZA 4A0AA 5HE0B 2OIZA 2H3XA 3ORVD 2OVRB 3DSMA 3I7KA 4PBYA 4PBZA 3K26A 3PSLA 2GC4A 3UVMA 4GMBA 3JZHA 5EM2A 5FXYA 5B4WA 1PBYB 4ERZA 3V5WB 2I0SA 2QXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ODT A;  3FRX A;  4E54 B;  2Z2N A;  5CYK B;  4IA9 A;  3MZL A;  5FA5 B;  1NR0 A;  5CXC B;  4CZX A;  3OL2 B;  3SHF A;  1SHY B;  3J80 g;  4R7A B;  5TEE A;  3JZG A;  2J57 G;  5IGO A;  5HE2 B;  5AJA A;  2IWF A;  4U7A A;  4E54 A;  5CYK A;  1N6F A;  3VH0 A;  1GG2 B;  5CXC A;  3N0D A;  1GOT B;  3OL2 A;  4CY1 A;  5IJ7 E;  5FLX g;  3RSE C;  3OKT A;  3KRW B;  3SN6 B;  3EMH A;  3L4M D;  2I0R A;  4FAN D;  4D6V A;  3RN1 D;  5EAL A;  3I7L A;  3V9F A;  3PE7 A;  5HE1 B;  3EI4 B;  2Z2P A;  3PXT D;  3PVW B;  2IUV A;  3VA6 A;  3FM0 A;  3DM0 A;  4LG8 A;  1RI6 A;  1B9X A;  4GGA A;  4JSX C;  3PVU B;  1OMW B;  4X60 B;  4I79 A;  3I7N A;  3PXW D;  4IMM A;  5IC7 A;  3EI4 A;  5HE3 B;  4MK0 B;  4LG9 A;  5I5J A;  4CI3 A;  3I7P A;  1NEX B;  4A11 B;  2P9S C;  4XYI A;  5TF2 A;  3SBR A;  2J55 H;  3AL8 A;  3JPX A;  4E5Z B;  1TBG A;  4J84 A;  3SBP A;  1MG3 A;  5C2W B;  2H9P A;  2B5M A;  3EU7 A;  2HES X;  1FWX A;  4GM9 A;  3OTT A;  3AH8 B;  1GP2 B;  2AH0 A;  3BWS A;  4CY2 A;  5C2V B;  5JWZ A;  2H9M A;  2XU7 A;  1JJU B;  4ZOV A;  3SFZ A;  5EAM A;  3IJ1 A;  5H1M A;  4FHL A;  3PSC B;  1R5M A;  4GM3 A;  3CFV A;  3J81 g;  4X3E A;  4ERQ A;  2H9L A;  2H9N A;  4GM8 A;  5EM2 B;  3I2N A;  3KRX B;  1P22 A;  2EBS A;  2OK6 A;  2AGY A;  4J8B A;  4FA1 D;  4O3T B;  1A0R B;  1SQ9 A;  5GMK n;  2P9L C;  3JZN A;  2PM9 A;  4O9D A;  1K32 A;  4PNK B;  3MMY A;  3RFG A;  3DXK C;  4GZ8 A;  3OKW A;  3MXX A;  1YFQ A;  2HKM A;  5EMM B;  2IWK A;  1PI6 A;  4NSX A;  3IJC A;  2AH1 A;  3F3P A;  1Q47 A;  2HJ4 A;  4L3G D;  3I8C A;  1QNI A;  3I7H A;  4A08 A;  4XYH A;  5CXB A;  3SMR A;  4JSN C;  4OWR A;  5FKT A;  5EMK B;  4EWR A;  2B5N A;  2H6N A;  1U4C A;  3DWL C;  5H14 A;  5EMJ B;  5SXM A;  4ZOY A;  5FKS A;  4K3I D;  1B9Y A;  5K19 A;  4Y5R D;  3JRP A;  4FAV D;  4J79 A;  5TEF A;  4Y7R A;  3CFS B;  5AFU 3;  4ES0 A;  2Z2O A;  4PSX B;  1S4U X;  4QRJ A;  3SWS D;  4FWW A;  4J78 A;  4HDJ A;  3NVX A;  2PM7 B;  5EAR A;  1JMX B;  4GGC A;  4J77 A;  3UVK A;  3SXT D;  4JSV C;  1GXR A;  3DXM C;  2GC7 A;  3SLE D;  5EAP A;  2YMU A;  4JXM A;  2IUP A;  2H13 A;  2IUR A;  1K8K C;  3MKQ A;  3AL8 B;  4CI2 A;  4A0B A;  3SVW D;  5IJ8 E;  2IAA A;  1XKS A;  2CNX A;  3L4O D;  4GQ1 A;  3UR4 A;  4BUJ C;  3VGZ A;  3ULE C;  3IIY A;  3ZWL B;  3RRM C;  3BG0 A;  4X61 B;  3FGB A;  5FQD A;  2XL3 A;  4J0W A;  3W15 A;  2CN3 A;  4L1Q D;  2HJB A;  2XL2 A;  5KDO B;  2P9U C;  1N6E A;  5H17 A;  5AMS A;  4FA9 D;  1ERJ A;  3JB9 L;  1TYQ C;  5GXH A;  4H5J A;  4JD2 C;  4Z8L A;  3HFQ A;  3CIK B;  4ERY A;  3EI2 B;  4UI9 R;  5IGQ A;  5GXI A;  3OKY A;  4A2L A;  2UZY B;  4JT6 C;  5I5M A;  2OVP B;  5THA A;  1L0Q A;  1VYH C;  3I8E A;  4OZU A;  4FA4 D;  1PGU A;  3EI2 A;  2H14 A;  2PM9 B;  5TDH B;  2HYE A;  4U1E I;  4G56 B;  4A7J A;  1JMZ B;  2P9P C;  5IT9 g;  2MTA H;  4AEZ A;  1MG2 A;  3K27 A;  3EI3 B;  3AFC A;  3RMZ D;  4A08 B;  3MKS B;  4JT5 C;  5CXB B;  3SBQ A;  4L3H D;  3UVL A;  2J56 H;  4D0K A;  5HYN B;  1OLZ A;  2HXC A;  3UKU C;  3EI3 A;  4XEI C;  3UVO A;  4O1Q D;  4J73 A;  4QT8 A;  3BG1 A;  4AOW A;  4CI1 A;  4YVD A;  4O3U B;  3F3F A;  2G99 A;  4CY5 A;  3PXS D;  4QQE A;  3IJ0 A;  3EG6 A;  2TRC B;  2CO0 C;  2CE8 A;  2OVQ B;  5FKQ A;  3E0C A;  3OW8 A;  2AGZ A;  2YBA A;  3JAM g;  3EI1 B;  1MDA H;  2BBK H;  2AGL A;  4FA5 D;  3C5M A;  4J8G A;  4BL0 A;  4JSP C;  3EWE A;  2O9K A;  3C99 A;  1N6D A;  1PEV A;  2HKR A;  2AQ5 A;  4L9O A;  4PSW B;  3AL9 A;  3EI1 A;  5GSA A;  2YB8 B;  4A2M A;  4A0B B;  3P4F A;  3C9C A;  4ESG A;  4ZN4 A;  4CZY A;  2OK4 A;  2H6Q A;  5I5I A;  3JRO A;  3A0F A;  4O45 A;  2I3T A;  2CO0 A;  4GQB B;  1JOF A;  3N0E A;  3F3G A;  2B5L A;  1XIP A;  3IIW A;  4GQ2 P;  3NVN A;  3MZK A;  3SCY A;  3UKR C;  3UVN A;  4TZ4 A;  4GGD A;  4X63 B;  2CE9 A;  2W18 A;  3OKY B;  2H47 A;  2I3S A;  2AGX A;  3GRE A;  2BCJ B;  3RFH A;  4J86 A;  2YNO A;  2P9I C;  2YNN A;  3IKO A;  4J87 A;  1XHM A;  2XYI A;  2GNQ A;  3RLM D;  2B4E A;  5FKR A;  3C75 H;  3RN0 D;  4J0X A;  2PBI B;  2AGW A;  2IUQ A;  2QC5 A;  2P9K C;  4CC9 A;  5K1C C;  2H68 A;  4FB1 D;  3I89 A;  3B7F A;  5EML B;  4J82 A;  2OJY A;  2G9A A;  3GFC A;  4A09 B;  4CI8 A;  4PXW A;  2Q7Q A;  1SQJ A;  2H6K A;  5A2Q g;  2PM6 B;  4A11 A;  4CZV A;  3V7D B;  1U2V C;  2UZX B;  4E5Z A;  4QL1 A;  2YNP A;  3NVQ A;  4H5I A;  4K3J B;  5C9Z B;  4A0A B;  4J81 A;  4LGN A;  3SJL D;  4CY3 A;  4A09 A;  4PC0 A;  2P9N C;  5HQG A;  4N14 A;  4KFM B;  3I7O A;  4BH6 A;  3U4Y A;  2I0T A;  2CN2 A;  4ZOX A;  4ZOZ A;  4A0A A;  5HE0 B;  2OIZ A;  2H3X A;  3ORV D;  2OVR B;  3DSM A;  3I7K A;  4PBY A;  4PBZ A;  3K26 A;  3PSL A;  2GC4 A;  3UVM A;  4GMB A;  3JZH A;  5EM2 A;  5FXY A;  5B4W A;  1PBY B;  4ERZ A;  3V5W B;  2I0S A;  2QXV A; 
#chains in the Genus database with same CATH topology
 3ODT A;  3FRX A;  4E54 B;  2Z2N A;  5CYK B;  4IA9 A;  2VDL A;  3MZL A;  5FA5 B;  2VDM A;  1NR0 A;  1JV2 A;  5CXC B;  3NID A;  1O6F A;  4CZX A;  3IUJ A;  3OL2 B;  3SHF A;  1SHY B;  3J80 g;  1E5T A;  3EQ7 A;  4R7A B;  2VDO A;  5TEE A;  3JZG A;  2J57 G;  3IVM A;  3QI0 A;  5IGO A;  3IJE A;  5HE2 B;  1QFS A;  5M5U A;  5AJA A;  2IWF A;  4U7A A;  4E54 A;  5CYK A;  2VZ1 A;  1N6F A;  4L1M A;  3VH0 A;  1GG2 B;  5CXC A;  3N0D A;  1GOT B;  2QR5 A;  1VZ2 A;  3OL2 A;  4CY1 A;  2VC2 A;  3MUO A;  4D9S A;  5IJ7 E;  5FLX g;  3RSE C;  3OKT A;  3KRW B;  3SN6 B;  3EMH A;  3L4M D;  2I0R A;  4FAN D;  4NEN A;  4D6V A;  3RN1 D;  5EAL A;  3MUN A;  3I7L A;  3V9F A;  5M5T A;  3PE7 A;  5HE1 B;  2VDN A;  3EI4 B;  2Z2P A;  1H2Y A;  3PXT D;  3PVW B;  2IUV A;  3VA6 A;  3FM0 A;  3DM0 A;  4LG8 A;  1RI6 A;  1B9X A;  4GGA A;  4JSX C;  5C86 A;  3PVU B;  1OMW B;  2VZ3 A;  3FCS A;  4X60 B;  4I79 A;  3DDU A;  3I7N A;  3PXW D;  4IMM A;  3EI4 A;  5IC7 A;  5HE3 B;  4MK0 B;  4LG9 A;  5I5J A;  2VDR A;  4CI3 A;  4O02 A;  3I7P A;  2EIE A;  1NEX B;  4A11 B;  4BP9 A;  2P9S C;  4XYI A;  5TF2 A;  3SBR A;  2J55 H;  3AL8 A;  3JPX A;  4JHP C;  4E5Z B;  3NIF A;  4Z7N A;  1TBG A;  4J84 A;  3SBP A;  1GOG A;  1MG3 A;  5C2W B;  2H9P A;  1H2W A;  1TYE A;  2B5M A;  3EU7 A;  2HES X;  1FWX A;  4GM9 A;  3OTT A;  2VDK A;  3AH8 B;  1GP2 B;  2AH0 A;  3BWS A;  4CY2 A;  5C2V B;  5JWZ A;  2H9M A;  2XU7 A;  1JJU B;  4ZOV A;  3IUL A;  3SFZ A;  5EAM A;  3IJ1 A;  5H1M A;  4FHL A;  3IUM A;  3PSC B;  5M5S A;  1R5M A;  4GM3 A;  4BP8 A;  3CFV A;  3J81 g;  4X3E A;  4ERQ A;  2H9L A;  2H9N A;  4GM8 A;  3IUQ A;  1UTC A;  5EM2 B;  3I2N A;  3KRX B;  1P22 A;  2EBS A;  2OK6 A;  4UM8 A;  2AGY A;  4J8B A;  4FA1 D;  4O3T B;  3O4H A;  4NC4 A;  1A0R B;  1SQ9 A;  5M5R A;  5C92 A;  5GMK n;  2P9L C;  3FCU A;  2PM9 A;  3JZN A;  1K32 A;  4O9D A;  4PNK B;  3ZDZ A;  3MMY A;  3RFG A;  3DXK C;  4GZ8 A;  3OKW A;  3MXX A;  1YFQ A;  2HKM A;  5EMM B;  2IWK A;  1PI6 A;  4NSX A;  3IJC A;  1VE7 A;  3ZE2 A;  2AH1 A;  3F3P A;  1Q47 A;  2HJ4 A;  4L3G D;  3I8C A;  1QNI A;  3I7H A;  4A08 A;  4XYH A;  5CXB A;  3O4I A;  1UOP A;  3SMR A;  4JSN C;  4OWR A;  5FKT A;  5EMK B;  4EWR A;  2B5N A;  2H6N A;  1O6G A;  1YR2 A;  1U4C A;  3DWL C;  3O4G A;  4BCC A;  5H14 A;  5EMJ B;  5SXM A;  4ZOY A;  5FKS A;  4K3I D;  1B9Y A;  2WQ8 A;  3V4P A;  5K19 A;  4WK2 A;  4Y5R D;  3JRP A;  3NIG A;  4FAV D;  4J79 A;  2EID A;  2HU7 A;  5TEF A;  4Y7R A;  3CFS B;  5AFU 3;  4ES0 A;  3GC3 B;  5HDB A;  2Z2O A;  4DNV A;  1C9I A;  4PSX B;  1S4U X;  4QRJ A;  3SWS D;  4FWW A;  4J78 A;  4BCD A;  1E8M A;  4HDJ A;  3NVX A;  2PM7 B;  5EAR A;  1JMX B;  4GGC A;  4J77 A;  3UVK A;  3SXT D;  4JSV C;  1GXR A;  3DXM C;  2GC7 A;  3SLE D;  5EAP A;  2YMU A;  4JXM A;  2IUP A;  3IUN A;  2H13 A;  2IUR A;  1K8K C;  3MKQ A;  3AL8 B;  4CI2 A;  4A0B A;  3SVW D;  5IJ8 E;  2IAA A;  1VZ3 A;  1XKS A;  2CNX A;  3L4O D;  4GQ1 A;  3UR4 A;  4BUJ C;  3VGZ A;  3ULE C;  3IIY A;  3ZWL B;  3RRM C;  2VDQ A;  3BG0 A;  4IRZ A;  4X61 B;  3FGB A;  5FQD A;  2XL3 A;  4J0W A;  3W15 A;  2CN3 A;  4L1Q D;  2HJB A;  2XL2 A;  2VDP A;  5KDO B;  2P9U C;  1N6E A;  5H17 A;  5AMS A;  4FA9 D;  1ERJ A;  3JB9 L;  1TYQ C;  3OF7 A;  4AMY A;  5GXH A;  4NAA A;  4H5J A;  4JD2 C;  5E6R A;  4Z8L A;  3HFQ A;  3CIK B;  4ERY A;  3EI2 B;  4UI9 R;  5IGQ A;  4AN0 A;  5GXI A;  3OKY A;  1M1X A;  4A2L A;  2UZY B;  4JT6 C;  5I5M A;  3T3P A;  2OVP B;  2XE4 A;  5THA A;  1L0Q A;  1VYH C;  3I8E A;  1UOQ A;  4OZU A;  4FA4 D;  1PGU A;  3EI2 A;  2H14 A;  2PM9 B;  5TDH B;  2HYE A;  4U1E I;  1H2Z A;  3EQ8 A;  4G56 B;  4A7J A;  4AN1 A;  1GOF A;  1JMZ B;  2P9P C;  3KCI A;  5IT9 g;  2MTA H;  4AEZ A;  1MG2 A;  3K27 A;  2EIB A;  4G1E A;  3EI3 B;  3QHY B;  4Z7Q A;  3AFC A;  3RMZ D;  1H2X A;  4A08 B;  3MKS B;  4JT5 C;  5CXB B;  2XDW A;  4L3H D;  3SBQ A;  3UVL A;  2EIC A;  2J56 H;  4D0K A;  5HYN B;  1OLZ A;  4MMX A;  3UKU C;  1T2X A;  3EI3 A;  5M61 A;  4XEI C;  3UVO A;  4O1Q D;  4J73 A;  4QT8 A;  2HU5 A;  2HU8 A;  3BG1 A;  4AOW A;  4CI1 A;  4YVD A;  4O3U B;  4BCB A;  2I0S A;  3F3F A;  2G99 A;  4CY5 A;  3PXS D;  4QQE A;  3IJ0 A;  4MMY A;  3EG6 A;  4NBM A;  2TRC B;  2CO0 C;  2CE8 A;  2OVQ B;  5FKQ A;  1JTD B;  3E0C A;  3OW8 A;  2AGZ A;  2YBA A;  3JAM g;  4O2W A;  3EI1 B;  1MDA H;  4WJK A;  2BBK H;  4JHN A;  2AGL A;  4FA5 D;  3C5M A;  4J8G A;  4BL0 A;  3K71 A;  4JSP C;  2BKL A;  3EWE A;  3IUR A;  2O9K A;  3C99 A;  1N6D A;  1PEV A;  2HKR A;  2AQ5 A;  4L9O A;  4PSW B;  3AL9 A;  3EI1 A;  5GSA A;  2XZG A;  2YB8 B;  4A2M A;  4A0B B;  3P4F A;  3C9C A;  4ESG A;  4ZN4 A;  4CZY A;  2OK4 A;  3K6S A;  2H6Q A;  4G55 A;  5I5I A;  3JRO A;  1C9L A;  3A0F A;  4O45 A;  2I3T A;  3ZDX A;  2CO0 A;  4GQB B;  1JOF A;  3N0E A;  3F3G A;  2B5L A;  1XIP A;  3IIW A;  3ZDY A;  4GQ2 P;  1UOO A;  5E6U A;  3NVN A;  3MZK A;  1K3I A;  4MMZ A;  3SCY A;  3UKR C;  3UVN A;  4TZ4 A;  1L5G A;  5M5V A;  4GGD A;  4X63 B;  1I2M B;  2CE9 A;  4UM9 A;  1U8C A;  2W18 A;  3OKY B;  2H47 A;  2I3S A;  4AMZ A;  2AGX A;  3GRE A;  2BCJ B;  3RFH A;  4J86 A;  3VI4 A;  1VE6 A;  2YNO A;  2P9I C;  2YNN A;  5FFO A;  4DNU A;  5E6S A;  3EQ9 A;  3IKO A;  4J87 A;  1XHM A;  2XYI A;  4RE5 A;  2GNQ A;  3RLM D;  2B4E A;  5FKR A;  3C75 H;  3RN0 D;  4J0X A;  2PBI B;  2AGW A;  1A12 A;  2IUQ A;  2P9K C;  2QC5 A;  5K1C C;  4CC9 A;  4WK0 A;  2H68 A;  4FB1 D;  3I89 A;  3B7F A;  3ZE1 A;  5EML B;  4J82 A;  2OJY A;  2G9A A;  3VI3 A;  3GFC A;  2QZP A;  3GD1 I;  4A09 B;  1GOH A;  4CI8 A;  4PXW A;  2Q7Q A;  1SQJ A;  2H6K A;  5A2Q g;  2PM6 B;  2JKX A;  4A11 A;  4CZV A;  3V7D B;  1U2V C;  2UZX B;  4E5Z A;  4QL1 A;  2YNP A;  3NVQ A;  4H5I A;  4K3J B;  3O4J A;  5C9Z B;  4A0A B;  3V4V A;  4J81 A;  4LGN A;  3SJL D;  4CY3 A;  4A09 A;  4PC0 A;  3MVD K;  2P9N C;  5HQG A;  4N14 A;  4QAM A;  4KFM B;  3I7O A;  4G1M A;  4WK4 A;  4BH6 A;  1BPO A;  3U4Y A;  4RE6 A;  2I0T A;  5FFG A;  3K72 A;  2CN2 A;  4ZOX A;  4ZOZ A;  4A0A A;  5HE0 B;  2OIZ A;  4AX4 A;  2H3X A;  3ORV D;  3T3M A;  2OVR B;  3DSM A;  4Z7O A;  3I7K A;  4PBY A;  4PBZ A;  3K26 A;  4DNW A;  3PSL A;  2GC4 A;  3UVM A;  4GMB A;  3JZH A;  5EM2 A;  5FXY A;  5B4W A;  3ZE0 A;  1QFM A;  1E8N A;  1PBY B;  4ERZ A;  3V5W B;  2HXC A;  2QXV A; 
#chains in the Genus database with same CATH homology
 3ODT A;  3FRX A;  4E54 B;  2Z2N A;  5CYK B;  4IA9 A;  3MZL A;  5FA5 B;  1NR0 A;  5CXC B;  4CZX A;  3OL2 B;  3SHF A;  1SHY B;  3J80 g;  4R7A B;  5TEE A;  3JZG A;  2J57 G;  5IGO A;  5HE2 B;  5AJA A;  2IWF A;  4U7A A;  4E54 A;  5CYK A;  1N6F A;  3VH0 A;  1GG2 B;  5CXC A;  3N0D A;  1GOT B;  3OL2 A;  4CY1 A;  5IJ7 E;  5FLX g;  3RSE C;  3OKT A;  3KRW B;  3SN6 B;  3EMH A;  3L4M D;  2I0R A;  4FAN D;  4D6V A;  3RN1 D;  5EAL A;  3I7L A;  3V9F A;  3PE7 A;  5HE1 B;  3EI4 B;  2Z2P A;  3PXT D;  3PVW B;  2IUV A;  3VA6 A;  3FM0 A;  3DM0 A;  4LG8 A;  1RI6 A;  1B9X A;  4GGA A;  4JSX C;  3PVU B;  1OMW B;  4X60 B;  4I79 A;  3I7N A;  3PXW D;  4IMM A;  5IC7 A;  3EI4 A;  5HE3 B;  4MK0 B;  4LG9 A;  5I5J A;  4CI3 A;  3I7P A;  1NEX B;  4A11 B;  2P9S C;  4XYI A;  5TF2 A;  3SBR A;  2J55 H;  3AL8 A;  3JPX A;  4E5Z B;  1TBG A;  4J84 A;  3SBP A;  1MG3 A;  5C2W B;  2H9P A;  2B5M A;  3EU7 A;  2HES X;  1FWX A;  4GM9 A;  3OTT A;  3AH8 B;  1GP2 B;  2AH0 A;  3BWS A;  4CY2 A;  5C2V B;  5JWZ A;  2H9M A;  2XU7 A;  1JJU B;  4ZOV A;  3SFZ A;  5EAM A;  3IJ1 A;  5H1M A;  4FHL A;  3PSC B;  1R5M A;  4GM3 A;  3CFV A;  3J81 g;  4X3E A;  4ERQ A;  2H9L A;  2H9N A;  4GM8 A;  5EM2 B;  3I2N A;  3KRX B;  1P22 A;  2EBS A;  2OK6 A;  2AGY A;  4J8B A;  4FA1 D;  4O3T B;  1A0R B;  1SQ9 A;  5GMK n;  2P9L C;  3JZN A;  2PM9 A;  4O9D A;  1K32 A;  4PNK B;  3MMY A;  3RFG A;  3DXK C;  4GZ8 A;  3OKW A;  3MXX A;  1YFQ A;  2HKM A;  5EMM B;  2IWK A;  1PI6 A;  4NSX A;  3IJC A;  2AH1 A;  3F3P A;  1Q47 A;  2HJ4 A;  4L3G D;  3I8C A;  1QNI A;  3I7H A;  4A08 A;  4XYH A;  5CXB A;  3SMR A;  4JSN C;  4OWR A;  5FKT A;  5EMK B;  4EWR A;  2B5N A;  2H6N A;  1U4C A;  3DWL C;  5H14 A;  5EMJ B;  5SXM A;  4ZOY A;  5FKS A;  4K3I D;  1B9Y A;  5K19 A;  4Y5R D;  3JRP A;  4FAV D;  4J79 A;  5TEF A;  4Y7R A;  3CFS B;  5AFU 3;  4ES0 A;  2Z2O A;  4PSX B;  1S4U X;  4QRJ A;  3SWS D;  4FWW A;  4J78 A;  4HDJ A;  3NVX A;  2PM7 B;  5EAR A;  1JMX B;  4GGC A;  4J77 A;  3UVK A;  3SXT D;  4JSV C;  1GXR A;  3DXM C;  2GC7 A;  3SLE D;  5EAP A;  2YMU A;  4JXM A;  2IUP A;  2H13 A;  2IUR A;  1K8K C;  3MKQ A;  3AL8 B;  4CI2 A;  4A0B A;  3SVW D;  5IJ8 E;  2IAA A;  1XKS A;  2CNX A;  3L4O D;  4GQ1 A;  3UR4 A;  4BUJ C;  3VGZ A;  3ULE C;  3IIY A;  3ZWL B;  3RRM C;  3BG0 A;  4X61 B;  3FGB A;  5FQD A;  2XL3 A;  4J0W A;  3W15 A;  2CN3 A;  4L1Q D;  2HJB A;  2XL2 A;  5KDO B;  2P9U C;  1N6E A;  5H17 A;  5AMS A;  4FA9 D;  1ERJ A;  3JB9 L;  1TYQ C;  5GXH A;  4H5J A;  4JD2 C;  4Z8L A;  3HFQ A;  3CIK B;  4ERY A;  3EI2 B;  4UI9 R;  5IGQ A;  5GXI A;  3OKY A;  4A2L A;  2UZY B;  4JT6 C;  5I5M A;  2OVP B;  5THA A;  1L0Q A;  1VYH C;  3I8E A;  4OZU A;  4FA4 D;  1PGU A;  3EI2 A;  2H14 A;  2PM9 B;  5TDH B;  2HYE A;  4U1E I;  4G56 B;  4A7J A;  1JMZ B;  2P9P C;  5IT9 g;  2MTA H;  4AEZ A;  1MG2 A;  3K27 A;  3EI3 B;  3AFC A;  3RMZ D;  4A08 B;  3MKS B;  4JT5 C;  5CXB B;  3SBQ A;  4L3H D;  3UVL A;  2J56 H;  4D0K A;  5HYN B;  1OLZ A;  2HXC A;  3UKU C;  3EI3 A;  4XEI C;  3UVO A;  4O1Q D;  4J73 A;  4QT8 A;  3BG1 A;  4AOW A;  4CI1 A;  4YVD A;  4O3U B;  3F3F A;  2G99 A;  4CY5 A;  3PXS D;  4QQE A;  3IJ0 A;  3EG6 A;  2TRC B;  2CO0 C;  2CE8 A;  2OVQ B;  5FKQ A;  3E0C A;  3OW8 A;  2AGZ A;  2YBA A;  3JAM g;  3EI1 B;  1MDA H;  2BBK H;  2AGL A;  4FA5 D;  3C5M A;  4J8G A;  4BL0 A;  4JSP C;  3EWE A;  2O9K A;  3C99 A;  1N6D A;  1PEV A;  2HKR A;  2AQ5 A;  4L9O A;  4PSW B;  3AL9 A;  3EI1 A;  5GSA A;  2YB8 B;  4A2M A;  4A0B B;  3P4F A;  3C9C A;  4ESG A;  4ZN4 A;  4CZY A;  2OK4 A;  2H6Q A;  5I5I A;  3JRO A;  3A0F A;  4O45 A;  2I3T A;  2CO0 A;  4GQB B;  1JOF A;  3N0E A;  3F3G A;  2B5L A;  1XIP A;  3IIW A;  4GQ2 P;  3NVN A;  3MZK A;  3SCY A;  3UKR C;  3UVN A;  4TZ4 A;  4GGD A;  4X63 B;  2CE9 A;  2W18 A;  3OKY B;  2H47 A;  2I3S A;  2AGX A;  3GRE A;  2BCJ B;  3RFH A;  4J86 A;  2YNO A;  2P9I C;  2YNN A;  3IKO A;  4J87 A;  1XHM A;  2XYI A;  2GNQ A;  3RLM D;  2B4E A;  5FKR A;  3C75 H;  3RN0 D;  4J0X A;  2PBI B;  2AGW A;  2IUQ A;  2QC5 A;  2P9K C;  4CC9 A;  5K1C C;  2H68 A;  4FB1 D;  3I89 A;  3B7F A;  5EML B;  4J82 A;  2OJY A;  2G9A A;  3GFC A;  4A09 B;  4CI8 A;  4PXW A;  2Q7Q A;  1SQJ A;  2H6K A;  5A2Q g;  2PM6 B;  4A11 A;  4CZV A;  3V7D B;  1U2V C;  2UZX B;  4E5Z A;  4QL1 A;  2YNP A;  3NVQ A;  4H5I A;  4K3J B;  5C9Z B;  4A0A B;  4J81 A;  4LGN A;  3SJL D;  4CY3 A;  4A09 A;  4PC0 A;  2P9N C;  5HQG A;  4N14 A;  4KFM B;  3I7O A;  4BH6 A;  3U4Y A;  2I0T A;  2CN2 A;  4ZOX A;  4ZOZ A;  4A0A A;  5HE0 B;  2OIZ A;  2H3X A;  3ORV D;  2OVR B;  3DSM A;  3I7K A;  4PBY A;  4PBZ A;  3K26 A;  3PSL A;  2GC4 A;  3UVM A;  4GMB A;  3JZH A;  5EM2 A;  5FXY A;  5B4W A;  1PBY B;  4ERZ A;  3V5W B;  2I0S A;  2QXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...