3EU7A

Crystal structure of a palb2 / brca2 complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
333
structure length
312
Chain Sequence
b'NLQLVSELKNPSGSCSVDVSAMFWEGCKEPCIITACEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCSEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAGGGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLSHPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHAAAILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Partner and localizer of BRCA2
publication title Structural basis for recruitment of BRCA2 by PALB2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/antitumor protein
total genus 63
structure length 312
sequence length 333
ec nomenclature
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16756 PALB2_WD40 Partner and localizer of BRCA2 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3eu7A00
3I7KA 4A0AB 3W15A 3UVKA 2IUVA 3CIKB 1XHMA 3BG0A 5IJ8E 1SHYB 5EMLB 4A08A 3L4OD 2IUPA 3A0FA 3UVLA 3RMZD 4JD2C 2P9UC 4FA4D 2GNQA 2HYEA 3EI3A 2YBAA 3I8CA 1N6EA 2AGWA 2HXCA 1GOTB 2G99A 3AL9A 4A0AA 2AH1A 1PGUA 4JXMA 3SFZA 3PXTD 2I0SA 3JB9L 4FAVD 4PSXB 3OKWA 5HE0B 3V9FA 1K8KC 2YNNA 5IGQA 3I2NA 3RRMC 5AMSA 2PM6B 4CY1A 2HKRA 3EI4B 1XKSA 3SBPA 1L0QA 3I89A 5HE3B 5SXMA 4A11B 5EALA 2H9NA 2IURA 5EMMB 2HESX 5TEFA 3JZHA 3PXWD 4YVDA 3C5MA 2B4EA 2CN2A 2QXVA 4ERZA 2P9KC 5FKTA 2H6QA 4N14A 2YNPA 1S4UX 3C75H 3HFQA 3MXXA 3MZKA 5H1MA 5AFU3 4ERQA 3DWLC 3V7DB 4ZN4A 5B4WA 4FWWA 3BG1A 4U7AA 2H68A 3EI4A 3JZNA 3PVWB 1TBGA 4JSPC 4A11A 4H5JA 2B5NA 3MZLA 3RFGA 4GQ1A 4K3ID 3SJLD 3NVXA 1GXRA 4CY5A 1JJUB 2EBSA 2Z2OA 5HE2B 4CC9A 4XYIA 5GMKn 3OL2B 4E5ZB 2B5LA 3UVMA 2CNXA 3PSLA 4GM8A 2OJYA 3MKSB 4JT6C 4O9DA 2AGZA 1JOFA 2H6NA 4D0KA 3PSCB 4O3TB 2IAAA 3IJCA 3RSEC 2AH0A 3C99A 4EWRA 3EI1B 1N6FA 2CE8A 2XU7A 3ODTA 3F3PA 4J84A 3MKQA 4XEIC 4QQEA 3IJ0A 4K3JB 2H47A 3FM0A 3RN0D 4A7JA 1TYQC 1U4CA 3OL2A 5C2VB 3SBRA 2H6KA 4X63B 1FWXA 4GZ8A 4GGCA 5HE1B 5FA5B 4J82A 4AEZA 5I5JA 5TEEA 5THAA 5KDOB 4LG8A 4GMBA 3DSMA 5IC7A 4CZXA 3E0CA 2P9NC 5K19A 2H14A 1MG3A 3GFCA 3JROA 4J79A 3RFHA 1B9YA 1SQ9A 3EI1A 3BWSA 2P9SC 2PM9A 4ZOXA 2J57G 5IGOA 5FKRA 1YFQA 3DM0A 1MDAH 3SN6B 2H3XA 3AL8B 3J81g 4BL0A 2H13A 4CI3A 1B9XA 3OKYB 4L1QD 3I7OA 4FA5D 3AH8B 1OLZA 3JPXA 3U4YA 2AGYA 4LG9A 4JSXC 2OVRB 5CXCB 3JZGA 4JSNC 2G9AA 2P9PC 5JWZA 3EMHA 4QRJA 3CFSB 2Z2NA 1U2VC 5FKQA 3UKRC 1SQJA 2IWFA 3AL8A 1A0RB 2TRCB 3OKYA 4LGNA 3KRWB 4O3UB 4PNKB 5GXIA 3SMRA 4OZUA 3SWSD 4J77A 5CXCA 4GM9A 5IJ7E 2H9LA 4D6VA 5I5MA 4Y7RA 4UI9R 1GP2B 2P9LC 4J0XA 4ZOVA 3V5WB 1OMWB 3UR4A 5C2WB 2BBKH 3PXSD 4A09B 4A0BB 4HDJA 2J55H 3L4MD 4X60B 5CXBB 4KFMB 3SHFA 4PBYA 4CI8A 1JMZB 3IKOA 3PVUB 4ZOZA 2Z2PA 1RI6A 4CZYA 4CI1A 3GREA 1P22A 3OKTA 1ERJA 2YNOA 5HQGA 2J56H 2I0TA 4J8GA 5IT9g 4GQBB 1PBYB 2GC7A 5A2Qg 4JSVC 4IMMA 3SLED 4GGDA 4BH6A 5HYNB 5I5IA 2B5MA 3J80g 2XL3A 2CO0A 4A09A 5CXBA 4J87A 4CY2A 1Q47A 5FXYA 4ZOYA 3DXKC 4AOWA 4R7AB 1NR0A 2Q7QA 2UZXB 3B7FA 2YB8B 2AGLA 4E5ZA 3F3FA 4H5IA 3K27A 2IWKA 5FKSA 2I3TA 1VYHC 3I7NA 4FAND 2I3SA 4E54B 3NVQA 3I7PA 2OK4A 5TF2A 4QL1A 2CE9A 3SXTD 4J81A 2O9KA 3ZWLB 2P9IC 4IA9A 3EG6A 3JRPA 1K32A 4L9OA 2CN3A 2OK6A 4O45A 4A2LA 3FGBA 3EU7A 3CFVA 3EWEA 4J78A 3IIWA 3UVNA 2H9MA 4A2MA 3MMYA 4J73A 3OW8A 4CZVA 2W18A 4ERYA 4E54A 3I7LA 5EARA 3F3GA 4L3GD 4BUJC 4CY3A 5AJAA 4QT8A 3ORVD 4CI2A 2HJ4A 3AFCA 2OVQB 3P4FA 4X61B 3VGZA 2H9PA 2BCJB 3PE7A 4X3EA 5EM2B 4JT5C 3N0EA 4O1QD 3UKUC 4J0WA 1PEVA 2QC5A 4MK0B 5TDHB 2IUQA 4GGAA 3RN1D 4GM3A 2PM7B 3SCYA 1QNIA 3N0DA 4OWRA 1GG2B 3DXMC 3VH0A 3VA6A 3NVNA 4FA9D 3OTTA 5FLXg 5EMJB 2MTAH 5CYKB 1NEXB 3EI2B 4J86A 3RLMD 4ESGA 2CO0C 3IJ1A 2HKMA 5EM2A 2PBIB 5C9ZB 5EAMA 1MG2A 3ULEC 4PBZA 1N6DA 5H17A 4XYHA 3K26A 2OVPB 1R5MA 5GXHA 3SVWD 4NSXA 4G56B 3I8EA 3I7HA 2AQ5A 1JMXB 3C9CA 1PI6A 4L3HD 2UZYB 3IIYA 2XL2A 4FHLA 5CYKA 3JAMg 4J8BA 2XYIA 3EI2A 2HJBA 5FQDA 5EMKB 3SBQA 4Y5RD 4A0BA 3FRXA 5H14A 2YMUA 5K1CC 4FA1D 4GQ2P 4I79A 5GSAA 4TZ4A 4A08B 4ES0A 4Z8LA 1XIPA 4U1EI 2I0RA 2GC4A 2OIZA 4PXWA 2AGXA 3UVOA 3KRXB 3EI3B 4PC0A 2PM9B 4FB1D 4PSWB 5EAPA
chains in the Genus database with same CATH superfamily
3IULA 3I7KA 4A0AB 3W15A 1C9LA 3UVKA 2IUVA 3CIKB 1XHMA 3IVMA 1JV2A 3BG0A 5IJ8E 1SHYB 4AN1A 5EMLB 4A08A 5E6SA 3L4OD 2IUPA 3A0FA 3UVLA 5M5SA 4G1MA 3RMZD 4JD2C 2P9UC 4FA4D 4MMYA 2EIDA 2GNQA 4UM8A 2HYEA 3EI3A 2YBAA 3I8CA 1N6EA 2AGWA 2HXCA 1GOTB 1E8MA 3T3PA 2G99A 3QHYB 2VDOA 1O6FA 4RE6A 3AL9A 4A0AA 2AH1A 3V4PA 1PGUA 4JXMA 5FFOA 3PXTD 2I0SA 1VZ2A 3SFZA 3JB9L 4FAVD 3IUJA 4PSXB 3OKWA 1GOHA 1E8NA 5HE0B 3V9FA 1K8KC 2YNNA 5IGQA 3I2NA 3RRMC 2VDKA 2PM6B 5AMSA 4CY1A 3K71A 2HKRA 1UTCA 3EI4B 1XKSA 3SBPA 1L0QA 3I89A 5HE3B 5SXMA 4A11B 5EALA 2H9NA 2VDLA 2IURA 5EMMB 2HESX 5TEFA 3JZHA 2EIBA 3PXWD 4YVDA 4G1EA 3C5MA 2B4EA 2CN2A 4BP8A 2QXVA 4ERZA 2P9KC 5HDBA 5FKTA 2H6QA 4N14A 2YNPA 1S4UX 3C75H 3HFQA 3MXXA 3MZKA 5H1MA 5AFU3 4ERQA 3DWLC 3V7DB 4ZN4A 2WQ8A 1C9IA 3IUMA 3NIFA 5B4WA 4FWWA 3BG1A 4U7AA 2H68A 3EI4A 3JZNA 1BPOA 4Z7QA 3PVWB 1TBGA 4JSPC 4A11A 2EICA 4H5JA 4AMZA 3MZLA 2B5NA 3RFGA 4GQ1A 3GD1I 4K3ID 2HU7A 3SJLD 3NVXA 1GXRA 4CY5A 1JJUB 2EBSA 2Z2OA 5HE2B 4CC9A 4XYIA 5GMKn 3OL2B 4QAMA 1H2YA 3O4IA 4E5ZB 2B5LA 3UVMA 2CNXA 3PSLA 4GM8A 5M5TA 2OJYA 3MKSB 4JT6C 4O9DA 2AGZA 3VI3A 1JOFA 2H6NA 3IUNA 4D0KA 3PSCB 4O3TB 2IAAA 3O4HA 3IJCA 3RSEC 2AH0A 4MMXA 3C99A 4EWRA 3EI1B 1N6FA 2CE8A 2XU7A 3ODTA 3F3PA 4J84A 3EQ8A 3T3MA 3MKQA 4XEIC 4QQEA 3IJ0A 2QR5A 4K3JB 2H47A 3FM0A 4DNWA 3RN0D 4A7JA 1TYQC 3VI4A 1U4CA 3OL2A 5C2VB 3SBRA 2H6KA 4X63B 1FWXA 4GZ8A 4GGCA 5HE1B 3MUOA 5FA5B 4J82A 4AEZA 5I5JA 5TEEA 5THAA 5KDOB 4LG8A 4GMBA 3DSMA 5IC7A 3NIDA 4CZXA 3E0CA 2P9NC 5K19A 2H14A 1MG3A 1QFSA 3GFCA 3JROA 4J79A 5FFGA 3RFHA 3IUQA 1E5TA 1B9YA 2HU8A 1SQ9A 3EI1A 4BCCA 4O02A 3BWSA 2P9SC 2PM9A 4ZOXA 2J57G 5IGOA 5FKRA 1YFQA 3DM0A 1MDAH 3SN6B 2H3XA 3AL8B 3J81g 4BL0A 2H13A 4CI3A 3ZDZA 1B9XA 3OKYB 4L1QD 3I7OA 4FA5D 3AH8B 1OLZA 3JPXA 3U4YA 1GOGA 1H2ZA 2AGYA 4LG9A 4JSXC 2OVRB 5CXCB 3JZGA 1L5GA 4JSNC 2G9AA 2P9PC 5JWZA 3EMHA 2XE4A 4QRJA 3CFSB 2Z2NA 1U2VC 5M61A 5FKQA 3UKRC 5M5VA 1SQJA 4NBMA 3ZDYA 2IWFA 1VE6A 1A0RB 3AL8A 2TRCB 3OKYA 4LGNA 3KRWB 4O3UB 4PNKB 5GXIA 1K3IA 3SMRA 4G55A 4OZUA 3SWSD 4J77A 3EQ9A 5CXCA 4GM9A 5IJ7E 2H9LA 4D6VA 3NIGA 4D9SA 5I5MA 4Y7RA 4UI9R 1GP2B 4WK0A 2P9LC 4J0XA 4ZOVA 3V5WB 1OMWB 3UR4A 5C2WB 3FCSA 2BBKH 3PXSD 4A09B 4A0BB 3DDUA 4HDJA 2J55H 3L4MD 4X60B 5CXBB 3V4VA 4KFMB 3SHFA 4PBYA 1TYEA 2VDRA 4CI8A 1JMZB 3IKOA 3PVUB 4ZOZA 2EIEA 5M5UA 1YR2A 2Z2PA 3K72A 1RI6A 4CZYA 4CI1A 1GOFA 3GREA 1P22A 3IURA 3OKTA 1U8CA 1ERJA 4AX4A 2YNOA 5HQGA 2J56H 2I0TA 2XZGA 2VZ1A 4J8GA 4Z7NA 5IT9g 4GQBB 1PBYB 2GC7A 1I2MB 3O4JA 5A2Qg 4JSVC 4IMMA 3SLED 4GGDA 4BH6A 5HYNB 5I5IA 2B5MA 3J80g 2XL3A 1H2XA 3EQ7A 2CO0A 4A09A 5CXBA 4J87A 4CY2A 3MVDK 1Q47A 5FXYA 5E6UA 4ZOYA 3DXKC 4AOWA 4R7AB 3O4GA 1NR0A 2Q7QA 2UZXB 3B7FA 4DNVA 2YB8B 4JHPC 2AGLA 4E5ZA 3F3FA 4H5IA 3K27A 2IWKA 1M1XA 5FKSA 2I3TA 1VYHC 3I7NA 2VDNA 4FAND 2I3SA 4E54B 4JHNA 3NVQA 5M5RA 4DNUA 3I7PA 2OK4A 5TF2A 4QL1A 2CE9A 3SXTD 4J81A 2O9KA 3ZWLB 4BP9A 1T2XA 2P9IC 5C86A 4IA9A 1QFMA 3EG6A 3JRPA 4NENA 1VE7A 4AMYA 1K32A 4L9OA 2CN3A 2OK6A 4O45A 3ZE2A 4A2LA 3FGBA 3EU7A 3CFVA 3EWEA 4J78A 2VC2A 3IIWA 3UVNA 2H9MA 4A2MA 3MMYA 2QZPA 4NAAA 4J73A 3OW8A 4CZVA 2W18A 4MMZA 4ERYA 4E54A 3I7LA 4BCBA 4Z7OA 1A12A 5EARA 3F3GA 4L3GD 4BUJC 4AN0A 4CY3A 5AJAA 4IRZA 4QT8A 3ORVD 4CI2A 2HJ4A 3AFCA 2OVQB 3P4FA 4X61B 3VGZA 2H9PA 4UM9A 2BCJB 3PE7A 4X3EA 5EM2B 4JT5C 3OF7A 3N0EA 4O1QD 3ZE0A 3UKUC 4J0WA 1PEVA 2QC5A 4MK0B 5TDHB 2VZ3A 2IUQA 4GGAA 3RN1D 4GM3A 3FCUA 2PM7B 3SCYA 1QNIA 4BCDA 3N0DA 4WK2A 1UOQA 4WK4A 4OWRA 1GG2B 3DXMC 3VH0A 4O2WA 3VA6A 3NVNA 4FA9D 4RE5A 3OTTA 5FLXg 5EMJB 4L1MA 2MTAH 5CYKB 1NEXB 5C92A 3EI2B 4J86A 1UOPA 3RLMD 4ESGA 2CO0C 1UOOA 3IJ1A 2HKMA 5EM2A 2PBIB 5C9ZB 3QI0A 5EAMA 1MG2A 3ULEC 2XDWA 4PBZA 1N6DA 5H17A 4XYHA 5E6RA 3K26A 2OVPB 1O6GA 1R5MA 5GXHA 3SVWD 3GC3B 4NSXA 4G56B 2JKXA 3I8EA 3I7HA 2AQ5A 1JMXB 4WJKA 3C9CA 2VDMA 1PI6A 4L3HD 2UZYB 3IIYA 2XL2A 4FHLA 5CYKA 3JAMg 4J8BA 2XYIA 3EI2A 3IJEA 2HJBA 5FQDA 5EMKB 3SBQA 2VDPA 4Y5RD 4A0BA 4NC4A 2HU5A 3FRXA 5H14A 2YMUA 1H2WA 5K1CC 2VDQA 4FA1D 4GQ2P 4I79A 5GSAA 4TZ4A 4A08B 4ES0A 4Z8LA 1XIPA 4U1EI 2I0RA 1VZ3A 2BKLA 2GC4A 2OIZA 3ZE1A 4PXWA 2AGXA 3UVOA 3KRXB 3EI3B 3K6SA 1JTDB 3MUNA 4PC0A 3KCIA 2PM9B 4FB1D 4PSWB 5EAPA 3ZDXA
chains in the Genus database with same CATH topology
3I7KA 4A0AB 3W15A 3UVKA 2IUVA 3CIKB 1XHMA 3BG0A 5IJ8E 1SHYB 5EMLB 4A08A 3L4OD 2IUPA 3A0FA 3UVLA 3RMZD 4JD2C 2P9UC 4FA4D 2GNQA 2HYEA 3EI3A 2YBAA 3I8CA 1N6EA 2AGWA 2HXCA 1GOTB 2G99A 3AL9A 4A0AA 2AH1A 1PGUA 4JXMA 3SFZA 3PXTD 2I0SA 3JB9L 4FAVD 4PSXB 3OKWA 5HE0B 3V9FA 1K8KC 2YNNA 5IGQA 3I2NA 3RRMC 5AMSA 2PM6B 4CY1A 2HKRA 3EI4B 1XKSA 3SBPA 1L0QA 3I89A 5HE3B 5SXMA 4A11B 5EALA 2H9NA 2IURA 5EMMB 2HESX 5TEFA 3JZHA 3PXWD 4YVDA 3C5MA 2B4EA 2CN2A 2QXVA 4ERZA 2P9KC 5FKTA 2H6QA 4N14A 2YNPA 1S4UX 3C75H 3HFQA 3MXXA 3MZKA 5H1MA 5AFU3 4ERQA 3DWLC 3V7DB 4ZN4A 5B4WA 4FWWA 3BG1A 4U7AA 2H68A 3EI4A 3JZNA 3PVWB 1TBGA 4JSPC 4A11A 4H5JA 2B5NA 3MZLA 3RFGA 4GQ1A 4K3ID 3SJLD 3NVXA 1GXRA 4CY5A 1JJUB 2EBSA 2Z2OA 5HE2B 4CC9A 4XYIA 5GMKn 3OL2B 4E5ZB 2B5LA 3UVMA 2CNXA 3PSLA 4GM8A 2OJYA 3MKSB 4JT6C 4O9DA 2AGZA 1JOFA 2H6NA 4D0KA 3PSCB 4O3TB 2IAAA 3IJCA 3RSEC 2AH0A 3C99A 4EWRA 3EI1B 1N6FA 2CE8A 2XU7A 3ODTA 3F3PA 4J84A 3MKQA 4XEIC 4QQEA 3IJ0A 4K3JB 2H47A 3FM0A 3RN0D 4A7JA 1TYQC 1U4CA 3OL2A 5C2VB 3SBRA 2H6KA 4X63B 1FWXA 4GZ8A 4GGCA 5HE1B 5FA5B 4J82A 4AEZA 5I5JA 5TEEA 5THAA 5KDOB 4LG8A 4GMBA 3DSMA 5IC7A 4CZXA 3E0CA 2P9NC 5K19A 2H14A 1MG3A 3GFCA 3JROA 4J79A 3RFHA 1B9YA 1SQ9A 3EI1A 3BWSA 2P9SC 2PM9A 4ZOXA 2J57G 5IGOA 5FKRA 1YFQA 3DM0A 1MDAH 3SN6B 2H3XA 3AL8B 3J81g 4BL0A 2H13A 4CI3A 1B9XA 3OKYB 4L1QD 3I7OA 4FA5D 3AH8B 1OLZA 3JPXA 3U4YA 2AGYA 4LG9A 4JSXC 2OVRB 5CXCB 3JZGA 4JSNC 2G9AA 2P9PC 5JWZA 3EMHA 4QRJA 3CFSB 2Z2NA 1U2VC 5FKQA 3UKRC 1SQJA 2IWFA 3AL8A 1A0RB 2TRCB 3OKYA 4LGNA 3KRWB 4O3UB 4PNKB 5GXIA 3SMRA 4OZUA 3SWSD 4J77A 5CXCA 4GM9A 5IJ7E 2H9LA 4D6VA 5I5MA 4Y7RA 4UI9R 1GP2B 2P9LC 4J0XA 4ZOVA 3V5WB 1OMWB 3UR4A 5C2WB 2BBKH 3PXSD 4A09B 4A0BB 4HDJA 2J55H 3L4MD 4X60B 5CXBB 4KFMB 3SHFA 4PBYA 4CI8A 1JMZB 3IKOA 3PVUB 4ZOZA 2Z2PA 1RI6A 4CZYA 4CI1A 3GREA 1P22A 3OKTA 1ERJA 2YNOA 5HQGA 2J56H 2I0TA 4J8GA 5IT9g 4GQBB 1PBYB 2GC7A 5A2Qg 4JSVC 4IMMA 3SLED 4GGDA 4BH6A 5HYNB 5I5IA 2B5MA 3J80g 2XL3A 2CO0A 4A09A 5CXBA 4J87A 4CY2A 1Q47A 5FXYA 4ZOYA 3DXKC 4AOWA 4R7AB 1NR0A 2Q7QA 2UZXB 3B7FA 2YB8B 2AGLA 4E5ZA 3F3FA 4H5IA 3K27A 2IWKA 5FKSA 2I3TA 1VYHC 3I7NA 4FAND 2I3SA 4E54B 3NVQA 3I7PA 2OK4A 5TF2A 4QL1A 2CE9A 3SXTD 4J81A 2O9KA 3ZWLB 2P9IC 4IA9A 3EG6A 3JRPA 1K32A 4L9OA 2CN3A 2OK6A 4O45A 4A2LA 3FGBA 3EU7A 3CFVA 3EWEA 4J78A 3IIWA 3UVNA 2H9MA 4A2MA 3MMYA 4J73A 3OW8A 4CZVA 2W18A 4ERYA 4E54A 3I7LA 5EARA 3F3GA 4L3GD 4BUJC 4CY3A 5AJAA 4QT8A 3ORVD 4CI2A 2HJ4A 3AFCA 2OVQB 3P4FA 4X61B 3VGZA 2H9PA 2BCJB 3PE7A 4X3EA 5EM2B 4JT5C 3N0EA 4O1QD 3UKUC 4J0WA 1PEVA 2QC5A 4MK0B 5TDHB 2IUQA 4GGAA 3RN1D 4GM3A 2PM7B 3SCYA 1QNIA 3N0DA 4OWRA 1GG2B 3DXMC 3VH0A 3VA6A 3NVNA 4FA9D 3OTTA 5FLXg 5EMJB 2MTAH 5CYKB 1NEXB 3EI2B 4J86A 3RLMD 4ESGA 2CO0C 3IJ1A 2HKMA 5EM2A 2PBIB 5C9ZB 5EAMA 1MG2A 3ULEC 4PBZA 1N6DA 5H17A 4XYHA 3K26A 2OVPB 1R5MA 5GXHA 3SVWD 4NSXA 4G56B 3I8EA 3I7HA 2AQ5A 1JMXB 3C9CA 1PI6A 4L3HD 2UZYB 3IIYA 2XL2A 4FHLA 5CYKA 3JAMg 4J8BA 2XYIA 3EI2A 2HJBA 5FQDA 5EMKB 3SBQA 4Y5RD 4A0BA 3FRXA 5H14A 2YMUA 5K1CC 4FA1D 4GQ2P 4I79A 5GSAA 4TZ4A 4A08B 4ES0A 4Z8LA 1XIPA 4U1EI 2I0RA 2GC4A 2OIZA 4PXWA 2AGXA 3UVOA 3KRXB 3EI3B 4PC0A 2PM9B 4FB1D 4PSWB 5EAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7K A;  4A0A B;  3W15 A;  3UVK A;  2IUV A;  3CIK B;  1XHM A;  3BG0 A;  5IJ8 E;  1SHY B;  5EML B;  4A08 A;  3L4O D;  2IUP A;  3A0F A;  3UVL A;  3RMZ D;  4JD2 C;  2P9U C;  4FA4 D;  2GNQ A;  2HYE A;  3EI3 A;  2YBA A;  3I8C A;  1N6E A;  2AGW A;  2HXC A;  1GOT B;  2G99 A;  3AL9 A;  4A0A A;  2AH1 A;  1PGU A;  4JXM A;  3SFZ A;  3PXT D;  2I0S A;  3JB9 L;  4FAV D;  4PSX B;  3OKW A;  5HE0 B;  3V9F A;  1K8K C;  2YNN A;  5IGQ A;  3I2N A;  3RRM C;  5AMS A;  2PM6 B;  4CY1 A;  2HKR A;  3EI4 B;  1XKS A;  3SBP A;  1L0Q A;  3I89 A;  5HE3 B;  5SXM A;  4A11 B;  5EAL A;  2H9N A;  2IUR A;  5EMM B;  2HES X;  5TEF A;  3JZH A;  3PXW D;  4YVD A;  3C5M A;  2B4E A;  2CN2 A;  2QXV A;  4ERZ A;  2P9K C;  5FKT A;  2H6Q A;  4N14 A;  2YNP A;  1S4U X;  3C75 H;  3HFQ A;  3MXX A;  3MZK A;  5H1M A;  5AFU 3;  4ERQ A;  3DWL C;  3V7D B;  4ZN4 A;  5B4W A;  4FWW A;  3BG1 A;  4U7A A;  2H68 A;  3EI4 A;  3JZN A;  3PVW B;  1TBG A;  4JSP C;  4A11 A;  4H5J A;  2B5N A;  3MZL A;  3RFG A;  4GQ1 A;  4K3I D;  3SJL D;  3NVX A;  1GXR A;  4CY5 A;  1JJU B;  2EBS A;  2Z2O A;  5HE2 B;  4CC9 A;  4XYI A;  5GMK n;  3OL2 B;  4E5Z B;  2B5L A;  3UVM A;  2CNX A;  3PSL A;  4GM8 A;  2OJY A;  3MKS B;  4JT6 C;  4O9D A;  2AGZ A;  1JOF A;  2H6N A;  4D0K A;  3PSC B;  4O3T B;  2IAA A;  3IJC A;  3RSE C;  2AH0 A;  3C99 A;  4EWR A;  3EI1 B;  1N6F A;  2CE8 A;  2XU7 A;  3ODT A;  3F3P A;  4J84 A;  3MKQ A;  4XEI C;  4QQE A;  3IJ0 A;  4K3J B;  2H47 A;  3FM0 A;  3RN0 D;  4A7J A;  1TYQ C;  1U4C A;  3OL2 A;  5C2V B;  3SBR A;  2H6K A;  4X63 B;  1FWX A;  4GZ8 A;  4GGC A;  5HE1 B;  5FA5 B;  4J82 A;  4AEZ A;  5I5J A;  5TEE A;  5THA A;  5KDO B;  4LG8 A;  4GMB A;  3DSM A;  5IC7 A;  4CZX A;  3E0C A;  2P9N C;  5K19 A;  2H14 A;  1MG3 A;  3GFC A;  3JRO A;  4J79 A;  3RFH A;  1B9Y A;  1SQ9 A;  3EI1 A;  3BWS A;  2P9S C;  2PM9 A;  4ZOX A;  2J57 G;  5IGO A;  5FKR A;  1YFQ A;  3DM0 A;  1MDA H;  3SN6 B;  2H3X A;  3AL8 B;  3J81 g;  4BL0 A;  2H13 A;  4CI3 A;  1B9X A;  3OKY B;  4L1Q D;  3I7O A;  4FA5 D;  3AH8 B;  1OLZ A;  3JPX A;  3U4Y A;  2AGY A;  4LG9 A;  4JSX C;  2OVR B;  5CXC B;  3JZG A;  4JSN C;  2G9A A;  2P9P C;  5JWZ A;  3EMH A;  4QRJ A;  3CFS B;  2Z2N A;  1U2V C;  5FKQ A;  3UKR C;  1SQJ A;  2IWF A;  3AL8 A;  1A0R B;  2TRC B;  3OKY A;  4LGN A;  3KRW B;  4O3U B;  4PNK B;  5GXI A;  3SMR A;  4OZU A;  3SWS D;  4J77 A;  5CXC A;  4GM9 A;  5IJ7 E;  2H9L A;  4D6V A;  5I5M A;  4Y7R A;  4UI9 R;  1GP2 B;  2P9L C;  4J0X A;  4ZOV A;  3V5W B;  1OMW B;  3UR4 A;  5C2W B;  2BBK H;  3PXS D;  4A09 B;  4A0B B;  4HDJ A;  2J55 H;  3L4M D;  4X60 B;  5CXB B;  4KFM B;  3SHF A;  4PBY A;  4CI8 A;  1JMZ B;  3IKO A;  3PVU B;  4ZOZ A;  2Z2P A;  1RI6 A;  4CZY A;  4CI1 A;  3GRE A;  1P22 A;  3OKT A;  1ERJ A;  2YNO A;  5HQG A;  2J56 H;  2I0T A;  4J8G A;  5IT9 g;  4GQB B;  1PBY B;  2GC7 A;  5A2Q g;  4JSV C;  4IMM A;  3SLE D;  4GGD A;  4BH6 A;  5HYN B;  5I5I A;  2B5M A;  3J80 g;  2XL3 A;  2CO0 A;  4A09 A;  5CXB A;  4J87 A;  4CY2 A;  1Q47 A;  5FXY A;  4ZOY A;  3DXK C;  4AOW A;  4R7A B;  1NR0 A;  2Q7Q A;  2UZX B;  3B7F A;  2YB8 B;  2AGL A;  4E5Z A;  3F3F A;  4H5I A;  3K27 A;  2IWK A;  5FKS A;  2I3T A;  1VYH C;  3I7N A;  4FAN D;  2I3S A;  4E54 B;  3NVQ A;  3I7P A;  2OK4 A;  5TF2 A;  4QL1 A;  2CE9 A;  3SXT D;  4J81 A;  2O9K A;  3ZWL B;  2P9I C;  4IA9 A;  3EG6 A;  3JRP A;  1K32 A;  4L9O A;  2CN3 A;  2OK6 A;  4O45 A;  4A2L A;  3FGB A;  3EU7 A;  3CFV A;  3EWE A;  4J78 A;  3IIW A;  3UVN A;  2H9M A;  4A2M A;  3MMY A;  4J73 A;  3OW8 A;  4CZV A;  2W18 A;  4ERY A;  4E54 A;  3I7L A;  5EAR A;  3F3G A;  4L3G D;  4BUJ C;  4CY3 A;  5AJA A;  4QT8 A;  3ORV D;  4CI2 A;  2HJ4 A;  3AFC A;  2OVQ B;  3P4F A;  4X61 B;  3VGZ A;  2H9P A;  2BCJ B;  3PE7 A;  4X3E A;  5EM2 B;  4JT5 C;  3N0E A;  4O1Q D;  3UKU C;  4J0W A;  1PEV A;  2QC5 A;  4MK0 B;  5TDH B;  2IUQ A;  4GGA A;  3RN1 D;  4GM3 A;  2PM7 B;  3SCY A;  1QNI A;  3N0D A;  4OWR A;  1GG2 B;  3DXM C;  3VH0 A;  3VA6 A;  3NVN A;  4FA9 D;  3OTT A;  5FLX g;  5EMJ B;  2MTA H;  5CYK B;  1NEX B;  3EI2 B;  4J86 A;  3RLM D;  4ESG A;  2CO0 C;  3IJ1 A;  2HKM A;  5EM2 A;  2PBI B;  5C9Z B;  5EAM A;  1MG2 A;  3ULE C;  4PBZ A;  1N6D A;  5H17 A;  4XYH A;  3K26 A;  2OVP B;  1R5M A;  5GXH A;  3SVW D;  4NSX A;  4G56 B;  3I8E A;  3I7H A;  2AQ5 A;  1JMX B;  3C9C A;  1PI6 A;  4L3H D;  2UZY B;  3IIY A;  2XL2 A;  4FHL A;  5CYK A;  3JAM g;  4J8B A;  2XYI A;  3EI2 A;  2HJB A;  5FQD A;  5EMK B;  3SBQ A;  4Y5R D;  4A0B A;  3FRX A;  5H14 A;  2YMU A;  5K1C C;  4FA1 D;  4GQ2 P;  4I79 A;  5GSA A;  4TZ4 A;  4A08 B;  4ES0 A;  4Z8L A;  1XIP A;  4U1E I;  2I0R A;  2GC4 A;  2OIZ A;  4PXW A;  2AGX A;  3UVO A;  3KRX B;  3EI3 B;  4PC0 A;  2PM9 B;  4FB1 D;  4PSW B;  5EAP A; 
#chains in the Genus database with same CATH topology
 3IUL A;  3I7K A;  4A0A B;  3W15 A;  1C9L A;  3UVK A;  2IUV A;  3CIK B;  1XHM A;  3IVM A;  1JV2 A;  3BG0 A;  5IJ8 E;  1SHY B;  4AN1 A;  5EML B;  4A08 A;  5E6S A;  3L4O D;  2IUP A;  3A0F A;  3UVL A;  5M5S A;  4G1M A;  3RMZ D;  4JD2 C;  2P9U C;  4FA4 D;  4MMY A;  2EID A;  2GNQ A;  4UM8 A;  2HYE A;  3EI3 A;  2YBA A;  3I8C A;  1N6E A;  2AGW A;  2HXC A;  1GOT B;  1E8M A;  3T3P A;  2G99 A;  3QHY B;  2VDO A;  1O6F A;  4RE6 A;  3AL9 A;  4A0A A;  2AH1 A;  3V4P A;  1PGU A;  4JXM A;  5FFO A;  3PXT D;  2I0S A;  1VZ2 A;  3SFZ A;  3JB9 L;  4FAV D;  3IUJ A;  4PSX B;  3OKW A;  1GOH A;  1E8N A;  5HE0 B;  3V9F A;  1K8K C;  2YNN A;  5IGQ A;  3I2N A;  3RRM C;  2VDK A;  2PM6 B;  5AMS A;  4CY1 A;  3K71 A;  2HKR A;  1UTC A;  3EI4 B;  1XKS A;  3SBP A;  1L0Q A;  3I89 A;  5HE3 B;  5SXM A;  4A11 B;  5EAL A;  2H9N A;  2VDL A;  2IUR A;  5EMM B;  2HES X;  5TEF A;  3JZH A;  2EIB A;  3PXW D;  4YVD A;  4G1E A;  3C5M A;  2B4E A;  2CN2 A;  4BP8 A;  2QXV A;  4ERZ A;  2P9K C;  5HDB A;  5FKT A;  2H6Q A;  4N14 A;  2YNP A;  1S4U X;  3C75 H;  3HFQ A;  3MXX A;  3MZK A;  5H1M A;  5AFU 3;  4ERQ A;  3DWL C;  3V7D B;  4ZN4 A;  2WQ8 A;  1C9I A;  3IUM A;  3NIF A;  5B4W A;  4FWW A;  3BG1 A;  4U7A A;  2H68 A;  3EI4 A;  3JZN A;  1BPO A;  4Z7Q A;  3PVW B;  1TBG A;  4JSP C;  4A11 A;  2EIC A;  4H5J A;  4AMZ A;  3MZL A;  2B5N A;  3RFG A;  4GQ1 A;  3GD1 I;  4K3I D;  2HU7 A;  3SJL D;  3NVX A;  1GXR A;  4CY5 A;  1JJU B;  2EBS A;  2Z2O A;  5HE2 B;  4CC9 A;  4XYI A;  5GMK n;  3OL2 B;  4QAM A;  1H2Y A;  3O4I A;  4E5Z B;  2B5L A;  3UVM A;  2CNX A;  3PSL A;  4GM8 A;  5M5T A;  2OJY A;  3MKS B;  4JT6 C;  4O9D A;  2AGZ A;  3VI3 A;  1JOF A;  2H6N A;  3IUN A;  4D0K A;  3PSC B;  4O3T B;  2IAA A;  3O4H A;  3IJC A;  3RSE C;  2AH0 A;  4MMX A;  3C99 A;  4EWR A;  3EI1 B;  1N6F A;  2CE8 A;  2XU7 A;  3ODT A;  3F3P A;  4J84 A;  3EQ8 A;  3T3M A;  3MKQ A;  4XEI C;  4QQE A;  3IJ0 A;  2QR5 A;  4K3J B;  2H47 A;  3FM0 A;  4DNW A;  3RN0 D;  4A7J A;  1TYQ C;  3VI4 A;  1U4C A;  3OL2 A;  5C2V B;  3SBR A;  2H6K A;  4X63 B;  1FWX A;  4GZ8 A;  4GGC A;  5HE1 B;  3MUO A;  5FA5 B;  4J82 A;  4AEZ A;  5I5J A;  5TEE A;  5THA A;  5KDO B;  4LG8 A;  4GMB A;  3DSM A;  5IC7 A;  3NID A;  4CZX A;  3E0C A;  2P9N C;  5K19 A;  2H14 A;  1MG3 A;  1QFS A;  3GFC A;  3JRO A;  4J79 A;  5FFG A;  3RFH A;  3IUQ A;  1E5T A;  1B9Y A;  2HU8 A;  1SQ9 A;  3EI1 A;  4BCC A;  4O02 A;  3BWS A;  2P9S C;  2PM9 A;  4ZOX A;  2J57 G;  5IGO A;  5FKR A;  1YFQ A;  3DM0 A;  1MDA H;  3SN6 B;  2H3X A;  3AL8 B;  3J81 g;  4BL0 A;  2H13 A;  4CI3 A;  3ZDZ A;  1B9X A;  3OKY B;  4L1Q D;  3I7O A;  4FA5 D;  3AH8 B;  1OLZ A;  3JPX A;  3U4Y A;  1GOG A;  1H2Z A;  2AGY A;  4LG9 A;  4JSX C;  2OVR B;  5CXC B;  3JZG A;  1L5G A;  4JSN C;  2G9A A;  2P9P C;  5JWZ A;  3EMH A;  2XE4 A;  4QRJ A;  3CFS B;  2Z2N A;  1U2V C;  5M61 A;  5FKQ A;  3UKR C;  5M5V A;  1SQJ A;  4NBM A;  3ZDY A;  2IWF A;  1VE6 A;  1A0R B;  3AL8 A;  2TRC B;  3OKY A;  4LGN A;  3KRW B;  4O3U B;  4PNK B;  5GXI A;  1K3I A;  3SMR A;  4G55 A;  4OZU A;  3SWS D;  4J77 A;  3EQ9 A;  5CXC A;  4GM9 A;  5IJ7 E;  2H9L A;  4D6V A;  3NIG A;  4D9S A;  5I5M A;  4Y7R A;  4UI9 R;  1GP2 B;  4WK0 A;  2P9L C;  4J0X A;  4ZOV A;  3V5W B;  1OMW B;  3UR4 A;  5C2W B;  3FCS A;  2BBK H;  3PXS D;  4A09 B;  4A0B B;  3DDU A;  4HDJ A;  2J55 H;  3L4M D;  4X60 B;  5CXB B;  3V4V A;  4KFM B;  3SHF A;  4PBY A;  1TYE A;  2VDR A;  4CI8 A;  1JMZ B;  3IKO A;  3PVU B;  4ZOZ A;  2EIE A;  5M5U A;  1YR2 A;  2Z2P A;  3K72 A;  1RI6 A;  4CZY A;  4CI1 A;  1GOF A;  3GRE A;  1P22 A;  3IUR A;  3OKT A;  1U8C A;  1ERJ A;  4AX4 A;  2YNO A;  5HQG A;  2J56 H;  2I0T A;  2XZG A;  2VZ1 A;  4J8G A;  4Z7N A;  5IT9 g;  4GQB B;  1PBY B;  2GC7 A;  1I2M B;  3O4J A;  5A2Q g;  4JSV C;  4IMM A;  3SLE D;  4GGD A;  4BH6 A;  5HYN B;  5I5I A;  2B5M A;  3J80 g;  2XL3 A;  1H2X A;  3EQ7 A;  2CO0 A;  4A09 A;  5CXB A;  4J87 A;  4CY2 A;  3MVD K;  1Q47 A;  5FXY A;  5E6U A;  4ZOY A;  3DXK C;  4AOW A;  4R7A B;  3O4G A;  1NR0 A;  2Q7Q A;  2UZX B;  3B7F A;  4DNV A;  2YB8 B;  4JHP C;  2AGL A;  4E5Z A;  3F3F A;  4H5I A;  3K27 A;  2IWK A;  1M1X A;  5FKS A;  2I3T A;  1VYH C;  3I7N A;  2VDN A;  4FAN D;  2I3S A;  4E54 B;  4JHN A;  3NVQ A;  5M5R A;  4DNU A;  3I7P A;  2OK4 A;  5TF2 A;  4QL1 A;  2CE9 A;  3SXT D;  4J81 A;  2O9K A;  3ZWL B;  4BP9 A;  1T2X A;  2P9I C;  5C86 A;  4IA9 A;  1QFM A;  3EG6 A;  3JRP A;  4NEN A;  1VE7 A;  4AMY A;  1K32 A;  4L9O A;  2CN3 A;  2OK6 A;  4O45 A;  3ZE2 A;  4A2L A;  3FGB A;  3EU7 A;  3CFV A;  3EWE A;  4J78 A;  2VC2 A;  3IIW A;  3UVN A;  2H9M A;  4A2M A;  3MMY A;  2QZP A;  4NAA A;  4J73 A;  3OW8 A;  4CZV A;  2W18 A;  4MMZ A;  4ERY A;  4E54 A;  3I7L A;  4BCB A;  4Z7O A;  1A12 A;  5EAR A;  3F3G A;  4L3G D;  4BUJ C;  4AN0 A;  4CY3 A;  5AJA A;  4IRZ A;  4QT8 A;  3ORV D;  4CI2 A;  2HJ4 A;  3AFC A;  2OVQ B;  3P4F A;  4X61 B;  3VGZ A;  2H9P A;  4UM9 A;  2BCJ B;  3PE7 A;  4X3E A;  5EM2 B;  4JT5 C;  3OF7 A;  3N0E A;  4O1Q D;  3ZE0 A;  3UKU C;  4J0W A;  1PEV A;  2QC5 A;  4MK0 B;  5TDH B;  2VZ3 A;  2IUQ A;  4GGA A;  3RN1 D;  4GM3 A;  3FCU A;  2PM7 B;  3SCY A;  1QNI A;  4BCD A;  3N0D A;  4WK2 A;  1UOQ A;  4WK4 A;  4OWR A;  1GG2 B;  3DXM C;  3VH0 A;  4O2W A;  3VA6 A;  3NVN A;  4FA9 D;  4RE5 A;  3OTT A;  5FLX g;  5EMJ B;  4L1M A;  2MTA H;  5CYK B;  1NEX B;  5C92 A;  3EI2 B;  4J86 A;  1UOP A;  3RLM D;  4ESG A;  2CO0 C;  1UOO A;  3IJ1 A;  2HKM A;  5EM2 A;  2PBI B;  5C9Z B;  3QI0 A;  5EAM A;  1MG2 A;  3ULE C;  2XDW A;  4PBZ A;  1N6D A;  5H17 A;  4XYH A;  5E6R A;  3K26 A;  2OVP B;  1O6G A;  1R5M A;  5GXH A;  3SVW D;  3GC3 B;  4NSX A;  4G56 B;  2JKX A;  3I8E A;  3I7H A;  2AQ5 A;  1JMX B;  4WJK A;  3C9C A;  2VDM A;  1PI6 A;  4L3H D;  2UZY B;  3IIY A;  2XL2 A;  4FHL A;  5CYK A;  3JAM g;  4J8B A;  2XYI A;  3EI2 A;  3IJE A;  2HJB A;  5FQD A;  5EMK B;  3SBQ A;  2VDP A;  4Y5R D;  4A0B A;  4NC4 A;  2HU5 A;  3FRX A;  5H14 A;  2YMU A;  1H2W A;  5K1C C;  2VDQ A;  4FA1 D;  4GQ2 P;  4I79 A;  5GSA A;  4TZ4 A;  4A08 B;  4ES0 A;  4Z8L A;  1XIP A;  4U1E I;  2I0R A;  1VZ3 A;  2BKL A;  2GC4 A;  2OIZ A;  3ZE1 A;  4PXW A;  2AGX A;  3UVO A;  3KRX B;  3EI3 B;  3K6S A;  1JTD B;  3MUN A;  4PC0 A;  3KCI A;  2PM9 B;  4FB1 D;  4PSW B;  5EAP A;  3ZDX A; 
#chains in the Genus database with same CATH homology
 3I7K A;  4A0A B;  3W15 A;  3UVK A;  2IUV A;  3CIK B;  1XHM A;  3BG0 A;  5IJ8 E;  1SHY B;  5EML B;  4A08 A;  3L4O D;  2IUP A;  3A0F A;  3UVL A;  3RMZ D;  4JD2 C;  2P9U C;  4FA4 D;  2GNQ A;  2HYE A;  3EI3 A;  2YBA A;  3I8C A;  1N6E A;  2AGW A;  2HXC A;  1GOT B;  2G99 A;  3AL9 A;  4A0A A;  2AH1 A;  1PGU A;  4JXM A;  3SFZ A;  3PXT D;  2I0S A;  3JB9 L;  4FAV D;  4PSX B;  3OKW A;  5HE0 B;  3V9F A;  1K8K C;  2YNN A;  5IGQ A;  3I2N A;  3RRM C;  5AMS A;  2PM6 B;  4CY1 A;  2HKR A;  3EI4 B;  1XKS A;  3SBP A;  1L0Q A;  3I89 A;  5HE3 B;  5SXM A;  4A11 B;  5EAL A;  2H9N A;  2IUR A;  5EMM B;  2HES X;  5TEF A;  3JZH A;  3PXW D;  4YVD A;  3C5M A;  2B4E A;  2CN2 A;  2QXV A;  4ERZ A;  2P9K C;  5FKT A;  2H6Q A;  4N14 A;  2YNP A;  1S4U X;  3C75 H;  3HFQ A;  3MXX A;  3MZK A;  5H1M A;  5AFU 3;  4ERQ A;  3DWL C;  3V7D B;  4ZN4 A;  5B4W A;  4FWW A;  3BG1 A;  4U7A A;  2H68 A;  3EI4 A;  3JZN A;  3PVW B;  1TBG A;  4JSP C;  4A11 A;  4H5J A;  2B5N A;  3MZL A;  3RFG A;  4GQ1 A;  4K3I D;  3SJL D;  3NVX A;  1GXR A;  4CY5 A;  1JJU B;  2EBS A;  2Z2O A;  5HE2 B;  4CC9 A;  4XYI A;  5GMK n;  3OL2 B;  4E5Z B;  2B5L A;  3UVM A;  2CNX A;  3PSL A;  4GM8 A;  2OJY A;  3MKS B;  4JT6 C;  4O9D A;  2AGZ A;  1JOF A;  2H6N A;  4D0K A;  3PSC B;  4O3T B;  2IAA A;  3IJC A;  3RSE C;  2AH0 A;  3C99 A;  4EWR A;  3EI1 B;  1N6F A;  2CE8 A;  2XU7 A;  3ODT A;  3F3P A;  4J84 A;  3MKQ A;  4XEI C;  4QQE A;  3IJ0 A;  4K3J B;  2H47 A;  3FM0 A;  3RN0 D;  4A7J A;  1TYQ C;  1U4C A;  3OL2 A;  5C2V B;  3SBR A;  2H6K A;  4X63 B;  1FWX A;  4GZ8 A;  4GGC A;  5HE1 B;  5FA5 B;  4J82 A;  4AEZ A;  5I5J A;  5TEE A;  5THA A;  5KDO B;  4LG8 A;  4GMB A;  3DSM A;  5IC7 A;  4CZX A;  3E0C A;  2P9N C;  5K19 A;  2H14 A;  1MG3 A;  3GFC A;  3JRO A;  4J79 A;  3RFH A;  1B9Y A;  1SQ9 A;  3EI1 A;  3BWS A;  2P9S C;  2PM9 A;  4ZOX A;  2J57 G;  5IGO A;  5FKR A;  1YFQ A;  3DM0 A;  1MDA H;  3SN6 B;  2H3X A;  3AL8 B;  3J81 g;  4BL0 A;  2H13 A;  4CI3 A;  1B9X A;  3OKY B;  4L1Q D;  3I7O A;  4FA5 D;  3AH8 B;  1OLZ A;  3JPX A;  3U4Y A;  2AGY A;  4LG9 A;  4JSX C;  2OVR B;  5CXC B;  3JZG A;  4JSN C;  2G9A A;  2P9P C;  5JWZ A;  3EMH A;  4QRJ A;  3CFS B;  2Z2N A;  1U2V C;  5FKQ A;  3UKR C;  1SQJ A;  2IWF A;  3AL8 A;  1A0R B;  2TRC B;  3OKY A;  4LGN A;  3KRW B;  4O3U B;  4PNK B;  5GXI A;  3SMR A;  4OZU A;  3SWS D;  4J77 A;  5CXC A;  4GM9 A;  5IJ7 E;  2H9L A;  4D6V A;  5I5M A;  4Y7R A;  4UI9 R;  1GP2 B;  2P9L C;  4J0X A;  4ZOV A;  3V5W B;  1OMW B;  3UR4 A;  5C2W B;  2BBK H;  3PXS D;  4A09 B;  4A0B B;  4HDJ A;  2J55 H;  3L4M D;  4X60 B;  5CXB B;  4KFM B;  3SHF A;  4PBY A;  4CI8 A;  1JMZ B;  3IKO A;  3PVU B;  4ZOZ A;  2Z2P A;  1RI6 A;  4CZY A;  4CI1 A;  3GRE A;  1P22 A;  3OKT A;  1ERJ A;  2YNO A;  5HQG A;  2J56 H;  2I0T A;  4J8G A;  5IT9 g;  4GQB B;  1PBY B;  2GC7 A;  5A2Q g;  4JSV C;  4IMM A;  3SLE D;  4GGD A;  4BH6 A;  5HYN B;  5I5I A;  2B5M A;  3J80 g;  2XL3 A;  2CO0 A;  4A09 A;  5CXB A;  4J87 A;  4CY2 A;  1Q47 A;  5FXY A;  4ZOY A;  3DXK C;  4AOW A;  4R7A B;  1NR0 A;  2Q7Q A;  2UZX B;  3B7F A;  2YB8 B;  2AGL A;  4E5Z A;  3F3F A;  4H5I A;  3K27 A;  2IWK A;  5FKS A;  2I3T A;  1VYH C;  3I7N A;  4FAN D;  2I3S A;  4E54 B;  3NVQ A;  3I7P A;  2OK4 A;  5TF2 A;  4QL1 A;  2CE9 A;  3SXT D;  4J81 A;  2O9K A;  3ZWL B;  2P9I C;  4IA9 A;  3EG6 A;  3JRP A;  1K32 A;  4L9O A;  2CN3 A;  2OK6 A;  4O45 A;  4A2L A;  3FGB A;  3EU7 A;  3CFV A;  3EWE A;  4J78 A;  3IIW A;  3UVN A;  2H9M A;  4A2M A;  3MMY A;  4J73 A;  3OW8 A;  4CZV A;  2W18 A;  4ERY A;  4E54 A;  3I7L A;  5EAR A;  3F3G A;  4L3G D;  4BUJ C;  4CY3 A;  5AJA A;  4QT8 A;  3ORV D;  4CI2 A;  2HJ4 A;  3AFC A;  2OVQ B;  3P4F A;  4X61 B;  3VGZ A;  2H9P A;  2BCJ B;  3PE7 A;  4X3E A;  5EM2 B;  4JT5 C;  3N0E A;  4O1Q D;  3UKU C;  4J0W A;  1PEV A;  2QC5 A;  4MK0 B;  5TDH B;  2IUQ A;  4GGA A;  3RN1 D;  4GM3 A;  2PM7 B;  3SCY A;  1QNI A;  3N0D A;  4OWR A;  1GG2 B;  3DXM C;  3VH0 A;  3VA6 A;  3NVN A;  4FA9 D;  3OTT A;  5FLX g;  5EMJ B;  2MTA H;  5CYK B;  1NEX B;  3EI2 B;  4J86 A;  3RLM D;  4ESG A;  2CO0 C;  3IJ1 A;  2HKM A;  5EM2 A;  2PBI B;  5C9Z B;  5EAM A;  1MG2 A;  3ULE C;  4PBZ A;  1N6D A;  5H17 A;  4XYH A;  3K26 A;  2OVP B;  1R5M A;  5GXH A;  3SVW D;  4NSX A;  4G56 B;  3I8E A;  3I7H A;  2AQ5 A;  1JMX B;  3C9C A;  1PI6 A;  4L3H D;  2UZY B;  3IIY A;  2XL2 A;  4FHL A;  5CYK A;  3JAM g;  4J8B A;  2XYI A;  3EI2 A;  2HJB A;  5FQD A;  5EMK B;  3SBQ A;  4Y5R D;  4A0B A;  3FRX A;  5H14 A;  2YMU A;  5K1C C;  4FA1 D;  4GQ2 P;  4I79 A;  5GSA A;  4TZ4 A;  4A08 B;  4ES0 A;  4Z8L A;  1XIP A;  4U1E I;  2I0R A;  2GC4 A;  2OIZ A;  4PXW A;  2AGX A;  3UVO A;  3KRX B;  3EI3 B;  4PC0 A;  2PM9 B;  4FB1 D;  4PSW B;  5EAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...