4ERZA

X-ray structure of wdr5-mll4 win motif peptide binary complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transferase
molecule keywords WD repeat-containing protein 5
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 304
sequence length 304
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4erzA00
4J81A 3EI2A 4A2MA 5K19A 3SLED 1N6EA 3OKTA 3MZLA 5IJ7E 2QXVA 2B5MA 3A0FA 2G9AA 5GXIA 3I2NA 5C9ZB 3K26A 1MG2A 3OW8A 4QL1A 2H68A 3UKUC 4ZN4A 4BH6A 3OL2B 2IWKA 4FA4D 4CZYA 2Z2NA 1K32A 3C5MA 2CO0C 3BG1A 1PBYB 4GGDA 5EM2A 5HE1B 3JPXA 3EI2B 5HYNB 1Q47A 3DXKC 4A0BA 5IGOA 3C99A 4PSWB 3JB9L 3AFCA 3I8CA 2Q7QA 2IAAA 3VGZA 3DXMC 5FKSA 4FA9D 3L4OD 2H6QA 1U2VC 4LGNA 4L3HD 5FKRA 5EMJB 1B9XA 1YFQA 5EALA 2AGWA 5EM2B 5GSAA 5HE0B 5B4WA 1A0RB 4X3EA 2I3SA 1XHMA 3I7PA 4A0BB 3CFSB 2QC5A 2J55H 5CXBA 4EWRA 2GC7A 3EMHA 4K3ID 4O45A 2IUVA 1PGUA 3NVXA 3SBRA 3F3PA 3AH8B 3BG0A 2YNOA 3IJCA 3OKYB 4O9DA 4PBYA 4ERQA 3RSEC 5H1MA 2CE9A 3PSLA 3SJLD 2XU7A 2O9KA 5A2Qg 1MG3A 3MKSB 4BUJC 1P22A 5CXBB 4NSXA 5EMLB 4ERYA 5EAMA 4GQ1A 5HQGA 3I7NA 2BCJB 5TDHB 4BL0A 3K27A 4FAND 1U4CA 3C75H 4CY3A 3SVWD 2P9SC 2Z2OA 3SBQA 2EBSA 3PE7A 3L4MD 2G99A 1GG2B 3EI3A 5AFU3 1N6FA 2YB8B 3DM0A 3SWSD 4MK0B 2H47A 4ZOZA 3V9FA 3IIYA 3SMRA 4AEZA 1K8KC 5IT9g 4XEIC 2GC4A 2YMUA 2TRCB 3I8EA 5I5MA 1JMXB 3SFZA 1JJUB 3CIKB 4O1QD 2AH0A 5H14A 3NVNA 3VA6A 3UVMA 2CN2A 3GREA 4QQEA 2AGXA 5I5IA 1NR0A 3P4FA 4A11A 3SBPA 4J77A 4U1EI 5CXCA 4CI3A 2H9PA 4JSNC 5HE2B 3EI1A 2PM7B 3E0CA 4KFMB 3MZKA 4CC9A 2Z2PA 4GZ8A 1B9YA 4J86A 5HE3B 3AL8A 5I5JA 2J57G 3JZNA 4ZOXA 2HKMA 5KDOB 1S4UX 4Z8LA 2IURA 1JOFA 2OK6A 5EMKB 5C2VB 4JT6C 4JD2C 4H5JA 5FKTA 2I0TA 2H9LA 3RFGA 3J81g 3DWLC 4E54A 4FB1D 3RRMC 5CXCB 4ZOYA 3UVNA 5CYKA 2CE8A 4JT5C 1ERJA 4L9OA 4A08A 2AGLA 1PEVA 2OIZA 4IA9A 4X63B 1TBGA 2P9UC 4K3JB 4J79A 4E5ZA 3AL8B 3RFHA 3PSCB 3RLMD 1N6DA 1OMWB 4GM8A 2XYIA 5SXMA 3V5WB 3I89A 2AGZA 3F3FA 2HYEA 4IMMA 5THAA 4E54B 3ORVD 4A0AA 2OK4A 3OTTA 2HJ4A 5CYKB 2CO0A 4CI2A 1GOTB 4A08B 2P9PC 2UZYB 2CN3A 2P9KC 4E5ZB 5TEFA 2YNPA 4X61B 4CZXA 4GM9A 4LG8A 1L0QA 3EI4A 3I7LA 3V7DB 2PM6B 2OVRB 3N0DA 3W15A 3N0EA 2H6NA 3DSMA 5EARA 4A0AB 3F3GA 2I3TA 2H9MA 3UVKA 4J78A 4ESGA 4J84A 2PBIB 1JMZB 3OL2A 3RN0D 3SHFA 4ERZA 4L1QD 2B5NA 1OLZA 4CY2A 3EI4B 5FKQA 4J8GA 3VH0A 2P9LC 3PXWD 5JWZA 2HXCA 1GP2B 3EI3B 4PNKB 5TEEA 1SQ9A 1XIPA 3KRWB 3FRXA 4R7AB 3RN1D 4AOWA 5IGQA 3UKRC 2AH1A 2IUPA 4GGCA 3UVOA 4PSXB 2B4EA 4U7AA 3HFQA 3FM0A 2XL3A 4GMBA 4A09A 4J0XA 2H9NA 5FXYA 5AJAA 4FWWA 4L3GD 4PC0A 5TF2A 2I0SA 3ZWLB 2AGYA 3BWSA 3MMYA 3SN6B 3AL9A 4ES0A 2AQ5A 3JRPA 2BBKH 4OWRA 4J8BA 3GFCA 4QT8A 3U4YA 4A11B 5IJ8E 5IC7A 2I0RA 5EMMB 3MXXA 4PXWA 4CZVA 4ZOVA 2XL2A 4JSXC 5K1CC 2H6KA 2YBAA 4J87A 4H5IA 1MDAH 3I7KA 1SHYB 4I79A 2CNXA 3UR4A 1SQJA 4D0KA 3EI1B 3IKOA 3KRXB 4Y7RA 3ULEC 3JZGA 2W18A 4A09B 3PXTD 4LG9A 3IIWA 3MKQA 3OKYA 3CFVA 4YVDA 2YNNA 3OKWA 3PVUB 4D6VA 4FAVD 3EU7A 4FA1D 4FA5D 4J82A 3RMZD 5H17A 1TYQC 4A7JA 4TZ4A 4J73A 3JAMg 1R5MA 1XKSA 4X60B 2P9IC 5EAPA 4GQBB 2HKRA 3ODTA 4HDJA 4CI8A 3JZHA 2IWFA 3SCYA 2H3XA 5FA5B 2H13A 4J0WA 2GNQA 4JSVC 5GXHA 4JXMA 2HJBA 3C9CA 4GM3A 3I7HA 2J56H 3PVWB 3SXTD 4GQ2P 4XYHA 1QNIA 2MTAH 4QRJA 4N14A 4CY5A 2UZXB 3I7OA 4CI1A 4CY1A 5GMKn 2PM9A 5FQDA 3UVLA 4OZUA 4FHLA 4JSPC 1VYHC 1GXRA 4GGAA 3IJ0A 2HESX 2P9NC 3JROA 4O3UB 3IJ1A 4G56B 1FWXA 3NVQA 2IUQA 4A2LA 3B7FA 4UI9R 5AMSA 2H14A 5FLXg 3EWEA 2B5LA 5C2WB 3J80g 4Y5RD 3PXSD 1NEXB 2OVPB 1PI6A 4PBZA 4XYIA 3FGBA 4O3TB 2OJYA 2OVQB 1RI6A 2PM9B 3EG6A
chains in the Genus database with same CATH superfamily
4J81A 3IVMA 1VZ3A 3EI2A 4A2MA 5K19A 3SLED 1N6EA 3OKTA 3MZLA 5IJ7E 4JHPC 2QXVA 2B5MA 4G55A 3A0FA 2G9AA 5GXIA 2EICA 3I2NA 5C9ZB 3K26A 1MG2A 2BKLA 3MUOA 4AMYA 3OW8A 4QL1A 3EQ9A 2H68A 3UKUC 4DNWA 4ZN4A 4BH6A 3O4HA 3OL2B 2IWKA 4FA4D 4CZYA 2Z2NA 1K32A 3C5MA 2CO0C 1L5GA 3BG1A 1PBYB 4GGDA 5EM2A 5HE1B 1QFMA 3JPXA 3EI2B 5HYNB 1Q47A 1VE6A 2VDOA 3GC3B 3DXKC 4A0BA 5IGOA 3C99A 4PSWB 3JB9L 3AFCA 2QR5A 3QHYB 3T3PA 3I8CA 2Q7QA 2IAAA 3VGZA 3DXMC 5FKSA 4FA9D 3L4OD 1H2ZA 2XE4A 3KCIA 2H6QA 1U2VC 4D9SA 4LGNA 4L3HD 2XDWA 4BCDA 5FKRA 5EMJB 1B9XA 1YFQA 5EALA 2AGWA 5EM2B 3NIDA 5GSAA 1H2XA 5HE0B 5B4WA 1I2MB 1A0RB 4WK4A 3T3MA 5E6SA 4X3EA 5M5UA 2I3SA 1XHMA 3I7PA 4A0BB 3CFSB 1A12A 4MMXA 2EIEA 2QC5A 2J55H 5CXBA 4EWRA 2GC7A 3EMHA 3EQ7A 4K3ID 4O45A 2HU5A 2IUVA 3EQ8A 1PGUA 3NVXA 3SBRA 3F3PA 3AH8B 5HDBA 3BG0A 3V4VA 2YNOA 3IJCA 1JV2A 3OKYB 4O9DA 4PBYA 4ERQA 3RSEC 5H1MA 2CE9A 1M1XA 3PSLA 3ZE0A 3SJLD 2XU7A 2O9KA 5A2Qg 1H2YA 1MG3A 3MKSB 4BUJC 1UOQA 1P22A 5CXBB 4NAAA 4NSXA 5EMLB 4NC4A 1E8MA 4ERYA 5EAMA 4GQ1A 1T2XA 5HQGA 3I7NA 1BPOA 3OF7A 2BCJB 5TDHB 4BL0A 3K27A 4FAND 1U4CA 3C75H 4CY3A 3SVWD 4AMZA 5M5TA 2P9SC 2Z2OA 3SBQA 2EBSA 3PE7A 3L4MD 2XZGA 2G99A 3QI0A 1GG2B 3EI3A 4WK2A 5AFU3 1UTCA 1N6FA 3IJEA 2YB8B 3DM0A 3SWSD 2H47A 4MK0B 4ZOZA 3V9FA 3IIYA 4O2WA 3SMRA 4AEZA 1K8KC 5IT9g 4XEIC 2GC4A 2YMUA 2TRCB 3GD1I 3IUQA 3I8EA 3V4PA 5I5MA 1VE7A 1JMXB 3SFZA 1JJUB 3CIKB 4O1QD 2AH0A 4WK0A 4G1MA 5M61A 5H14A 3NVNA 3VA6A 3UVMA 2CN2A 3GREA 4QQEA 4L1MA 2AGXA 5I5IA 3FCUA 4BCCA 1NR0A 1E5TA 3P4FA 4A11A 3SBPA 4J77A 4U1EI 5CXCA 4CI3A 2H9PA 3ZDZA 4JSNC 5HE2B 3EI1A 2PM7B 3E0CA 4KFMB 3MZKA 4CC9A 5M5SA 2Z2PA 4GZ8A 1B9YA 4J86A 2WQ8A 5HE3B 3AL8A 5I5JA 2J57G 3JZNA 4ZOXA 1C9IA 2HKMA 3IUJA 4RE5A 5KDOB 1S4UX 4Z8LA 2IURA 1JOFA 3ZE1A 2OK6A 5EMKB 5C2VB 4JT6C 4JD2C 4H5JA 5FKTA 5M5RA 2I0TA 2H9LA 3RFGA 3J81g 3DWLC 4E54A 4FB1D 3RRMC 3NIFA 5CXCB 4AN1A 4ZOYA 3UVNA 5CYKA 2CE8A 1GOHA 4JT5C 4QAMA 1ERJA 4L9OA 4A08A 2AGLA 1PEVA 3ZDXA 2OIZA 4IA9A 4X63B 1TBGA 2HU8A 2P9UC 4K3JB 4J79A 4E5ZA 2JKXA 3AL8B 3RFHA 3PSCB 3RLMD 3IULA 1N6DA 2EIDA 1OMWB 4GM8A 2XYIA 5SXMA 5C86A 4Z7OA 3V5WB 4UM8A 3I89A 2AGZA 3F3FA 2HYEA 4IMMA 5THAA 4E54B 3ORVD 4A0AA 3IUMA 2OK4A 3OTTA 2HJ4A 5CYKB 2CO0A 3MUNA 4CI2A 1GOTB 4A08B 2P9PC 2UZYB 2CN3A 4WJKA 1GOFA 2P9KC 4E5ZB 1H2WA 5TEFA 3VI3A 2YNPA 3O4IA 1O6GA 1E8NA 4X61B 3ZE2A 4CZXA 3FCSA 4GM9A 4LG8A 1L0QA 3EI4A 3I7LA 3V7DB 2PM6B 2OVRB 3N0DA 3W15A 4Z7QA 3N0EA 2H6NA 3DSMA 1GOGA 5EARA 4A0AB 4DNUA 3F3GA 2I3TA 4O02A 3VI4A 2H9MA 4RE6A 3UVKA 4J78A 4ESGA 1VZ2A 2PBIB 2VDKA 4J84A 4AX4A 1JMZB 3OL2A 3RN0D 3SHFA 4ERZA 4MMYA 4L1QD 2B5NA 1OLZA 2VDLA 4CY2A 3EI4B 5FKQA 1UOOA 4J8GA 3VH0A 2P9LC 3PXWD 5JWZA 2VDPA 3MVDK 4IRZA 2HXCA 1GP2B 3EI3B 4PNKB 5TEEA 1SQ9A 1XIPA 4JHNA 3KRWB 1U8CA 3FRXA 4R7AB 3RN1D 4DNVA 4BP8A 4NBMA 5E6RA 4AOWA 5E6UA 5IGQA 3UKRC 2AH1A 2IUPA 4GGCA 3UVOA 4PSXB 2B4EA 4U7AA 4NENA 3HFQA 3FM0A 2XL3A 4GMBA 4A09A 2EIBA 1QFSA 2H9NA 4J0XA 5FXYA 5AJAA 4AN0A 1YR2A 4FWWA 4L3GD 4PC0A 5TF2A 2I0SA 3ZWLB 3K6SA 2AGYA 3BWSA 4BCBA 2VC2A 3MMYA 3SN6B 3AL9A 4ES0A 2AQ5A 3JRPA 2BBKH 4OWRA 4J8BA 3GFCA 3DDUA 4QT8A 3U4YA 3IUNA 4A11B 5IJ8E 5IC7A 2I0RA 5FFGA 1UOPA 3MXXA 4PXWA 5EMMB 4CZVA 4ZOVA 2XL2A 4JSXC 5K1CC 2H6KA 2YBAA 2VZ1A 4J87A 4H5IA 1MDAH 3I7KA 1SHYB 1C9LA 2CNXA 4I79A 1SQJA 3UR4A 4D0KA 3EI1B 3IKOA 3KRXB 4Y7RA 3ULEC 5C92A 3JZGA 2W18A 4A09B 3PXTD 4LG9A 3MKQA 3IIWA 3OKYA 3CFVA 3NIGA 4YVDA 2YNNA 3OKWA 3PVUB 4D6VA 2VDMA 3EU7A 4FAVD 4MMZA 4FA1D 4FA5D 5M5VA 4J82A 3RMZD 5H17A 1TYQC 4A7JA 3O4GA 4TZ4A 4J73A 3JAMg 1R5MA 1XKSA 4X60B 2P9IC 5EAPA 4GQBB 2HKRA 3ODTA 4HDJA 4CI8A 3JZHA 2IWFA 3SCYA 3IURA 4BP9A 2H3XA 5FA5B 2H13A 4J0WA 2GNQA 4JSVC 5GXHA 4JXMA 2HJBA 4G1EA 3C9CA 4GM3A 3I7HA 2J56H 3PVWB 3SXTD 4GQ2P 2VDQA 4XYHA 1QNIA 4UM9A 2MTAH 4QRJA 4N14A 4CY5A 2UZXB 3I7OA 2HU7A 4CI1A 4CY1A 5GMKn 2PM9A 3K72A 1JTDB 5FQDA 3UVLA 4OZUA 4Z7NA 4FHLA 4JSPC 1VYHC 1GXRA 4GGAA 1K3IA 5FFOA 3ZDYA 3IJ0A 2HESX 3JROA 2P9NC 3O4JA 3IJ1A 4O3UB 4G56B 1FWXA 3NVQA 2IUQA 4A2LA 3B7FA 4UI9R 5AMSA 2H14A 5FLXg 2VDRA 2QZPA 2VZ3A 3EWEA 2B5LA 5C2WB 3J80g 4Y5RD 3PXSD 1NEXB 1TYEA 2OVPB 1PI6A 2VDNA 4PBZA 4XYIA 3FGBA 3K71A 4O3TB 2OJYA 1O6FA 2OVQB 1RI6A 2PM9B 3EG6A
chains in the Genus database with same CATH topology
4J81A 3EI2A 4A2MA 5K19A 3SLED 1N6EA 3OKTA 3MZLA 5IJ7E 2QXVA 2B5MA 3A0FA 2G9AA 5GXIA 3I2NA 5C9ZB 3K26A 1MG2A 3OW8A 4QL1A 2H68A 3UKUC 4ZN4A 4BH6A 3OL2B 2IWKA 4FA4D 4CZYA 2Z2NA 1K32A 3C5MA 2CO0C 3BG1A 1PBYB 4GGDA 5EM2A 5HE1B 3JPXA 3EI2B 5HYNB 1Q47A 3DXKC 4A0BA 5IGOA 3C99A 4PSWB 3JB9L 3AFCA 3I8CA 2Q7QA 2IAAA 3VGZA 3DXMC 5FKSA 4FA9D 3L4OD 2H6QA 1U2VC 4LGNA 4L3HD 5FKRA 5EMJB 1B9XA 1YFQA 5EALA 2AGWA 5EM2B 5GSAA 5HE0B 5B4WA 1A0RB 4X3EA 2I3SA 1XHMA 3I7PA 4A0BB 3CFSB 2QC5A 2J55H 5CXBA 4EWRA 2GC7A 3EMHA 4K3ID 4O45A 2IUVA 1PGUA 3NVXA 3SBRA 3F3PA 3AH8B 3BG0A 2YNOA 3IJCA 3OKYB 4O9DA 4PBYA 4ERQA 3RSEC 5H1MA 2CE9A 3PSLA 3SJLD 2XU7A 2O9KA 5A2Qg 1MG3A 3MKSB 4BUJC 1P22A 5CXBB 4NSXA 5EMLB 4ERYA 5EAMA 4GQ1A 5HQGA 3I7NA 2BCJB 5TDHB 4BL0A 3K27A 4FAND 1U4CA 3C75H 4CY3A 3SVWD 2P9SC 2Z2OA 3SBQA 2EBSA 3PE7A 3L4MD 2G99A 1GG2B 3EI3A 5AFU3 1N6FA 2YB8B 3DM0A 3SWSD 4MK0B 2H47A 4ZOZA 3V9FA 3IIYA 3SMRA 4AEZA 1K8KC 5IT9g 4XEIC 2GC4A 2YMUA 2TRCB 3I8EA 5I5MA 1JMXB 3SFZA 1JJUB 3CIKB 4O1QD 2AH0A 5H14A 3NVNA 3VA6A 3UVMA 2CN2A 3GREA 4QQEA 2AGXA 5I5IA 1NR0A 3P4FA 4A11A 3SBPA 4J77A 4U1EI 5CXCA 4CI3A 2H9PA 4JSNC 5HE2B 3EI1A 2PM7B 3E0CA 4KFMB 3MZKA 4CC9A 2Z2PA 4GZ8A 1B9YA 4J86A 5HE3B 3AL8A 5I5JA 2J57G 3JZNA 4ZOXA 2HKMA 5KDOB 1S4UX 4Z8LA 2IURA 1JOFA 2OK6A 5EMKB 5C2VB 4JT6C 4JD2C 4H5JA 5FKTA 2I0TA 2H9LA 3RFGA 3J81g 3DWLC 4E54A 4FB1D 3RRMC 5CXCB 4ZOYA 3UVNA 5CYKA 2CE8A 4JT5C 1ERJA 4L9OA 4A08A 2AGLA 1PEVA 2OIZA 4IA9A 4X63B 1TBGA 2P9UC 4K3JB 4J79A 4E5ZA 3AL8B 3RFHA 3PSCB 3RLMD 1N6DA 1OMWB 4GM8A 2XYIA 5SXMA 3V5WB 3I89A 2AGZA 3F3FA 2HYEA 4IMMA 5THAA 4E54B 3ORVD 4A0AA 2OK4A 3OTTA 2HJ4A 5CYKB 2CO0A 4CI2A 1GOTB 4A08B 2P9PC 2UZYB 2CN3A 2P9KC 4E5ZB 5TEFA 2YNPA 4X61B 4CZXA 4GM9A 4LG8A 1L0QA 3EI4A 3I7LA 3V7DB 2PM6B 2OVRB 3N0DA 3W15A 3N0EA 2H6NA 3DSMA 5EARA 4A0AB 3F3GA 2I3TA 2H9MA 3UVKA 4J78A 4ESGA 4J84A 2PBIB 1JMZB 3OL2A 3RN0D 3SHFA 4ERZA 4L1QD 2B5NA 1OLZA 4CY2A 3EI4B 5FKQA 4J8GA 3VH0A 2P9LC 3PXWD 5JWZA 2HXCA 1GP2B 3EI3B 4PNKB 5TEEA 1SQ9A 1XIPA 3KRWB 3FRXA 4R7AB 3RN1D 4AOWA 5IGQA 3UKRC 2AH1A 2IUPA 4GGCA 3UVOA 4PSXB 2B4EA 4U7AA 3HFQA 3FM0A 2XL3A 4GMBA 4A09A 4J0XA 2H9NA 5FXYA 5AJAA 4FWWA 4L3GD 4PC0A 5TF2A 2I0SA 3ZWLB 2AGYA 3BWSA 3MMYA 3SN6B 3AL9A 4ES0A 2AQ5A 3JRPA 2BBKH 4OWRA 4J8BA 3GFCA 4QT8A 3U4YA 4A11B 5IJ8E 5IC7A 2I0RA 5EMMB 3MXXA 4PXWA 4CZVA 4ZOVA 2XL2A 4JSXC 5K1CC 2H6KA 2YBAA 4J87A 4H5IA 1MDAH 3I7KA 1SHYB 4I79A 2CNXA 3UR4A 1SQJA 4D0KA 3EI1B 3IKOA 3KRXB 4Y7RA 3ULEC 3JZGA 2W18A 4A09B 3PXTD 4LG9A 3IIWA 3MKQA 3OKYA 3CFVA 4YVDA 2YNNA 3OKWA 3PVUB 4D6VA 4FAVD 3EU7A 4FA1D 4FA5D 4J82A 3RMZD 5H17A 1TYQC 4A7JA 4TZ4A 4J73A 3JAMg 1R5MA 1XKSA 4X60B 2P9IC 5EAPA 4GQBB 2HKRA 3ODTA 4HDJA 4CI8A 3JZHA 2IWFA 3SCYA 2H3XA 5FA5B 2H13A 4J0WA 2GNQA 4JSVC 5GXHA 4JXMA 2HJBA 3C9CA 4GM3A 3I7HA 2J56H 3PVWB 3SXTD 4GQ2P 4XYHA 1QNIA 2MTAH 4QRJA 4N14A 4CY5A 2UZXB 3I7OA 4CI1A 4CY1A 5GMKn 2PM9A 5FQDA 3UVLA 4OZUA 4FHLA 4JSPC 1VYHC 1GXRA 4GGAA 3IJ0A 2HESX 2P9NC 3JROA 4O3UB 3IJ1A 4G56B 1FWXA 3NVQA 2IUQA 4A2LA 3B7FA 4UI9R 5AMSA 2H14A 5FLXg 3EWEA 2B5LA 5C2WB 3J80g 4Y5RD 3PXSD 1NEXB 2OVPB 1PI6A 4PBZA 4XYIA 3FGBA 4O3TB 2OJYA 2OVQB 1RI6A 2PM9B 3EG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J81 A;  3EI2 A;  4A2M A;  5K19 A;  3SLE D;  1N6E A;  3OKT A;  3MZL A;  5IJ7 E;  2QXV A;  2B5M A;  3A0F A;  2G9A A;  5GXI A;  3I2N A;  5C9Z B;  3K26 A;  1MG2 A;  3OW8 A;  4QL1 A;  2H68 A;  3UKU C;  4ZN4 A;  4BH6 A;  3OL2 B;  2IWK A;  4FA4 D;  4CZY A;  2Z2N A;  1K32 A;  3C5M A;  2CO0 C;  3BG1 A;  1PBY B;  4GGD A;  5EM2 A;  5HE1 B;  3JPX A;  3EI2 B;  5HYN B;  1Q47 A;  3DXK C;  4A0B A;  5IGO A;  3C99 A;  4PSW B;  3JB9 L;  3AFC A;  3I8C A;  2Q7Q A;  2IAA A;  3VGZ A;  3DXM C;  5FKS A;  4FA9 D;  3L4O D;  2H6Q A;  1U2V C;  4LGN A;  4L3H D;  5FKR A;  5EMJ B;  1B9X A;  1YFQ A;  5EAL A;  2AGW A;  5EM2 B;  5GSA A;  5HE0 B;  5B4W A;  1A0R B;  4X3E A;  2I3S A;  1XHM A;  3I7P A;  4A0B B;  3CFS B;  2QC5 A;  2J55 H;  5CXB A;  4EWR A;  2GC7 A;  3EMH A;  4K3I D;  4O45 A;  2IUV A;  1PGU A;  3NVX A;  3SBR A;  3F3P A;  3AH8 B;  3BG0 A;  2YNO A;  3IJC A;  3OKY B;  4O9D A;  4PBY A;  4ERQ A;  3RSE C;  5H1M A;  2CE9 A;  3PSL A;  3SJL D;  2XU7 A;  2O9K A;  5A2Q g;  1MG3 A;  3MKS B;  4BUJ C;  1P22 A;  5CXB B;  4NSX A;  5EML B;  4ERY A;  5EAM A;  4GQ1 A;  5HQG A;  3I7N A;  2BCJ B;  5TDH B;  4BL0 A;  3K27 A;  4FAN D;  1U4C A;  3C75 H;  4CY3 A;  3SVW D;  2P9S C;  2Z2O A;  3SBQ A;  2EBS A;  3PE7 A;  3L4M D;  2G99 A;  1GG2 B;  3EI3 A;  5AFU 3;  1N6F A;  2YB8 B;  3DM0 A;  3SWS D;  4MK0 B;  2H47 A;  4ZOZ A;  3V9F A;  3IIY A;  3SMR A;  4AEZ A;  1K8K C;  5IT9 g;  4XEI C;  2GC4 A;  2YMU A;  2TRC B;  3I8E A;  5I5M A;  1JMX B;  3SFZ A;  1JJU B;  3CIK B;  4O1Q D;  2AH0 A;  5H14 A;  3NVN A;  3VA6 A;  3UVM A;  2CN2 A;  3GRE A;  4QQE A;  2AGX A;  5I5I A;  1NR0 A;  3P4F A;  4A11 A;  3SBP A;  4J77 A;  4U1E I;  5CXC A;  4CI3 A;  2H9P A;  4JSN C;  5HE2 B;  3EI1 A;  2PM7 B;  3E0C A;  4KFM B;  3MZK A;  4CC9 A;  2Z2P A;  4GZ8 A;  1B9Y A;  4J86 A;  5HE3 B;  3AL8 A;  5I5J A;  2J57 G;  3JZN A;  4ZOX A;  2HKM A;  5KDO B;  1S4U X;  4Z8L A;  2IUR A;  1JOF A;  2OK6 A;  5EMK B;  5C2V B;  4JT6 C;  4JD2 C;  4H5J A;  5FKT A;  2I0T A;  2H9L A;  3RFG A;  3J81 g;  3DWL C;  4E54 A;  4FB1 D;  3RRM C;  5CXC B;  4ZOY A;  3UVN A;  5CYK A;  2CE8 A;  4JT5 C;  1ERJ A;  4L9O A;  4A08 A;  2AGL A;  1PEV A;  2OIZ A;  4IA9 A;  4X63 B;  1TBG A;  2P9U C;  4K3J B;  4J79 A;  4E5Z A;  3AL8 B;  3RFH A;  3PSC B;  3RLM D;  1N6D A;  1OMW B;  4GM8 A;  2XYI A;  5SXM A;  3V5W B;  3I89 A;  2AGZ A;  3F3F A;  2HYE A;  4IMM A;  5THA A;  4E54 B;  3ORV D;  4A0A A;  2OK4 A;  3OTT A;  2HJ4 A;  5CYK B;  2CO0 A;  4CI2 A;  1GOT B;  4A08 B;  2P9P C;  2UZY B;  2CN3 A;  2P9K C;  4E5Z B;  5TEF A;  2YNP A;  4X61 B;  4CZX A;  4GM9 A;  4LG8 A;  1L0Q A;  3EI4 A;  3I7L A;  3V7D B;  2PM6 B;  2OVR B;  3N0D A;  3W15 A;  3N0E A;  2H6N A;  3DSM A;  5EAR A;  4A0A B;  3F3G A;  2I3T A;  2H9M A;  3UVK A;  4J78 A;  4ESG A;  4J84 A;  2PBI B;  1JMZ B;  3OL2 A;  3RN0 D;  3SHF A;  4ERZ A;  4L1Q D;  2B5N A;  1OLZ A;  4CY2 A;  3EI4 B;  5FKQ A;  4J8G A;  3VH0 A;  2P9L C;  3PXW D;  5JWZ A;  2HXC A;  1GP2 B;  3EI3 B;  4PNK B;  5TEE A;  1SQ9 A;  1XIP A;  3KRW B;  3FRX A;  4R7A B;  3RN1 D;  4AOW A;  5IGQ A;  3UKR C;  2AH1 A;  2IUP A;  4GGC A;  3UVO A;  4PSX B;  2B4E A;  4U7A A;  3HFQ A;  3FM0 A;  2XL3 A;  4GMB A;  4A09 A;  4J0X A;  2H9N A;  5FXY A;  5AJA A;  4FWW A;  4L3G D;  4PC0 A;  5TF2 A;  2I0S A;  3ZWL B;  2AGY A;  3BWS A;  3MMY A;  3SN6 B;  3AL9 A;  4ES0 A;  2AQ5 A;  3JRP A;  2BBK H;  4OWR A;  4J8B A;  3GFC A;  4QT8 A;  3U4Y A;  4A11 B;  5IJ8 E;  5IC7 A;  2I0R A;  5EMM B;  3MXX A;  4PXW A;  4CZV A;  4ZOV A;  2XL2 A;  4JSX C;  5K1C C;  2H6K A;  2YBA A;  4J87 A;  4H5I A;  1MDA H;  3I7K A;  1SHY B;  4I79 A;  2CNX A;  3UR4 A;  1SQJ A;  4D0K A;  3EI1 B;  3IKO A;  3KRX B;  4Y7R A;  3ULE C;  3JZG A;  2W18 A;  4A09 B;  3PXT D;  4LG9 A;  3IIW A;  3MKQ A;  3OKY A;  3CFV A;  4YVD A;  2YNN A;  3OKW A;  3PVU B;  4D6V A;  4FAV D;  3EU7 A;  4FA1 D;  4FA5 D;  4J82 A;  3RMZ D;  5H17 A;  1TYQ C;  4A7J A;  4TZ4 A;  4J73 A;  3JAM g;  1R5M A;  1XKS A;  4X60 B;  2P9I C;  5EAP A;  4GQB B;  2HKR A;  3ODT A;  4HDJ A;  4CI8 A;  3JZH A;  2IWF A;  3SCY A;  2H3X A;  5FA5 B;  2H13 A;  4J0W A;  2GNQ A;  4JSV C;  5GXH A;  4JXM A;  2HJB A;  3C9C A;  4GM3 A;  3I7H A;  2J56 H;  3PVW B;  3SXT D;  4GQ2 P;  4XYH A;  1QNI A;  2MTA H;  4QRJ A;  4N14 A;  4CY5 A;  2UZX B;  3I7O A;  4CI1 A;  4CY1 A;  5GMK n;  2PM9 A;  5FQD A;  3UVL A;  4OZU A;  4FHL A;  4JSP C;  1VYH C;  1GXR A;  4GGA A;  3IJ0 A;  2HES X;  2P9N C;  3JRO A;  4O3U B;  3IJ1 A;  4G56 B;  1FWX A;  3NVQ A;  2IUQ A;  4A2L A;  3B7F A;  4UI9 R;  5AMS A;  2H14 A;  5FLX g;  3EWE A;  2B5L A;  5C2W B;  3J80 g;  4Y5R D;  3PXS D;  1NEX B;  2OVP B;  1PI6 A;  4PBZ A;  4XYI A;  3FGB A;  4O3T B;  2OJY A;  2OVQ B;  1RI6 A;  2PM9 B;  3EG6 A; 
#chains in the Genus database with same CATH topology
 4J81 A;  3IVM A;  1VZ3 A;  3EI2 A;  4A2M A;  5K19 A;  3SLE D;  1N6E A;  3OKT A;  3MZL A;  5IJ7 E;  4JHP C;  2QXV A;  2B5M A;  4G55 A;  3A0F A;  2G9A A;  5GXI A;  2EIC A;  3I2N A;  5C9Z B;  3K26 A;  1MG2 A;  2BKL A;  3MUO A;  4AMY A;  3OW8 A;  4QL1 A;  3EQ9 A;  2H68 A;  3UKU C;  4DNW A;  4ZN4 A;  4BH6 A;  3O4H A;  3OL2 B;  2IWK A;  4FA4 D;  4CZY A;  2Z2N A;  1K32 A;  3C5M A;  2CO0 C;  1L5G A;  3BG1 A;  1PBY B;  4GGD A;  5EM2 A;  5HE1 B;  1QFM A;  3JPX A;  3EI2 B;  5HYN B;  1Q47 A;  1VE6 A;  2VDO A;  3GC3 B;  3DXK C;  4A0B A;  5IGO A;  3C99 A;  4PSW B;  3JB9 L;  3AFC A;  2QR5 A;  3QHY B;  3T3P A;  3I8C A;  2Q7Q A;  2IAA A;  3VGZ A;  3DXM C;  5FKS A;  4FA9 D;  3L4O D;  1H2Z A;  2XE4 A;  3KCI A;  2H6Q A;  1U2V C;  4D9S A;  4LGN A;  4L3H D;  2XDW A;  4BCD A;  5FKR A;  5EMJ B;  1B9X A;  1YFQ A;  5EAL A;  2AGW A;  5EM2 B;  3NID A;  5GSA A;  1H2X A;  5HE0 B;  5B4W A;  1I2M B;  1A0R B;  4WK4 A;  3T3M A;  5E6S A;  4X3E A;  5M5U A;  2I3S A;  1XHM A;  3I7P A;  4A0B B;  3CFS B;  1A12 A;  4MMX A;  2EIE A;  2QC5 A;  2J55 H;  5CXB A;  4EWR A;  2GC7 A;  3EMH A;  3EQ7 A;  4K3I D;  4O45 A;  2HU5 A;  2IUV A;  3EQ8 A;  1PGU A;  3NVX A;  3SBR A;  3F3P A;  3AH8 B;  5HDB A;  3BG0 A;  3V4V A;  2YNO A;  3IJC A;  1JV2 A;  3OKY B;  4O9D A;  4PBY A;  4ERQ A;  3RSE C;  5H1M A;  2CE9 A;  1M1X A;  3PSL A;  3ZE0 A;  3SJL D;  2XU7 A;  2O9K A;  5A2Q g;  1H2Y A;  1MG3 A;  3MKS B;  4BUJ C;  1UOQ A;  1P22 A;  5CXB B;  4NAA A;  4NSX A;  5EML B;  4NC4 A;  1E8M A;  4ERY A;  5EAM A;  4GQ1 A;  1T2X A;  5HQG A;  3I7N A;  1BPO A;  3OF7 A;  2BCJ B;  5TDH B;  4BL0 A;  3K27 A;  4FAN D;  1U4C A;  3C75 H;  4CY3 A;  3SVW D;  4AMZ A;  5M5T A;  2P9S C;  2Z2O A;  3SBQ A;  2EBS A;  3PE7 A;  3L4M D;  2XZG A;  2G99 A;  3QI0 A;  1GG2 B;  3EI3 A;  4WK2 A;  5AFU 3;  1UTC A;  1N6F A;  3IJE A;  2YB8 B;  3DM0 A;  3SWS D;  2H47 A;  4MK0 B;  4ZOZ A;  3V9F A;  3IIY A;  4O2W A;  3SMR A;  4AEZ A;  1K8K C;  5IT9 g;  4XEI C;  2GC4 A;  2YMU A;  2TRC B;  3GD1 I;  3IUQ A;  3I8E A;  3V4P A;  5I5M A;  1VE7 A;  1JMX B;  3SFZ A;  1JJU B;  3CIK B;  4O1Q D;  2AH0 A;  4WK0 A;  4G1M A;  5M61 A;  5H14 A;  3NVN A;  3VA6 A;  3UVM A;  2CN2 A;  3GRE A;  4QQE A;  4L1M A;  2AGX A;  5I5I A;  3FCU A;  4BCC A;  1NR0 A;  1E5T A;  3P4F A;  4A11 A;  3SBP A;  4J77 A;  4U1E I;  5CXC A;  4CI3 A;  2H9P A;  3ZDZ A;  4JSN C;  5HE2 B;  3EI1 A;  2PM7 B;  3E0C A;  4KFM B;  3MZK A;  4CC9 A;  5M5S A;  2Z2P A;  4GZ8 A;  1B9Y A;  4J86 A;  2WQ8 A;  5HE3 B;  3AL8 A;  5I5J A;  2J57 G;  3JZN A;  4ZOX A;  1C9I A;  2HKM A;  3IUJ A;  4RE5 A;  5KDO B;  1S4U X;  4Z8L A;  2IUR A;  1JOF A;  3ZE1 A;  2OK6 A;  5EMK B;  5C2V B;  4JT6 C;  4JD2 C;  4H5J A;  5FKT A;  5M5R A;  2I0T A;  2H9L A;  3RFG A;  3J81 g;  3DWL C;  4E54 A;  4FB1 D;  3RRM C;  3NIF A;  5CXC B;  4AN1 A;  4ZOY A;  3UVN A;  5CYK A;  2CE8 A;  1GOH A;  4JT5 C;  4QAM A;  1ERJ A;  4L9O A;  4A08 A;  2AGL A;  1PEV A;  3ZDX A;  2OIZ A;  4IA9 A;  4X63 B;  1TBG A;  2HU8 A;  2P9U C;  4K3J B;  4J79 A;  4E5Z A;  2JKX A;  3AL8 B;  3RFH A;  3PSC B;  3RLM D;  3IUL A;  1N6D A;  2EID A;  1OMW B;  4GM8 A;  2XYI A;  5SXM A;  5C86 A;  4Z7O A;  3V5W B;  4UM8 A;  3I89 A;  2AGZ A;  3F3F A;  2HYE A;  4IMM A;  5THA A;  4E54 B;  3ORV D;  4A0A A;  3IUM A;  2OK4 A;  3OTT A;  2HJ4 A;  5CYK B;  2CO0 A;  3MUN A;  4CI2 A;  1GOT B;  4A08 B;  2P9P C;  2UZY B;  2CN3 A;  4WJK A;  1GOF A;  2P9K C;  4E5Z B;  1H2W A;  5TEF A;  3VI3 A;  2YNP A;  3O4I A;  1O6G A;  1E8N A;  4X61 B;  3ZE2 A;  4CZX A;  3FCS A;  4GM9 A;  4LG8 A;  1L0Q A;  3EI4 A;  3I7L A;  3V7D B;  2PM6 B;  2OVR B;  3N0D A;  3W15 A;  4Z7Q A;  3N0E A;  2H6N A;  3DSM A;  1GOG A;  5EAR A;  4A0A B;  4DNU A;  3F3G A;  2I3T A;  4O02 A;  3VI4 A;  2H9M A;  4RE6 A;  3UVK A;  4J78 A;  4ESG A;  1VZ2 A;  2PBI B;  2VDK A;  4J84 A;  4AX4 A;  1JMZ B;  3OL2 A;  3RN0 D;  3SHF A;  4ERZ A;  4MMY A;  4L1Q D;  2B5N A;  1OLZ A;  2VDL A;  4CY2 A;  3EI4 B;  5FKQ A;  1UOO A;  4J8G A;  3VH0 A;  2P9L C;  3PXW D;  5JWZ A;  2VDP A;  3MVD K;  4IRZ A;  2HXC A;  1GP2 B;  3EI3 B;  4PNK B;  5TEE A;  1SQ9 A;  1XIP A;  4JHN A;  3KRW B;  1U8C A;  3FRX A;  4R7A B;  3RN1 D;  4DNV A;  4BP8 A;  4NBM A;  5E6R A;  4AOW A;  5E6U A;  5IGQ A;  3UKR C;  2AH1 A;  2IUP A;  4GGC A;  3UVO A;  4PSX B;  2B4E A;  4U7A A;  4NEN A;  3HFQ A;  3FM0 A;  2XL3 A;  4GMB A;  4A09 A;  2EIB A;  1QFS A;  2H9N A;  4J0X A;  5FXY A;  5AJA A;  4AN0 A;  1YR2 A;  4FWW A;  4L3G D;  4PC0 A;  5TF2 A;  2I0S A;  3ZWL B;  3K6S A;  2AGY A;  3BWS A;  4BCB A;  2VC2 A;  3MMY A;  3SN6 B;  3AL9 A;  4ES0 A;  2AQ5 A;  3JRP A;  2BBK H;  4OWR A;  4J8B A;  3GFC A;  3DDU A;  4QT8 A;  3U4Y A;  3IUN A;  4A11 B;  5IJ8 E;  5IC7 A;  2I0R A;  5FFG A;  1UOP A;  3MXX A;  4PXW A;  5EMM B;  4CZV A;  4ZOV A;  2XL2 A;  4JSX C;  5K1C C;  2H6K A;  2YBA A;  2VZ1 A;  4J87 A;  4H5I A;  1MDA H;  3I7K A;  1SHY B;  1C9L A;  2CNX A;  4I79 A;  1SQJ A;  3UR4 A;  4D0K A;  3EI1 B;  3IKO A;  3KRX B;  4Y7R A;  3ULE C;  5C92 A;  3JZG A;  2W18 A;  4A09 B;  3PXT D;  4LG9 A;  3MKQ A;  3IIW A;  3OKY A;  3CFV A;  3NIG A;  4YVD A;  2YNN A;  3OKW A;  3PVU B;  4D6V A;  2VDM A;  3EU7 A;  4FAV D;  4MMZ A;  4FA1 D;  4FA5 D;  5M5V A;  4J82 A;  3RMZ D;  5H17 A;  1TYQ C;  4A7J A;  3O4G A;  4TZ4 A;  4J73 A;  3JAM g;  1R5M A;  1XKS A;  4X60 B;  2P9I C;  5EAP A;  4GQB B;  2HKR A;  3ODT A;  4HDJ A;  4CI8 A;  3JZH A;  2IWF A;  3SCY A;  3IUR A;  4BP9 A;  2H3X A;  5FA5 B;  2H13 A;  4J0W A;  2GNQ A;  4JSV C;  5GXH A;  4JXM A;  2HJB A;  4G1E A;  3C9C A;  4GM3 A;  3I7H A;  2J56 H;  3PVW B;  3SXT D;  4GQ2 P;  2VDQ A;  4XYH A;  1QNI A;  4UM9 A;  2MTA H;  4QRJ A;  4N14 A;  4CY5 A;  2UZX B;  3I7O A;  2HU7 A;  4CI1 A;  4CY1 A;  5GMK n;  2PM9 A;  3K72 A;  1JTD B;  5FQD A;  3UVL A;  4OZU A;  4Z7N A;  4FHL A;  4JSP C;  1VYH C;  1GXR A;  4GGA A;  1K3I A;  5FFO A;  3ZDY A;  3IJ0 A;  2HES X;  3JRO A;  2P9N C;  3O4J A;  3IJ1 A;  4O3U B;  4G56 B;  1FWX A;  3NVQ A;  2IUQ A;  4A2L A;  3B7F A;  4UI9 R;  5AMS A;  2H14 A;  5FLX g;  2VDR A;  2QZP A;  2VZ3 A;  3EWE A;  2B5L A;  5C2W B;  3J80 g;  4Y5R D;  3PXS D;  1NEX B;  1TYE A;  2OVP B;  1PI6 A;  2VDN A;  4PBZ A;  4XYI A;  3FGB A;  3K71 A;  4O3T B;  2OJY A;  1O6F A;  2OVQ B;  1RI6 A;  2PM9 B;  3EG6 A; 
#chains in the Genus database with same CATH homology
 4J81 A;  3EI2 A;  4A2M A;  5K19 A;  3SLE D;  1N6E A;  3OKT A;  3MZL A;  5IJ7 E;  2QXV A;  2B5M A;  3A0F A;  2G9A A;  5GXI A;  3I2N A;  5C9Z B;  3K26 A;  1MG2 A;  3OW8 A;  4QL1 A;  2H68 A;  3UKU C;  4ZN4 A;  4BH6 A;  3OL2 B;  2IWK A;  4FA4 D;  4CZY A;  2Z2N A;  1K32 A;  3C5M A;  2CO0 C;  3BG1 A;  1PBY B;  4GGD A;  5EM2 A;  5HE1 B;  3JPX A;  3EI2 B;  5HYN B;  1Q47 A;  3DXK C;  4A0B A;  5IGO A;  3C99 A;  4PSW B;  3JB9 L;  3AFC A;  3I8C A;  2Q7Q A;  2IAA A;  3VGZ A;  3DXM C;  5FKS A;  4FA9 D;  3L4O D;  2H6Q A;  1U2V C;  4LGN A;  4L3H D;  5FKR A;  5EMJ B;  1B9X A;  1YFQ A;  5EAL A;  2AGW A;  5EM2 B;  5GSA A;  5HE0 B;  5B4W A;  1A0R B;  4X3E A;  2I3S A;  1XHM A;  3I7P A;  4A0B B;  3CFS B;  2QC5 A;  2J55 H;  5CXB A;  4EWR A;  2GC7 A;  3EMH A;  4K3I D;  4O45 A;  2IUV A;  1PGU A;  3NVX A;  3SBR A;  3F3P A;  3AH8 B;  3BG0 A;  2YNO A;  3IJC A;  3OKY B;  4O9D A;  4PBY A;  4ERQ A;  3RSE C;  5H1M A;  2CE9 A;  3PSL A;  3SJL D;  2XU7 A;  2O9K A;  5A2Q g;  1MG3 A;  3MKS B;  4BUJ C;  1P22 A;  5CXB B;  4NSX A;  5EML B;  4ERY A;  5EAM A;  4GQ1 A;  5HQG A;  3I7N A;  2BCJ B;  5TDH B;  4BL0 A;  3K27 A;  4FAN D;  1U4C A;  3C75 H;  4CY3 A;  3SVW D;  2P9S C;  2Z2O A;  3SBQ A;  2EBS A;  3PE7 A;  3L4M D;  2G99 A;  1GG2 B;  3EI3 A;  5AFU 3;  1N6F A;  2YB8 B;  3DM0 A;  3SWS D;  4MK0 B;  2H47 A;  4ZOZ A;  3V9F A;  3IIY A;  3SMR A;  4AEZ A;  1K8K C;  5IT9 g;  4XEI C;  2GC4 A;  2YMU A;  2TRC B;  3I8E A;  5I5M A;  1JMX B;  3SFZ A;  1JJU B;  3CIK B;  4O1Q D;  2AH0 A;  5H14 A;  3NVN A;  3VA6 A;  3UVM A;  2CN2 A;  3GRE A;  4QQE A;  2AGX A;  5I5I A;  1NR0 A;  3P4F A;  4A11 A;  3SBP A;  4J77 A;  4U1E I;  5CXC A;  4CI3 A;  2H9P A;  4JSN C;  5HE2 B;  3EI1 A;  2PM7 B;  3E0C A;  4KFM B;  3MZK A;  4CC9 A;  2Z2P A;  4GZ8 A;  1B9Y A;  4J86 A;  5HE3 B;  3AL8 A;  5I5J A;  2J57 G;  3JZN A;  4ZOX A;  2HKM A;  5KDO B;  1S4U X;  4Z8L A;  2IUR A;  1JOF A;  2OK6 A;  5EMK B;  5C2V B;  4JT6 C;  4JD2 C;  4H5J A;  5FKT A;  2I0T A;  2H9L A;  3RFG A;  3J81 g;  3DWL C;  4E54 A;  4FB1 D;  3RRM C;  5CXC B;  4ZOY A;  3UVN A;  5CYK A;  2CE8 A;  4JT5 C;  1ERJ A;  4L9O A;  4A08 A;  2AGL A;  1PEV A;  2OIZ A;  4IA9 A;  4X63 B;  1TBG A;  2P9U C;  4K3J B;  4J79 A;  4E5Z A;  3AL8 B;  3RFH A;  3PSC B;  3RLM D;  1N6D A;  1OMW B;  4GM8 A;  2XYI A;  5SXM A;  3V5W B;  3I89 A;  2AGZ A;  3F3F A;  2HYE A;  4IMM A;  5THA A;  4E54 B;  3ORV D;  4A0A A;  2OK4 A;  3OTT A;  2HJ4 A;  5CYK B;  2CO0 A;  4CI2 A;  1GOT B;  4A08 B;  2P9P C;  2UZY B;  2CN3 A;  2P9K C;  4E5Z B;  5TEF A;  2YNP A;  4X61 B;  4CZX A;  4GM9 A;  4LG8 A;  1L0Q A;  3EI4 A;  3I7L A;  3V7D B;  2PM6 B;  2OVR B;  3N0D A;  3W15 A;  3N0E A;  2H6N A;  3DSM A;  5EAR A;  4A0A B;  3F3G A;  2I3T A;  2H9M A;  3UVK A;  4J78 A;  4ESG A;  4J84 A;  2PBI B;  1JMZ B;  3OL2 A;  3RN0 D;  3SHF A;  4ERZ A;  4L1Q D;  2B5N A;  1OLZ A;  4CY2 A;  3EI4 B;  5FKQ A;  4J8G A;  3VH0 A;  2P9L C;  3PXW D;  5JWZ A;  2HXC A;  1GP2 B;  3EI3 B;  4PNK B;  5TEE A;  1SQ9 A;  1XIP A;  3KRW B;  3FRX A;  4R7A B;  3RN1 D;  4AOW A;  5IGQ A;  3UKR C;  2AH1 A;  2IUP A;  4GGC A;  3UVO A;  4PSX B;  2B4E A;  4U7A A;  3HFQ A;  3FM0 A;  2XL3 A;  4GMB A;  4A09 A;  4J0X A;  2H9N A;  5FXY A;  5AJA A;  4FWW A;  4L3G D;  4PC0 A;  5TF2 A;  2I0S A;  3ZWL B;  2AGY A;  3BWS A;  3MMY A;  3SN6 B;  3AL9 A;  4ES0 A;  2AQ5 A;  3JRP A;  2BBK H;  4OWR A;  4J8B A;  3GFC A;  4QT8 A;  3U4Y A;  4A11 B;  5IJ8 E;  5IC7 A;  2I0R A;  5EMM B;  3MXX A;  4PXW A;  4CZV A;  4ZOV A;  2XL2 A;  4JSX C;  5K1C C;  2H6K A;  2YBA A;  4J87 A;  4H5I A;  1MDA H;  3I7K A;  1SHY B;  4I79 A;  2CNX A;  3UR4 A;  1SQJ A;  4D0K A;  3EI1 B;  3IKO A;  3KRX B;  4Y7R A;  3ULE C;  3JZG A;  2W18 A;  4A09 B;  3PXT D;  4LG9 A;  3IIW A;  3MKQ A;  3OKY A;  3CFV A;  4YVD A;  2YNN A;  3OKW A;  3PVU B;  4D6V A;  4FAV D;  3EU7 A;  4FA1 D;  4FA5 D;  4J82 A;  3RMZ D;  5H17 A;  1TYQ C;  4A7J A;  4TZ4 A;  4J73 A;  3JAM g;  1R5M A;  1XKS A;  4X60 B;  2P9I C;  5EAP A;  4GQB B;  2HKR A;  3ODT A;  4HDJ A;  4CI8 A;  3JZH A;  2IWF A;  3SCY A;  2H3X A;  5FA5 B;  2H13 A;  4J0W A;  2GNQ A;  4JSV C;  5GXH A;  4JXM A;  2HJB A;  3C9C A;  4GM3 A;  3I7H A;  2J56 H;  3PVW B;  3SXT D;  4GQ2 P;  4XYH A;  1QNI A;  2MTA H;  4QRJ A;  4N14 A;  4CY5 A;  2UZX B;  3I7O A;  4CI1 A;  4CY1 A;  5GMK n;  2PM9 A;  5FQD A;  3UVL A;  4OZU A;  4FHL A;  4JSP C;  1VYH C;  1GXR A;  4GGA A;  3IJ0 A;  2HES X;  2P9N C;  3JRO A;  4O3U B;  3IJ1 A;  4G56 B;  1FWX A;  3NVQ A;  2IUQ A;  4A2L A;  3B7F A;  4UI9 R;  5AMS A;  2H14 A;  5FLX g;  3EWE A;  2B5L A;  5C2W B;  3J80 g;  4Y5R D;  3PXS D;  1NEX B;  2OVP B;  1PI6 A;  4PBZ A;  4XYI A;  3FGB A;  4O3T B;  2OJY A;  2OVQ B;  1RI6 A;  2PM9 B;  3EG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...