3EU7A

Crystal structure of a palb2 / brca2 complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
333
structure length
312
Chain Sequence
NLQLVSELKNPSGSCSVDVSAMFWEGCKEPCIITACEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCSEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAGGGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLSHPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHAAAILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/antitumor protein
molecule keywords Partner and localizer of BRCA2
publication title Structural basis for recruitment of BRCA2 by PALB2
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 312
sequence length 333
ec nomenclature
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16756 PALB2_WD40 Partner and localizer of BRCA2 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3eu7A00
2H14A 2B5NA 2CO0C 1JMXB 2HJBA 4XEIC 3I7NA 3GFCA 2W18A 2J56H 4PSWB 3MKSB 3L4OD 4CI8A 3SLED 4JSPC 2BCJB 4GZ8A 4O9DA 3JZHA 3AH8B 4JD2C 4O45A 4J78A 4GQ2P 4TZ4A 1GG2B 4LG9A 4BL0A 2CE9A 4HDJA 3L4MD 3UVLA 3AL8B 3ZWLB 2CE8A 2H9NA 4LGNA 3SN6B 4FA9D 4K3ID 1MG3A 4A0BB 3I7OA 5H17A 4CI3A 3DXMC 5JWZA 5GMKn 4E5ZA 4CI1A 1OLZA 3JROA 2Q7QA 3OL2B 3PSLA 4PC0A 3UVKA 2Z2NA 3U4YA 4FB1D 2GC7A 3PE7A 3PXSD 2H13A 2HXCA 2I3SA 2Z2PA 4U1EI 3IIYA 4A08A 1N6FA 4CY2A 3JZNA 1OMWB 2IUVA 2IUQA 4YVDA 4J81A 3MXXA 3P4FA 3VH0A 3MMYA 4ES0A 1U4CA 4ERZA 5CYKB 5HE0B 3OTTA 1QNIA 2XU7A 4J8GA 1PI6A 3I7PA 4EWRA 4Z8LA 5HE2B 2I0TA 2GC4A 4L3HD 3NVXA 1K8KC 3W15A 3V7DB 2AQ5A 3B7FA 1XHMA 5TEFA 2OIZA 3SVWD 4AEZA 1L0QA 5AJAA 3I2NA 4FA1D 2TRCB 3IKOA 2I3TA 1JMZB 2AGZA 2PM6B 3EI2A 2Z2OA 4GGCA 2IAAA 4IA9A 2P9UC 1NR0A 1TYQC 4O3UB 5H1MA 2J55H 2XL2A 3I89A 3I7KA 3J81g 5I5MA 4L1QD 1JOFA 5CXBA 2OK4A 3OKTA 2B4EA 4JXMA 3SCYA 2G99A 3EI1A 3MZLA 4CY3A 2YNPA 3PVUB 4A2LA 3K26A 3OKYA 3EI4B 5EM2A 3JZGA 1N6EA 1B9YA 2CN3A 2CNXA 5FLXg 1VYHC 5CXCB 3SBRA 1TBGA 2YNNA 5TF2A 5IJ8E 5HYNB 4BUJC 3F3GA 1PBYB 3AFCA 2H9LA 2HESX 4A11A 1JJUB 5FKSA 2P9SC 5K1CC 1PGUA 4QL1A 1MG2A 3RLMD 4PXWA 5FQDA 4J86A 3EI3A 3UVOA 5THAA 5GXIA 3SFZA 3E0CA 3FM0A 4J82A 3RMZD 3BG0A 3I8CA 2YBAA 1FWXA 3MKQA 3UKUC 2H6KA 3IJ0A 4A08B 5EMKB 5I5JA 4GM9A 3PXTD 2UZYB 4FHLA 4O1QD 4A7JA 3AL8A 2GNQA 4KFMB 2P9KC 4J8BA 5HE1B 3BWSA 4XYHA 3EWEA 2H9MA 4A0BA 3UR4A 1XKSA 2B5MA 4GMBA 3K27A 2I0SA 2YB8B 4J73A 3NVQA 3MZKA 3ULEC 2YMUA 3RN1D 4NSXA 3OL2A 5IGQA 3J80g 3JB9L 3I8EA 3EG6A 2AH0A 3C75H 4A0AB 2P9IC 3IJCA 3V9FA 1SHYB 3I7HA 5CYKA 5HE3B 3IJ1A 1P22A 3DWLC 4PSXB 2OVRB 5GSAA 4QQEA 2HKMA 4IMMA 4MK0B 4A09B 4E54B 3CIKB 4GQBB 1B9XA 3PSCB 3C5MA 4JT6C 4I79A 2H9PA 4CZXA 2O9KA 3N0DA 1S4UX 2B5LA 2PM9B 3KRXB 5KDOB 2IWFA 4PNKB 5I5IA 2P9LC 3F3FA 1N6DA 3UVMA 3RFHA 5FXYA 3NVNA 2H3XA 5C2WB 4FAVD 3CFVA 4ERQA 2OVPB 4J0WA 4ZOZA 3KRWB 1U2VC 4N14A 4D6VA 3JRPA 3SWSD 4XYIA 2QC5A 2EBSA 3DSMA 4ZN4A 4H5JA 4Y5RD 3OW8A 3C9CA 2HYEA 5B4WA 4K3JB 2IUPA 2OJYA 3SBQA 4CY5A 4ERYA 5IJ7E 3PXWD 3SXTD 4PBZA 5EMMB 2XL3A 3ODTA 5EAMA 1Q47A 3EMHA 3EI4A 3EI3B 2H47A 4OZUA 2I0RA 2AH1A 4E5ZB 5H14A 5CXCA 4J0XA 4JSNC 2XYIA 5IGOA 3IIWA 3SBPA 5EMJB 3DM0A 3HFQA 3CFSB 4J84A 2HKRA 1ERJA 2AGLA 2OK6A 2MTAH 2IURA 4JSVC 4JSXC 3ORVD 2BBKH 5FKRA 2UZXB 4Y7RA 3GREA 2OVQB 4FA5D 5K19A 4GGAA 4FWWA 4CZVA 5A2Qg 2G9AA 4GM3A 1MDAH 4R7AB 5TEEA 3UKRC 3JAMg 2P9PC 1A0RB 3PVWB 1YFQA 3RRMC 4L3GD 5AMSA 5TDHB 5C2VB 2IWKA 5FKQA 1XIPA 5EMLB 1RI6A 2PM7B 4X3EA 3N0EA 3RN0D 3I7LA 4FA4D 2AGWA 3V5WB 4PBYA 4L9OA 4CC9A 4UI9R 5SXMA 1GXRA 3EU7A 3EI2B 5EALA 4QRJA 2J57G 4CI2A 5EAPA 1K32A 4LG8A 4OWRA 5FKTA 4J79A 5IT9g 4X60B 4AOWA 2YNOA 5HQGA 4G56B 2PBIB 5AFU3 5CXBB 3SHFA 2CN2A 5C9ZB 3BG1A 1PEVA 4U7AA 4A2MA 3EI1B 3C99A 4X61B 4FAND 4A0AA 2AGXA 3DXKC 5EARA 4GGDA 5FA5B 3OKYB 2H6QA 4X63B 5EM2B 1SQJA 5GXHA 3RSEC 4J87A 4D0KA 4GQ1A 2CO0A 3FGBA 2H6NA 3SJLD 3UVNA 1R5MA 1GOTB 3F3PA 5IC7A 4A09A 4E54A 2P9NC 2QXVA 4ZOYA 3RFGA 3AL9A 4ZOVA 4CZYA 2PM9A 3JPXA 4QT8A 2HJ4A 4CY1A 1GP2B 1SQ9A 2H68A 3A0FA 4GM8A 4A11B 4BH6A 4JT5C 4J77A 3FRXA 1NEXB 4ZOXA 2AGYA 4H5IA 3SMRA 3VA6A 3OKWA 3VGZA 4ESGA 4O3TB
chains in the Genus database with same CATH superfamily
1H2XA 2H14A 2B5NA 2CO0C 3MUOA 1JMXB 2HJBA 4XEIC 3I7NA 3GFCA 3NIFA 3NIDA 2W18A 1E5TA 2J56H 4PSWB 4WK4A 3MKSB 3L4OD 4CI8A 4O02A 3SLED 4JSPC 2BCJB 1VE7A 4GZ8A 5FFOA 4O9DA 1H2ZA 3JZHA 3ZE0A 3AH8B 2VDPA 4JD2C 4O45A 4J78A 3GC3B 4GQ2P 4TZ4A 3VI4A 1GG2B 1YR2A 4LG9A 4G1MA 4BL0A 2CE9A 4HDJA 3L4MD 3UVLA 1VZ2A 3AL8B 3ZWLB 2CE8A 2H9NA 4WK2A 1E8MA 4LGNA 3SN6B 4FA9D 4K3ID 1MG3A 4A0BB 3I7OA 4G1EA 5H17A 4CI3A 3DXMC 5JWZA 5GMKn 4E5ZA 4BP9A 4CI1A 1UOPA 1OLZA 1VE6A 3JROA 3IUMA 2Q7QA 3OL2B 3PSLA 4PC0A 3UVKA 3V4PA 2Z2NA 4AN0A 1BPOA 4FB1D 3U4YA 2GC7A 3PE7A 3PXSD 3QI0A 3DDUA 2H13A 2HXCA 2I3SA 2Z2PA 4U1EI 2EIEA 3IIYA 4A08A 1N6FA 4CY2A 3JZNA 1OMWB 2IUVA 2IUQA 4YVDA 4J81A 3MXXA 5M5UA 3P4FA 3VH0A 1C9LA 3MMYA 4ES0A 1U4CA 4ERZA 5CYKB 5HE0B 3OTTA 1UTCA 1QNIA 2XU7A 4J8GA 2HU7A 1PI6A 3I7PA 4EWRA 4Z8LA 5HE2B 2VDOA 3K71A 2I0TA 2GC4A 4L3HD 2VC2A 3NVXA 2VDNA 1K8KC 3W15A 3V7DB 2AQ5A 3T3MA 2BKLA 4NBMA 3B7FA 1XHMA 5TEFA 2OIZA 3SVWD 4AEZA 1L0QA 5AJAA 3I2NA 3IURA 4FA1D 4BP8A 2TRCB 3IKOA 2I3TA 1JMZB 2WQ8A 2AGZA 2PM6B 3EI2A 3ZDYA 2Z2OA 4GGCA 4AX4A 2IAAA 4RE6A 4IA9A 2P9UC 5C92A 1NR0A 1A12A 1TYQC 4O3UB 4JHNA 4AN1A 5H1MA 2J55H 2XL2A 3I89A 3I7KA 3J81g 5I5MA 1H2YA 4L1QD 1JOFA 5CXBA 2JKXA 2OK4A 3OKTA 4AMYA 2B4EA 4JXMA 3VI3A 3SCYA 2G99A 2VDQA 3GD1I 3EI1A 3MZLA 4CY3A 2YNPA 3PVUB 1K3IA 4A2LA 3K26A 3OKYA 3EI4B 5EM2A 3JZGA 1N6EA 1B9YA 2CN3A 2CNXA 5FLXg 1VYHC 5CXCB 3SBRA 1TBGA 2YNNA 5FFGA 5TF2A 5IJ8E 4QAMA 5E6UA 5HYNB 4BUJC 3F3GA 1L5GA 1PBYB 1I2MB 3T3PA 3AFCA 2H9LA 2HESX 4A11A 5E6RA 1JJUB 5FKSA 3KCIA 2P9SC 5K1CC 1QFMA 2XE4A 3EQ7A 1PGUA 5M5RA 4QL1A 3IULA 3ZE2A 1MG2A 3RLMD 3IUJA 1M1XA 4PXWA 5FQDA 4WJKA 4J86A 4RE5A 3EI3A 3UVOA 5THAA 5GXIA 3SFZA 3E0CA 3K72A 2QZPA 3FM0A 4J82A 3RMZD 2EIBA 3BG0A 3I8CA 2YBAA 1FWXA 1E8NA 3MKQA 4UM8A 3UKUC 2H6KA 3IJ0A 4A08B 5EMKB 1T2XA 5I5JA 4GM9A 3NIGA 3PXTD 2UZYB 4FHLA 4O1QD 4A7JA 2VDLA 3AL8A 2GNQA 4J8BA 2P9KC 4KFMB 4G55A 5HE1B 3BWSA 3ZDZA 4XYHA 1O6FA 3EWEA 2H9MA 4A0BA 3UR4A 2XZGA 1XKSA 2B5MA 2VDMA 1GOHA 1JV2A 4DNUA 4GMBA 3K27A 2I0SA 2YB8B 4J73A 3NVQA 3MZKA 3ULEC 5C86A 2YMUA 3RN1D 4NSXA 4NENA 3OL2A 5IGQA 3J80g 3IUQA 3JB9L 3I8EA 3MUNA 3EG6A 2AH0A 3C75H 2EIDA 4A0AB 2P9IC 3IJCA 3V9FA 1SHYB 5M5VA 3I7HA 5CYKA 5HE3B 3IJ1A 1P22A 2HU5A 5M5SA 3DWLC 4PSXB 2OVRB 5GSAA 4QQEA 2HKMA 4IMMA 4MK0B 4O2WA 4A09B 4E54B 1UOOA 3CIKB 4GQBB 1B9XA 3PSCB 3C5MA 4JT6C 4I79A 2H9PA 4CZXA 2O9KA 3N0DA 1S4UX 3K6SA 2B5LA 2PM9B 3KRXB 5KDOB 3EQ9A 2IWFA 4PNKB 4AMZA 5I5IA 2P9LC 3F3FA 1N6DA 3UVMA 3RFHA 2XDWA 5FXYA 3NVNA 2H3XA 5C2WB 4FAVD 3CFVA 4ERQA 3EQ8A 2OVPB 4J0WA 4ZOZA 3KRWB 1U2VC 4N14A 4D6VA 1O6GA 3JRPA 3SWSD 3IJEA 4XYIA 2QC5A 2EBSA 3DSMA 4ZN4A 4Z7QA 4H5JA 4Y5RD 3OW8A 3C9CA 2HYEA 4NC4A 5B4WA 2HU8A 4K3JB 2IUPA 1UOQA 3ZE1A 2OJYA 3SBQA 4CY5A 4ERYA 5IJ7E 3PXWD 3SXTD 4PBZA 5EMMB 4L1MA 2XL3A 3ODTA 5EAMA 1Q47A 2VZ1A 3EMHA 3EI4A 3EI3B 2H47A 4OZUA 2I0RA 2AH1A 4E5ZB 5H14A 5CXCA 4J0XA 4JSNC 4DNVA 2XYIA 5IGOA 3IIWA 3SBPA 5EMJB 3MVDK 2EICA 3DM0A 3HFQA 3IUNA 3CFSB 5M5TA 4J84A 2HKRA 1ERJA 5M61A 2AGLA 2OK6A 2MTAH 2IURA 4JSVC 4JSXC 3FCUA 4IRZA 3QHYB 3ORVD 2BBKH 5FKRA 2UZXB 4Y7RA 3GREA 1GOGA 2OVQB 4FA5D 5K19A 4GGAA 1QFSA 4FWWA 4CZVA 4NAAA 3FCSA 5A2Qg 2G9AA 1TYEA 4GM3A 2VZ3A 1H2WA 1MDAH 4R7AB 5TEEA 3UKRC 3JAMg 2P9PC 1A0RB 3PVWB 4BCDA 1YFQA 3RRMC 4L3GD 5AMSA 5TDHB 5C2VB 3O4HA 2IWKA 5FKQA 1XIPA 5EMLB 1RI6A 2PM7B 4X3EA 3N0EA 3RN0D 3I7LA 4FA4D 2AGWA 3V5WB 4PBYA 4L9OA 4CC9A 1VZ3A 4UI9R 3O4IA 5SXMA 1GXRA 3EU7A 1GOFA 3O4JA 3EI2B 4BCCA 5EALA 3IVMA 4UM9A 1U8CA 4QRJA 2J57G 4CI2A 5EAPA 1K32A 4LG8A 4OWRA 2QR5A 5FKTA 4J79A 5IT9g 3OF7A 4X60B 4AOWA 2YNOA 5HQGA 4G56B 2PBIB 5AFU3 5CXBB 3V4VA 3SHFA 2CN2A 5C9ZB 3BG1A 1PEVA 4Z7NA 4U7AA 4A2MA 3EI1B 3C99A 4WK0A 4D9SA 4X61B 4FAND 4A0AA 2AGXA 3DXKC 5EARA 4GGDA 5FA5B 3OKYB 2H6QA 4X63B 5EM2B 1SQJA 5GXHA 3RSEC 4J87A 4D0KA 4DNWA 4MMZA 4GQ1A 2CO0A 5E6SA 3FGBA 4MMYA 2H6NA 3SJLD 1JTDB 1R5MA 2VDRA 3UVNA 1GOTB 3F3PA 5IC7A 4A09A 4E54A 2P9NC 2QXVA 2VDKA 5HDBA 4ZOYA 3RFGA 3AL9A 1C9IA 4ZOVA 4CZYA 2PM9A 3JPXA 4QT8A 2HJ4A 4CY1A 1GP2B 1SQ9A 2H68A 3A0FA 4GM8A 4JHPC 4A11B 4JT5C 4BH6A 4J77A 3FRXA 1NEXB 4ZOXA 2AGYA 4H5IA 4BCBA 4MMXA 4Z7OA 3SMRA 3VA6A 3ZDXA 3OKWA 3VGZA 3O4GA 4ESGA 4O3TB
chains in the Genus database with same CATH topology
2H14A 2B5NA 2CO0C 1JMXB 2HJBA 4XEIC 3I7NA 3GFCA 2W18A 2J56H 4PSWB 3MKSB 3L4OD 4CI8A 3SLED 4JSPC 2BCJB 4GZ8A 4O9DA 3JZHA 3AH8B 4JD2C 4O45A 4J78A 4GQ2P 4TZ4A 1GG2B 4LG9A 4BL0A 2CE9A 4HDJA 3L4MD 3UVLA 3AL8B 3ZWLB 2CE8A 2H9NA 4LGNA 3SN6B 4FA9D 4K3ID 1MG3A 4A0BB 3I7OA 5H17A 4CI3A 3DXMC 5JWZA 5GMKn 4E5ZA 4CI1A 1OLZA 3JROA 2Q7QA 3OL2B 3PSLA 4PC0A 3UVKA 2Z2NA 3U4YA 4FB1D 2GC7A 3PE7A 3PXSD 2H13A 2HXCA 2I3SA 2Z2PA 4U1EI 3IIYA 4A08A 1N6FA 4CY2A 3JZNA 1OMWB 2IUVA 2IUQA 4YVDA 4J81A 3MXXA 3P4FA 3VH0A 3MMYA 4ES0A 1U4CA 4ERZA 5CYKB 5HE0B 3OTTA 1QNIA 2XU7A 4J8GA 1PI6A 3I7PA 4EWRA 4Z8LA 5HE2B 2I0TA 2GC4A 4L3HD 3NVXA 1K8KC 3W15A 3V7DB 2AQ5A 3B7FA 1XHMA 5TEFA 2OIZA 3SVWD 4AEZA 1L0QA 5AJAA 3I2NA 4FA1D 2TRCB 3IKOA 2I3TA 1JMZB 2AGZA 2PM6B 3EI2A 2Z2OA 4GGCA 2IAAA 4IA9A 2P9UC 1NR0A 1TYQC 4O3UB 5H1MA 2J55H 2XL2A 3I89A 3I7KA 3J81g 5I5MA 4L1QD 1JOFA 5CXBA 2OK4A 3OKTA 2B4EA 4JXMA 3SCYA 2G99A 3EI1A 3MZLA 4CY3A 2YNPA 3PVUB 4A2LA 3K26A 3OKYA 3EI4B 5EM2A 3JZGA 1N6EA 1B9YA 2CN3A 2CNXA 5FLXg 1VYHC 5CXCB 3SBRA 1TBGA 2YNNA 5TF2A 5IJ8E 5HYNB 4BUJC 3F3GA 1PBYB 3AFCA 2H9LA 2HESX 4A11A 1JJUB 5FKSA 2P9SC 5K1CC 1PGUA 4QL1A 1MG2A 3RLMD 4PXWA 5FQDA 4J86A 3EI3A 3UVOA 5THAA 5GXIA 3SFZA 3E0CA 3FM0A 4J82A 3RMZD 3BG0A 3I8CA 2YBAA 1FWXA 3MKQA 3UKUC 2H6KA 3IJ0A 4A08B 5EMKB 5I5JA 4GM9A 3PXTD 2UZYB 4FHLA 4O1QD 4A7JA 3AL8A 2GNQA 4KFMB 2P9KC 4J8BA 5HE1B 3BWSA 4XYHA 3EWEA 2H9MA 4A0BA 3UR4A 1XKSA 2B5MA 4GMBA 3K27A 2I0SA 2YB8B 4J73A 3NVQA 3MZKA 3ULEC 2YMUA 3RN1D 4NSXA 3OL2A 5IGQA 3J80g 3JB9L 3I8EA 3EG6A 2AH0A 3C75H 4A0AB 2P9IC 3IJCA 3V9FA 1SHYB 3I7HA 5CYKA 5HE3B 3IJ1A 1P22A 3DWLC 4PSXB 2OVRB 5GSAA 4QQEA 2HKMA 4IMMA 4MK0B 4A09B 4E54B 3CIKB 4GQBB 1B9XA 3PSCB 3C5MA 4JT6C 4I79A 2H9PA 4CZXA 2O9KA 3N0DA 1S4UX 2B5LA 2PM9B 3KRXB 5KDOB 2IWFA 4PNKB 5I5IA 2P9LC 3F3FA 1N6DA 3UVMA 3RFHA 5FXYA 3NVNA 2H3XA 5C2WB 4FAVD 3CFVA 4ERQA 2OVPB 4J0WA 4ZOZA 3KRWB 1U2VC 4N14A 4D6VA 3JRPA 3SWSD 4XYIA 2QC5A 2EBSA 3DSMA 4ZN4A 4H5JA 4Y5RD 3OW8A 3C9CA 2HYEA 5B4WA 4K3JB 2IUPA 2OJYA 3SBQA 4CY5A 4ERYA 5IJ7E 3PXWD 3SXTD 4PBZA 5EMMB 2XL3A 3ODTA 5EAMA 1Q47A 3EMHA 3EI4A 3EI3B 2H47A 4OZUA 2I0RA 2AH1A 4E5ZB 5H14A 5CXCA 4J0XA 4JSNC 2XYIA 5IGOA 3IIWA 3SBPA 5EMJB 3DM0A 3HFQA 3CFSB 4J84A 2HKRA 1ERJA 2AGLA 2OK6A 2MTAH 2IURA 4JSVC 4JSXC 3ORVD 2BBKH 5FKRA 2UZXB 4Y7RA 3GREA 2OVQB 4FA5D 5K19A 4GGAA 4FWWA 4CZVA 5A2Qg 2G9AA 4GM3A 1MDAH 4R7AB 5TEEA 3UKRC 3JAMg 2P9PC 1A0RB 3PVWB 1YFQA 3RRMC 4L3GD 5AMSA 5TDHB 5C2VB 2IWKA 5FKQA 1XIPA 5EMLB 1RI6A 2PM7B 4X3EA 3N0EA 3RN0D 3I7LA 4FA4D 2AGWA 3V5WB 4PBYA 4L9OA 4CC9A 4UI9R 5SXMA 1GXRA 3EU7A 3EI2B 5EALA 4QRJA 2J57G 4CI2A 5EAPA 1K32A 4LG8A 4OWRA 5FKTA 4J79A 5IT9g 4X60B 4AOWA 2YNOA 5HQGA 4G56B 2PBIB 5AFU3 5CXBB 3SHFA 2CN2A 5C9ZB 3BG1A 1PEVA 4U7AA 4A2MA 3EI1B 3C99A 4X61B 4FAND 4A0AA 2AGXA 3DXKC 5EARA 4GGDA 5FA5B 3OKYB 2H6QA 4X63B 5EM2B 1SQJA 5GXHA 3RSEC 4J87A 4D0KA 4GQ1A 2CO0A 3FGBA 2H6NA 3SJLD 3UVNA 1R5MA 1GOTB 3F3PA 5IC7A 4A09A 4E54A 2P9NC 2QXVA 4ZOYA 3RFGA 3AL9A 4ZOVA 4CZYA 2PM9A 3JPXA 4QT8A 2HJ4A 4CY1A 1GP2B 1SQ9A 2H68A 3A0FA 4GM8A 4A11B 4BH6A 4JT5C 4J77A 3FRXA 1NEXB 4ZOXA 2AGYA 4H5IA 3SMRA 3VA6A 3OKWA 3VGZA 4ESGA 4O3TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H14 A;  2B5N A;  2CO0 C;  1JMX B;  2HJB A;  4XEI C;  3I7N A;  3GFC A;  2W18 A;  2J56 H;  4PSW B;  3MKS B;  3L4O D;  4CI8 A;  3SLE D;  4JSP C;  2BCJ B;  4GZ8 A;  4O9D A;  3JZH A;  3AH8 B;  4JD2 C;  4O45 A;  4J78 A;  4GQ2 P;  4TZ4 A;  1GG2 B;  4LG9 A;  4BL0 A;  2CE9 A;  4HDJ A;  3L4M D;  3UVL A;  3AL8 B;  3ZWL B;  2CE8 A;  2H9N A;  4LGN A;  3SN6 B;  4FA9 D;  4K3I D;  1MG3 A;  4A0B B;  3I7O A;  5H17 A;  4CI3 A;  3DXM C;  5JWZ A;  5GMK n;  4E5Z A;  4CI1 A;  1OLZ A;  3JRO A;  2Q7Q A;  3OL2 B;  3PSL A;  4PC0 A;  3UVK A;  2Z2N A;  3U4Y A;  4FB1 D;  2GC7 A;  3PE7 A;  3PXS D;  2H13 A;  2HXC A;  2I3S A;  2Z2P A;  4U1E I;  3IIY A;  4A08 A;  1N6F A;  4CY2 A;  3JZN A;  1OMW B;  2IUV A;  2IUQ A;  4YVD A;  4J81 A;  3MXX A;  3P4F A;  3VH0 A;  3MMY A;  4ES0 A;  1U4C A;  4ERZ A;  5CYK B;  5HE0 B;  3OTT A;  1QNI A;  2XU7 A;  4J8G A;  1PI6 A;  3I7P A;  4EWR A;  4Z8L A;  5HE2 B;  2I0T A;  2GC4 A;  4L3H D;  3NVX A;  1K8K C;  3W15 A;  3V7D B;  2AQ5 A;  3B7F A;  1XHM A;  5TEF A;  2OIZ A;  3SVW D;  4AEZ A;  1L0Q A;  5AJA A;  3I2N A;  4FA1 D;  2TRC B;  3IKO A;  2I3T A;  1JMZ B;  2AGZ A;  2PM6 B;  3EI2 A;  2Z2O A;  4GGC A;  2IAA A;  4IA9 A;  2P9U C;  1NR0 A;  1TYQ C;  4O3U B;  5H1M A;  2J55 H;  2XL2 A;  3I89 A;  3I7K A;  3J81 g;  5I5M A;  4L1Q D;  1JOF A;  5CXB A;  2OK4 A;  3OKT A;  2B4E A;  4JXM A;  3SCY A;  2G99 A;  3EI1 A;  3MZL A;  4CY3 A;  2YNP A;  3PVU B;  4A2L A;  3K26 A;  3OKY A;  3EI4 B;  5EM2 A;  3JZG A;  1N6E A;  1B9Y A;  2CN3 A;  2CNX A;  5FLX g;  1VYH C;  5CXC B;  3SBR A;  1TBG A;  2YNN A;  5TF2 A;  5IJ8 E;  5HYN B;  4BUJ C;  3F3G A;  1PBY B;  3AFC A;  2H9L A;  2HES X;  4A11 A;  1JJU B;  5FKS A;  2P9S C;  5K1C C;  1PGU A;  4QL1 A;  1MG2 A;  3RLM D;  4PXW A;  5FQD A;  4J86 A;  3EI3 A;  3UVO A;  5THA A;  5GXI A;  3SFZ A;  3E0C A;  3FM0 A;  4J82 A;  3RMZ D;  3BG0 A;  3I8C A;  2YBA A;  1FWX A;  3MKQ A;  3UKU C;  2H6K A;  3IJ0 A;  4A08 B;  5EMK B;  5I5J A;  4GM9 A;  3PXT D;  2UZY B;  4FHL A;  4O1Q D;  4A7J A;  3AL8 A;  2GNQ A;  4KFM B;  2P9K C;  4J8B A;  5HE1 B;  3BWS A;  4XYH A;  3EWE A;  2H9M A;  4A0B A;  3UR4 A;  1XKS A;  2B5M A;  4GMB A;  3K27 A;  2I0S A;  2YB8 B;  4J73 A;  3NVQ A;  3MZK A;  3ULE C;  2YMU A;  3RN1 D;  4NSX A;  3OL2 A;  5IGQ A;  3J80 g;  3JB9 L;  3I8E A;  3EG6 A;  2AH0 A;  3C75 H;  4A0A B;  2P9I C;  3IJC A;  3V9F A;  1SHY B;  3I7H A;  5CYK A;  5HE3 B;  3IJ1 A;  1P22 A;  3DWL C;  4PSX B;  2OVR B;  5GSA A;  4QQE A;  2HKM A;  4IMM A;  4MK0 B;  4A09 B;  4E54 B;  3CIK B;  4GQB B;  1B9X A;  3PSC B;  3C5M A;  4JT6 C;  4I79 A;  2H9P A;  4CZX A;  2O9K A;  3N0D A;  1S4U X;  2B5L A;  2PM9 B;  3KRX B;  5KDO B;  2IWF A;  4PNK B;  5I5I A;  2P9L C;  3F3F A;  1N6D A;  3UVM A;  3RFH A;  5FXY A;  3NVN A;  2H3X A;  5C2W B;  4FAV D;  3CFV A;  4ERQ A;  2OVP B;  4J0W A;  4ZOZ A;  3KRW B;  1U2V C;  4N14 A;  4D6V A;  3JRP A;  3SWS D;  4XYI A;  2QC5 A;  2EBS A;  3DSM A;  4ZN4 A;  4H5J A;  4Y5R D;  3OW8 A;  3C9C A;  2HYE A;  5B4W A;  4K3J B;  2IUP A;  2OJY A;  3SBQ A;  4CY5 A;  4ERY A;  5IJ7 E;  3PXW D;  3SXT D;  4PBZ A;  5EMM B;  2XL3 A;  3ODT A;  5EAM A;  1Q47 A;  3EMH A;  3EI4 A;  3EI3 B;  2H47 A;  4OZU A;  2I0R A;  2AH1 A;  4E5Z B;  5H14 A;  5CXC A;  4J0X A;  4JSN C;  2XYI A;  5IGO A;  3IIW A;  3SBP A;  5EMJ B;  3DM0 A;  3HFQ A;  3CFS B;  4J84 A;  2HKR A;  1ERJ A;  2AGL A;  2OK6 A;  2MTA H;  2IUR A;  4JSV C;  4JSX C;  3ORV D;  2BBK H;  5FKR A;  2UZX B;  4Y7R A;  3GRE A;  2OVQ B;  4FA5 D;  5K19 A;  4GGA A;  4FWW A;  4CZV A;  5A2Q g;  2G9A A;  4GM3 A;  1MDA H;  4R7A B;  5TEE A;  3UKR C;  3JAM g;  2P9P C;  1A0R B;  3PVW B;  1YFQ A;  3RRM C;  4L3G D;  5AMS A;  5TDH B;  5C2V B;  2IWK A;  5FKQ A;  1XIP A;  5EML B;  1RI6 A;  2PM7 B;  4X3E A;  3N0E A;  3RN0 D;  3I7L A;  4FA4 D;  2AGW A;  3V5W B;  4PBY A;  4L9O A;  4CC9 A;  4UI9 R;  5SXM A;  1GXR A;  3EU7 A;  3EI2 B;  5EAL A;  4QRJ A;  2J57 G;  4CI2 A;  5EAP A;  1K32 A;  4LG8 A;  4OWR A;  5FKT A;  4J79 A;  5IT9 g;  4X60 B;  4AOW A;  2YNO A;  5HQG A;  4G56 B;  2PBI B;  5AFU 3;  5CXB B;  3SHF A;  2CN2 A;  5C9Z B;  3BG1 A;  1PEV A;  4U7A A;  4A2M A;  3EI1 B;  3C99 A;  4X61 B;  4FAN D;  4A0A A;  2AGX A;  3DXK C;  5EAR A;  4GGD A;  5FA5 B;  3OKY B;  2H6Q A;  4X63 B;  5EM2 B;  1SQJ A;  5GXH A;  3RSE C;  4J87 A;  4D0K A;  4GQ1 A;  2CO0 A;  3FGB A;  2H6N A;  3SJL D;  3UVN A;  1R5M A;  1GOT B;  3F3P A;  5IC7 A;  4A09 A;  4E54 A;  2P9N C;  2QXV A;  4ZOY A;  3RFG A;  3AL9 A;  4ZOV A;  4CZY A;  2PM9 A;  3JPX A;  4QT8 A;  2HJ4 A;  4CY1 A;  1GP2 B;  1SQ9 A;  2H68 A;  3A0F A;  4GM8 A;  4A11 B;  4BH6 A;  4JT5 C;  4J77 A;  3FRX A;  1NEX B;  4ZOX A;  2AGY A;  4H5I A;  3SMR A;  3VA6 A;  3OKW A;  3VGZ A;  4ESG A;  4O3T B; 
#chains in the Genus database with same CATH topology
 1H2X A;  2H14 A;  2B5N A;  2CO0 C;  3MUO A;  1JMX B;  2HJB A;  4XEI C;  3I7N A;  3GFC A;  3NIF A;  3NID A;  2W18 A;  1E5T A;  2J56 H;  4PSW B;  4WK4 A;  3MKS B;  3L4O D;  4CI8 A;  4O02 A;  3SLE D;  4JSP C;  2BCJ B;  1VE7 A;  4GZ8 A;  5FFO A;  4O9D A;  1H2Z A;  3JZH A;  3ZE0 A;  3AH8 B;  2VDP A;  4JD2 C;  4O45 A;  4J78 A;  3GC3 B;  4GQ2 P;  4TZ4 A;  3VI4 A;  1GG2 B;  1YR2 A;  4LG9 A;  4G1M A;  4BL0 A;  2CE9 A;  4HDJ A;  3L4M D;  3UVL A;  1VZ2 A;  3AL8 B;  3ZWL B;  2CE8 A;  2H9N A;  4WK2 A;  1E8M A;  4LGN A;  3SN6 B;  4FA9 D;  4K3I D;  1MG3 A;  4A0B B;  3I7O A;  4G1E A;  5H17 A;  4CI3 A;  3DXM C;  5JWZ A;  5GMK n;  4E5Z A;  4BP9 A;  4CI1 A;  1UOP A;  1OLZ A;  1VE6 A;  3JRO A;  3IUM A;  2Q7Q A;  3OL2 B;  3PSL A;  4PC0 A;  3UVK A;  3V4P A;  2Z2N A;  4AN0 A;  1BPO A;  4FB1 D;  3U4Y A;  2GC7 A;  3PE7 A;  3PXS D;  3QI0 A;  3DDU A;  2H13 A;  2HXC A;  2I3S A;  2Z2P A;  4U1E I;  2EIE A;  3IIY A;  4A08 A;  1N6F A;  4CY2 A;  3JZN A;  1OMW B;  2IUV A;  2IUQ A;  4YVD A;  4J81 A;  3MXX A;  5M5U A;  3P4F A;  3VH0 A;  1C9L A;  3MMY A;  4ES0 A;  1U4C A;  4ERZ A;  5CYK B;  5HE0 B;  3OTT A;  1UTC A;  1QNI A;  2XU7 A;  4J8G A;  2HU7 A;  1PI6 A;  3I7P A;  4EWR A;  4Z8L A;  5HE2 B;  2VDO A;  3K71 A;  2I0T A;  2GC4 A;  4L3H D;  2VC2 A;  3NVX A;  2VDN A;  1K8K C;  3W15 A;  3V7D B;  2AQ5 A;  3T3M A;  2BKL A;  4NBM A;  3B7F A;  1XHM A;  5TEF A;  2OIZ A;  3SVW D;  4AEZ A;  1L0Q A;  5AJA A;  3I2N A;  3IUR A;  4FA1 D;  4BP8 A;  2TRC B;  3IKO A;  2I3T A;  1JMZ B;  2WQ8 A;  2AGZ A;  2PM6 B;  3EI2 A;  3ZDY A;  2Z2O A;  4GGC A;  4AX4 A;  2IAA A;  4RE6 A;  4IA9 A;  2P9U C;  5C92 A;  1NR0 A;  1A12 A;  1TYQ C;  4O3U B;  4JHN A;  4AN1 A;  5H1M A;  2J55 H;  2XL2 A;  3I89 A;  3I7K A;  3J81 g;  5I5M A;  1H2Y A;  4L1Q D;  1JOF A;  5CXB A;  2JKX A;  2OK4 A;  3OKT A;  4AMY A;  2B4E A;  4JXM A;  3VI3 A;  3SCY A;  2G99 A;  2VDQ A;  3GD1 I;  3EI1 A;  3MZL A;  4CY3 A;  2YNP A;  3PVU B;  1K3I A;  4A2L A;  3K26 A;  3OKY A;  3EI4 B;  5EM2 A;  3JZG A;  1N6E A;  1B9Y A;  2CN3 A;  2CNX A;  5FLX g;  1VYH C;  5CXC B;  3SBR A;  1TBG A;  2YNN A;  5FFG A;  5TF2 A;  5IJ8 E;  4QAM A;  5E6U A;  5HYN B;  4BUJ C;  3F3G A;  1L5G A;  1PBY B;  1I2M B;  3T3P A;  3AFC A;  2H9L A;  2HES X;  4A11 A;  5E6R A;  1JJU B;  5FKS A;  3KCI A;  2P9S C;  5K1C C;  1QFM A;  2XE4 A;  3EQ7 A;  1PGU A;  5M5R A;  4QL1 A;  3IUL A;  3ZE2 A;  1MG2 A;  3RLM D;  3IUJ A;  1M1X A;  4PXW A;  5FQD A;  4WJK A;  4J86 A;  4RE5 A;  3EI3 A;  3UVO A;  5THA A;  5GXI A;  3SFZ A;  3E0C A;  3K72 A;  2QZP A;  3FM0 A;  4J82 A;  3RMZ D;  2EIB A;  3BG0 A;  3I8C A;  2YBA A;  1FWX A;  1E8N A;  3MKQ A;  4UM8 A;  3UKU C;  2H6K A;  3IJ0 A;  4A08 B;  5EMK B;  1T2X A;  5I5J A;  4GM9 A;  3NIG A;  3PXT D;  2UZY B;  4FHL A;  4O1Q D;  4A7J A;  2VDL A;  3AL8 A;  2GNQ A;  4J8B A;  2P9K C;  4KFM B;  4G55 A;  5HE1 B;  3BWS A;  3ZDZ A;  4XYH A;  1O6F A;  3EWE A;  2H9M A;  4A0B A;  3UR4 A;  2XZG A;  1XKS A;  2B5M A;  2VDM A;  1GOH A;  1JV2 A;  4DNU A;  4GMB A;  3K27 A;  2I0S A;  2YB8 B;  4J73 A;  3NVQ A;  3MZK A;  3ULE C;  5C86 A;  2YMU A;  3RN1 D;  4NSX A;  4NEN A;  3OL2 A;  5IGQ A;  3J80 g;  3IUQ A;  3JB9 L;  3I8E A;  3MUN A;  3EG6 A;  2AH0 A;  3C75 H;  2EID A;  4A0A B;  2P9I C;  3IJC A;  3V9F A;  1SHY B;  5M5V A;  3I7H A;  5CYK A;  5HE3 B;  3IJ1 A;  1P22 A;  2HU5 A;  5M5S A;  3DWL C;  4PSX B;  2OVR B;  5GSA A;  4QQE A;  2HKM A;  4IMM A;  4MK0 B;  4O2W A;  4A09 B;  4E54 B;  1UOO A;  3CIK B;  4GQB B;  1B9X A;  3PSC B;  3C5M A;  4JT6 C;  4I79 A;  2H9P A;  4CZX A;  2O9K A;  3N0D A;  1S4U X;  3K6S A;  2B5L A;  2PM9 B;  3KRX B;  5KDO B;  3EQ9 A;  2IWF A;  4PNK B;  4AMZ A;  5I5I A;  2P9L C;  3F3F A;  1N6D A;  3UVM A;  3RFH A;  2XDW A;  5FXY A;  3NVN A;  2H3X A;  5C2W B;  4FAV D;  3CFV A;  4ERQ A;  3EQ8 A;  2OVP B;  4J0W A;  4ZOZ A;  3KRW B;  1U2V C;  4N14 A;  4D6V A;  1O6G A;  3JRP A;  3SWS D;  3IJE A;  4XYI A;  2QC5 A;  2EBS A;  3DSM A;  4ZN4 A;  4Z7Q A;  4H5J A;  4Y5R D;  3OW8 A;  3C9C A;  2HYE A;  4NC4 A;  5B4W A;  2HU8 A;  4K3J B;  2IUP A;  1UOQ A;  3ZE1 A;  2OJY A;  3SBQ A;  4CY5 A;  4ERY A;  5IJ7 E;  3PXW D;  3SXT D;  4PBZ A;  5EMM B;  4L1M A;  2XL3 A;  3ODT A;  5EAM A;  1Q47 A;  2VZ1 A;  3EMH A;  3EI4 A;  3EI3 B;  2H47 A;  4OZU A;  2I0R A;  2AH1 A;  4E5Z B;  5H14 A;  5CXC A;  4J0X A;  4JSN C;  4DNV A;  2XYI A;  5IGO A;  3IIW A;  3SBP A;  5EMJ B;  3MVD K;  2EIC A;  3DM0 A;  3HFQ A;  3IUN A;  3CFS B;  5M5T A;  4J84 A;  2HKR A;  1ERJ A;  5M61 A;  2AGL A;  2OK6 A;  2MTA H;  2IUR A;  4JSV C;  4JSX C;  3FCU A;  4IRZ A;  3QHY B;  3ORV D;  2BBK H;  5FKR A;  2UZX B;  4Y7R A;  3GRE A;  1GOG A;  2OVQ B;  4FA5 D;  5K19 A;  4GGA A;  1QFS A;  4FWW A;  4CZV A;  4NAA A;  3FCS A;  5A2Q g;  2G9A A;  1TYE A;  4GM3 A;  2VZ3 A;  1H2W A;  1MDA H;  4R7A B;  5TEE A;  3UKR C;  3JAM g;  2P9P C;  1A0R B;  3PVW B;  4BCD A;  1YFQ A;  3RRM C;  4L3G D;  5AMS A;  5TDH B;  5C2V B;  3O4H A;  2IWK A;  5FKQ A;  1XIP A;  5EML B;  1RI6 A;  2PM7 B;  4X3E A;  3N0E A;  3RN0 D;  3I7L A;  4FA4 D;  2AGW A;  3V5W B;  4PBY A;  4L9O A;  4CC9 A;  1VZ3 A;  4UI9 R;  3O4I A;  5SXM A;  1GXR A;  3EU7 A;  1GOF A;  3O4J A;  3EI2 B;  4BCC A;  5EAL A;  3IVM A;  4UM9 A;  1U8C A;  4QRJ A;  2J57 G;  4CI2 A;  5EAP A;  1K32 A;  4LG8 A;  4OWR A;  2QR5 A;  5FKT A;  4J79 A;  5IT9 g;  3OF7 A;  4X60 B;  4AOW A;  2YNO A;  5HQG A;  4G56 B;  2PBI B;  5AFU 3;  5CXB B;  3V4V A;  3SHF A;  2CN2 A;  5C9Z B;  3BG1 A;  1PEV A;  4Z7N A;  4U7A A;  4A2M A;  3EI1 B;  3C99 A;  4WK0 A;  4D9S A;  4X61 B;  4FAN D;  4A0A A;  2AGX A;  3DXK C;  5EAR A;  4GGD A;  5FA5 B;  3OKY B;  2H6Q A;  4X63 B;  5EM2 B;  1SQJ A;  5GXH A;  3RSE C;  4J87 A;  4D0K A;  4DNW A;  4MMZ A;  4GQ1 A;  2CO0 A;  5E6S A;  3FGB A;  4MMY A;  2H6N A;  3SJL D;  1JTD B;  1R5M A;  2VDR A;  3UVN A;  1GOT B;  3F3P A;  5IC7 A;  4A09 A;  4E54 A;  2P9N C;  2QXV A;  2VDK A;  5HDB A;  4ZOY A;  3RFG A;  3AL9 A;  1C9I A;  4ZOV A;  4CZY A;  2PM9 A;  3JPX A;  4QT8 A;  2HJ4 A;  4CY1 A;  1GP2 B;  1SQ9 A;  2H68 A;  3A0F A;  4GM8 A;  4JHP C;  4A11 B;  4JT5 C;  4BH6 A;  4J77 A;  3FRX A;  1NEX B;  4ZOX A;  2AGY A;  4H5I A;  4BCB A;  4MMX A;  4Z7O A;  3SMR A;  3VA6 A;  3ZDX A;  3OKW A;  3VGZ A;  3O4G A;  4ESG A;  4O3T B; 
#chains in the Genus database with same CATH homology
 2H14 A;  2B5N A;  2CO0 C;  1JMX B;  2HJB A;  4XEI C;  3I7N A;  3GFC A;  2W18 A;  2J56 H;  4PSW B;  3MKS B;  3L4O D;  4CI8 A;  3SLE D;  4JSP C;  2BCJ B;  4GZ8 A;  4O9D A;  3JZH A;  3AH8 B;  4JD2 C;  4O45 A;  4J78 A;  4GQ2 P;  4TZ4 A;  1GG2 B;  4LG9 A;  4BL0 A;  2CE9 A;  4HDJ A;  3L4M D;  3UVL A;  3AL8 B;  3ZWL B;  2CE8 A;  2H9N A;  4LGN A;  3SN6 B;  4FA9 D;  4K3I D;  1MG3 A;  4A0B B;  3I7O A;  5H17 A;  4CI3 A;  3DXM C;  5JWZ A;  5GMK n;  4E5Z A;  4CI1 A;  1OLZ A;  3JRO A;  2Q7Q A;  3OL2 B;  3PSL A;  4PC0 A;  3UVK A;  2Z2N A;  3U4Y A;  4FB1 D;  2GC7 A;  3PE7 A;  3PXS D;  2H13 A;  2HXC A;  2I3S A;  2Z2P A;  4U1E I;  3IIY A;  4A08 A;  1N6F A;  4CY2 A;  3JZN A;  1OMW B;  2IUV A;  2IUQ A;  4YVD A;  4J81 A;  3MXX A;  3P4F A;  3VH0 A;  3MMY A;  4ES0 A;  1U4C A;  4ERZ A;  5CYK B;  5HE0 B;  3OTT A;  1QNI A;  2XU7 A;  4J8G A;  1PI6 A;  3I7P A;  4EWR A;  4Z8L A;  5HE2 B;  2I0T A;  2GC4 A;  4L3H D;  3NVX A;  1K8K C;  3W15 A;  3V7D B;  2AQ5 A;  3B7F A;  1XHM A;  5TEF A;  2OIZ A;  3SVW D;  4AEZ A;  1L0Q A;  5AJA A;  3I2N A;  4FA1 D;  2TRC B;  3IKO A;  2I3T A;  1JMZ B;  2AGZ A;  2PM6 B;  3EI2 A;  2Z2O A;  4GGC A;  2IAA A;  4IA9 A;  2P9U C;  1NR0 A;  1TYQ C;  4O3U B;  5H1M A;  2J55 H;  2XL2 A;  3I89 A;  3I7K A;  3J81 g;  5I5M A;  4L1Q D;  1JOF A;  5CXB A;  2OK4 A;  3OKT A;  2B4E A;  4JXM A;  3SCY A;  2G99 A;  3EI1 A;  3MZL A;  4CY3 A;  2YNP A;  3PVU B;  4A2L A;  3K26 A;  3OKY A;  3EI4 B;  5EM2 A;  3JZG A;  1N6E A;  1B9Y A;  2CN3 A;  2CNX A;  5FLX g;  1VYH C;  5CXC B;  3SBR A;  1TBG A;  2YNN A;  5TF2 A;  5IJ8 E;  5HYN B;  4BUJ C;  3F3G A;  1PBY B;  3AFC A;  2H9L A;  2HES X;  4A11 A;  1JJU B;  5FKS A;  2P9S C;  5K1C C;  1PGU A;  4QL1 A;  1MG2 A;  3RLM D;  4PXW A;  5FQD A;  4J86 A;  3EI3 A;  3UVO A;  5THA A;  5GXI A;  3SFZ A;  3E0C A;  3FM0 A;  4J82 A;  3RMZ D;  3BG0 A;  3I8C A;  2YBA A;  1FWX A;  3MKQ A;  3UKU C;  2H6K A;  3IJ0 A;  4A08 B;  5EMK B;  5I5J A;  4GM9 A;  3PXT D;  2UZY B;  4FHL A;  4O1Q D;  4A7J A;  3AL8 A;  2GNQ A;  4KFM B;  2P9K C;  4J8B A;  5HE1 B;  3BWS A;  4XYH A;  3EWE A;  2H9M A;  4A0B A;  3UR4 A;  1XKS A;  2B5M A;  4GMB A;  3K27 A;  2I0S A;  2YB8 B;  4J73 A;  3NVQ A;  3MZK A;  3ULE C;  2YMU A;  3RN1 D;  4NSX A;  3OL2 A;  5IGQ A;  3J80 g;  3JB9 L;  3I8E A;  3EG6 A;  2AH0 A;  3C75 H;  4A0A B;  2P9I C;  3IJC A;  3V9F A;  1SHY B;  3I7H A;  5CYK A;  5HE3 B;  3IJ1 A;  1P22 A;  3DWL C;  4PSX B;  2OVR B;  5GSA A;  4QQE A;  2HKM A;  4IMM A;  4MK0 B;  4A09 B;  4E54 B;  3CIK B;  4GQB B;  1B9X A;  3PSC B;  3C5M A;  4JT6 C;  4I79 A;  2H9P A;  4CZX A;  2O9K A;  3N0D A;  1S4U X;  2B5L A;  2PM9 B;  3KRX B;  5KDO B;  2IWF A;  4PNK B;  5I5I A;  2P9L C;  3F3F A;  1N6D A;  3UVM A;  3RFH A;  5FXY A;  3NVN A;  2H3X A;  5C2W B;  4FAV D;  3CFV A;  4ERQ A;  2OVP B;  4J0W A;  4ZOZ A;  3KRW B;  1U2V C;  4N14 A;  4D6V A;  3JRP A;  3SWS D;  4XYI A;  2QC5 A;  2EBS A;  3DSM A;  4ZN4 A;  4H5J A;  4Y5R D;  3OW8 A;  3C9C A;  2HYE A;  5B4W A;  4K3J B;  2IUP A;  2OJY A;  3SBQ A;  4CY5 A;  4ERY A;  5IJ7 E;  3PXW D;  3SXT D;  4PBZ A;  5EMM B;  2XL3 A;  3ODT A;  5EAM A;  1Q47 A;  3EMH A;  3EI4 A;  3EI3 B;  2H47 A;  4OZU A;  2I0R A;  2AH1 A;  4E5Z B;  5H14 A;  5CXC A;  4J0X A;  4JSN C;  2XYI A;  5IGO A;  3IIW A;  3SBP A;  5EMJ B;  3DM0 A;  3HFQ A;  3CFS B;  4J84 A;  2HKR A;  1ERJ A;  2AGL A;  2OK6 A;  2MTA H;  2IUR A;  4JSV C;  4JSX C;  3ORV D;  2BBK H;  5FKR A;  2UZX B;  4Y7R A;  3GRE A;  2OVQ B;  4FA5 D;  5K19 A;  4GGA A;  4FWW A;  4CZV A;  5A2Q g;  2G9A A;  4GM3 A;  1MDA H;  4R7A B;  5TEE A;  3UKR C;  3JAM g;  2P9P C;  1A0R B;  3PVW B;  1YFQ A;  3RRM C;  4L3G D;  5AMS A;  5TDH B;  5C2V B;  2IWK A;  5FKQ A;  1XIP A;  5EML B;  1RI6 A;  2PM7 B;  4X3E A;  3N0E A;  3RN0 D;  3I7L A;  4FA4 D;  2AGW A;  3V5W B;  4PBY A;  4L9O A;  4CC9 A;  4UI9 R;  5SXM A;  1GXR A;  3EU7 A;  3EI2 B;  5EAL A;  4QRJ A;  2J57 G;  4CI2 A;  5EAP A;  1K32 A;  4LG8 A;  4OWR A;  5FKT A;  4J79 A;  5IT9 g;  4X60 B;  4AOW A;  2YNO A;  5HQG A;  4G56 B;  2PBI B;  5AFU 3;  5CXB B;  3SHF A;  2CN2 A;  5C9Z B;  3BG1 A;  1PEV A;  4U7A A;  4A2M A;  3EI1 B;  3C99 A;  4X61 B;  4FAN D;  4A0A A;  2AGX A;  3DXK C;  5EAR A;  4GGD A;  5FA5 B;  3OKY B;  2H6Q A;  4X63 B;  5EM2 B;  1SQJ A;  5GXH A;  3RSE C;  4J87 A;  4D0K A;  4GQ1 A;  2CO0 A;  3FGB A;  2H6N A;  3SJL D;  3UVN A;  1R5M A;  1GOT B;  3F3P A;  5IC7 A;  4A09 A;  4E54 A;  2P9N C;  2QXV A;  4ZOY A;  3RFG A;  3AL9 A;  4ZOV A;  4CZY A;  2PM9 A;  3JPX A;  4QT8 A;  2HJ4 A;  4CY1 A;  1GP2 B;  1SQ9 A;  2H68 A;  3A0F A;  4GM8 A;  4A11 B;  4BH6 A;  4JT5 C;  4J77 A;  3FRX A;  1NEX B;  4ZOX A;  2AGY A;  4H5I A;  3SMR A;  3VA6 A;  3OKW A;  3VGZ A;  4ESG A;  4O3T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...