5EAMA

Crystal structure of human wdr5 in complex with compound 9o
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords WD repeat-containing protein 5
publication title Structure-Based Optimization of a Small Molecule Antagonist of the Interaction Between WD Repeat-Containing Protein 5 (WDR5) and Mixed-Lineage Leukemia 1 (MLL1).
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5eamA00
3I7NA 3EI3B 3RRMC 5H1MA 2IWKA 2BCJB 3IIYA 3OKTA 2H9PA 4I79A 4G56B 5AJAA 5H17A 2AGWA 3I7HA 2HKMA 2CO0A 3DSMA 4FA5D 3JZGA 4PSXB 3RSEC 4KFMB 1NR0A 4OZUA 2B5LA 1JOFA 4L9OA 4CY2A 4LG9A 3V9FA 2UZXB 3JAMg 1B9YA 4TZ4A 4QT8A 5CXCB 4BL0A 2H14A 4J82A 2J56H 1JMZB 3CFVA 4FA4D 5GXHA 1GXRA 4ERZA 4CY1A 2IUVA 1PGUA 3PE7A 5THAA 3AL9A 4GGDA 4E5ZA 5EMMB 2P9IC 1SQJA 2B4EA 4PNKB 4BH6A 3OL2A 4A11A 4UI9R 1SHYB 4PBZA 4X3EA 3MKQA 5C2VB 3P4FA 4GQ1A 4E54A 2CE9A 2YB8B 2H9MA 4CC9A 2YBAA 1P22A 3EI1A 1K8KC 3W15A 1MDAH 4NSXA 3BWSA 1VYHC 1ERJA 5I5MA 4ZOZA 3EI4A 3U4YA 4FA9D 5IJ8E 4PSWB 2QC5A 4JT6C 3OKYA 3I2NA 2H13A 3RN0D 3L4OD 5EMKB 4A0AA 5EAMA 1TYQC 5GXIA 1L0QA 5SXMA 3UKRC 4ERQA 3BG0A 2QXVA 4H5JA 3I7OA 1FWXA 5B4WA 3SLED 2I0RA 2IUPA 2UZYB 2I3TA 3PXWD 5HE3B 3UVKA 1R5MA 4O9DA 1A0RB 5EMLB 5TEFA 2H9LA 4L3HD 4J86A 2OK6A 2CO0C 2IURA 5GSAA 4CI2A 5C2WB 2OVQB 4J87A 2I0TA 5H14A 4O3TB 5FXYA 2YNPA 1GP2B 1N6FA 4GQBB 3EI2B 4LG8A 2P9LC 1YFQA 4CI8A 4IMMA 1PEVA 2CN2A 4O1QD 2Z2OA 3ODTA 4N14A 4O3UB 3UVNA 5IT9g 4GMBA 5EALA 3BG1A 3JZHA 3NVXA 3I89A 4D0KA 3FRXA 4K3JB 1SQ9A 4CZYA 3VGZA 4J78A 4PXWA 4HDJA 3UVOA 5TDHB 2GC7A 1MG3A 3SMRA 4YVDA 2AQ5A 2GC4A 3RLMD 1GOTB 3PSCB 3AL8B 5EM2A 2J55H 3EG6A 3EI3A 4A0BA 4CI1A 4A09B 4X60B 4QQEA 5FKQA 2AH0A 4GM9A 4A2MA 2I3SA 3PVWB 4Z8LA 1OMWB 1U4CA 3I8EA 4Y7RA 3OL2B 4ERYA 5EMJB 5CXBB 2I0SA 3C5MA 5HE1B 5KDOB 3A0FA 5CXCA 5TF2A 5AFU3 4H5IA 4CY5A 2GNQA 4J84A 2HYEA 3SJLD 4A08B 3C75H 4CZXA 3J80g 1PBYB 5K19A 2AGXA 3KRWB 3HFQA 3MZKA 5IC7A 1MG2A 1RI6A 2H47A 3EI4B 3SXTD 2P9PC 3SBPA 5FLXg 4QL1A 2HESX 3V5WB 3RMZD 4A0AB 2P9KC 2B5MA 2IWFA 2AGLA 4GGCA 3AFCA 2H68A 3KRXB 1N6EA 4JXMA 3I7LA 4J0XA 3C99A 3N0DA 4K3ID 3JZNA 3CFSB 2CNXA 2PM6B 4PC0A 1PI6A 3EWEA 3EU7A 2B5NA 4GM3A 2CN3A 1TBGA 4LGNA 3NVNA 4L3GD 2G9AA 5IGOA 4AOWA 3PXTD 3F3GA 3V7DB 3SFZA 5JWZA 3OKWA 1JJUB 4ZOXA 4FAND 4J77A 3JB9L 2MTAH 3DXKC 3SBQA 3I7PA 5CYKB 4U7AA 1B9XA 3IJ0A 1N6DA 3IJCA 3IJ1A 4BUJC 2HXCA 2OJYA 2PM9B 2H6KA 3PXSD 2IAAA 2J57G 3GFCA 4ZN4A 2BBKH 4J8BA 2G99A 5IJ7E 5I5IA 2AGZA 4CY3A 3SHFA 2YMUA 4XYIA 3MZLA 3UVLA 4GZ8A 3F3FA 5FKSA 4GGAA 4J81A 3K27A 4IA9A 3RFGA 3N0EA 3EI2A 3AH8B 3C9CA 5HE2B 5GMKn 1XHMA 4X61B 2H3XA 3MXXA 3I8CA 2PBIB 4CI3A 4ESGA 4MK0B 3SWSD 4A0BB 5TEEA 5HE0B 3JPXA 5K1CC 3IIWA 2TRCB 4O45A 3F3PA 4J73A 4FAVD 3SCYA 3PSLA 4Y5RD 4E5ZB 3RN1D 4GQ2P 2H6QA 1Q47A 1NEXB 3ZWLB 2AGYA 1XIPA 5IGQA 4A11B 4AEZA 4L1QD 3NVQA 3GREA 2HJ4A 4E54B 2HJBA 2YNOA 4JSNC 3J81g 3AL8A 1OLZA 2H9NA 4U1EI 2EBSA 2YNNA 3EI1B 2O9KA 5HYNB 3E0CA 4A09A 5A2Qg 2Q7QA 3SN6B 2P9SC 5AMSA 2PM7B 2IUQA 3OKYB 3UKUC 4XYHA 3MMYA 1QNIA 5FKTA 4JD2C 4JSPC 5FKRA 3UVMA 3DWLC 4X63B 5CXBA 3SVWD 2XYIA 1GG2B 4GM8A 4A7JA 1JMXB 4XEIC 4A08A 3L4MD 2P9NC 3ORVD 5FQDA 5FA5B 2OIZA 2W18A 3MKSB 2Z2PA 4J79A 2XL3A 4A2LA 4J8GA 5HQGA 2OK4A 4JSXC 2HKRA 4ES0A 2XU7A 3UR4A 1XKSA 4EWRA 4JSVC 5EARA 3FM0A 4FA1D 2OVPB 3SBRA 2Z2NA 4ZOYA 3DXMC 3B7FA 5C9ZB 1K32A 3VH0A 2P9UC 3PVUB 2XL2A 3JRPA 4PBYA 5EAPA 2AH1A 3RFHA 4FB1D 3VA6A 4ZOVA 4FWWA 5I5JA 3FGBA 3JROA 4D6VA 3OTTA 4QRJA 2H6NA 4OWRA 1S4UX 3IKOA 4J0WA 3OW8A 2CE8A 3DM0A 1U2VC 4R7AB 3ULEC 4FHLA 4CZVA 3I7KA 2OVRB 3CIKB 5CYKA 4JT5C 3EMHA 2PM9A 3K26A 5EM2B
chains in the Genus database with same CATH superfamily
3I7NA 3EI3B 3RRMC 5H1MA 2IWKA 4NC4A 2BCJB 3IIYA 3OKTA 2H9PA 4I79A 4G56B 1K3IA 5AJAA 5H17A 2VZ1A 3T3MA 2AGWA 3I7HA 2HKMA 2CO0A 3DSMA 4FA5D 3JZGA 3QHYB 4PSXB 3RSEC 3ZE1A 4KFMB 1NR0A 4OZUA 2B5LA 1L5GA 1JOFA 4L9OA 2HU5A 4CY2A 4LG9A 3V9FA 2UZXB 3JAMg 1B9YA 4WJKA 4TZ4A 4QT8A 5CXCB 4BL0A 2H14A 3OF7A 4J82A 2J56H 1JMZB 5E6UA 3CFVA 1QFSA 4AMYA 1BPOA 4FA4D 5GXHA 1GXRA 4ERZA 1VZ3A 4CY1A 2IUVA 3IULA 1PGUA 3PE7A 5FFGA 3VI3A 5THAA 3AL9A 4DNUA 2QZPA 4GGDA 4E5ZA 5EMMB 2VDNA 2P9IC 1SQJA 2B4EA 4PNKB 4BH6A 1YR2A 4WK0A 3O4IA 3OL2A 4A11A 2VZ3A 4UI9R 5M61A 1SHYB 4PBZA 4X3EA 3MKQA 3EQ7A 5C2VB 3P4FA 4GQ1A 4O02A 3VI4A 4E54A 2CE9A 2YB8B 2H9MA 4CC9A 2YBAA 1P22A 3EI1A 1K8KC 1E5TA 3ZE2A 3W15A 1MDAH 4NSXA 3BWSA 1VYHC 1ERJA 5I5MA 4ZOZA 3NIFA 3EI4A 3U4YA 4FA9D 5IJ8E 4MMYA 4PSWB 4DNWA 2QC5A 4JT6C 3OKYA 3I2NA 2H13A 3RN0D 3L4OD 5EMKB 4A0AA 5EAMA 1TYQC 5FFOA 5GXIA 1L0QA 4L1MA 5SXMA 3UKRC 4ERQA 2JKXA 3BG0A 1M1XA 2QXVA 4H5JA 4Z7QA 3I7OA 1FWXA 5B4WA 3SLED 2I0RA 2IUPA 2UZYB 4NBMA 2I3TA 3PXWD 5HE3B 3UVKA 1R5MA 4O9DA 1A0RB 5EMLB 5TEFA 1JV2A 2H9LA 4L3HD 4J86A 2OK6A 3NIGA 2CO0C 2EIBA 2IURA 4MMZA 5GSAA 4CI2A 4BCBA 5C2WB 5E6SA 2EIEA 2OVQB 4J87A 2I0TA 5H14A 4O3TB 5FXYA 4Z7OA 2YNPA 1GP2B 1N6FA 4UM8A 4GQBB 3EI2B 4LG8A 3O4JA 3IVMA 2P9LC 1UOPA 1YFQA 4CI8A 4IMMA 1PEVA 2CN2A 4O1QD 2Z2OA 3ODTA 4N14A 4O3UB 2HU8A 3UVNA 5IT9g 2VDKA 4GMBA 1TYEA 5EALA 3BG1A 3JZHA 3NVXA 3V4PA 3I89A 4D0KA 3FRXA 4K3JB 1SQ9A 4CZYA 3VGZA 4J78A 4PXWA 3O4HA 4HDJA 4Z7NA 3UVOA 4BP8A 5TDHB 4AMZA 2GC7A 4NENA 4BP9A 1MG3A 3SMRA 4YVDA 2AQ5A 2GC4A 1H2WA 3RLMD 3ZDYA 1GOTB 3PSCB 3AL8B 5EM2A 2J55H 3EG6A 1H2XA 3ZE0A 3EI3A 4A0BA 4CI1A 3V4VA 4A09B 4X60B 5C86A 1E8MA 4QQEA 1A12A 2XE4A 5FKQA 2AH0A 4GM9A 4A2MA 2I3SA 3PVWB 3EQ9A 4Z8LA 1OMWB 1U4CA 3I8EA 4Y7RA 3OL2B 1GOGA 4ERYA 5EMJB 5CXBB 4WK2A 2I0SA 3C5MA 5HE1B 5KDOB 3A0FA 5CXCA 5TF2A 1C9IA 5AFU3 1JTDB 4H5IA 4CY5A 2VDRA 2GNQA 4J84A 2HYEA 3SJLD 4A08B 3C75H 4CZXA 3J80g 1PBYB 1C9LA 5K19A 3ZDZA 2AGXA 3KRWB 3HFQA 1UOOA 3MZKA 5IC7A 1MG2A 1RI6A 2H47A 3EI4B 3SXTD 1U8CA 2P9PC 2XDWA 3SBPA 5FLXg 4QL1A 2HESX 3V5WB 3IUNA 3RMZD 4A0AB 2P9KC 2B5MA 2IWFA 2AGLA 3AFCA 1I2MB 4GGCA 2H68A 3KRXB 1N6EA 4WK4A 4JXMA 3I7LA 4J0XA 3C99A 3K72A 2WQ8A 3N0DA 4K3ID 3JZNA 4JHNA 3CFSB 2CNXA 2PM6B 4PC0A 1PI6A 3EWEA 3EU7A 3O4GA 2B5NA 4GM3A 2CN3A 1TBGA 4LGNA 3NVNA 4L3GD 2G9AA 4O2WA 5IGOA 4AOWA 3NIDA 3PXTD 3K6SA 3F3GA 3FCUA 5E6RA 3SFZA 3V7DB 5JWZA 3MUOA 1JJUB 2HU7A 3OKWA 2BKLA 4ZOXA 4FAND 4J77A 2VDLA 3JB9L 4G1MA 2MTAH 3DXKC 4AN1A 3SBQA 3I7PA 5CYKB 4U7AA 3IUQA 1B9XA 3IJ0A 1O6GA 1N6DA 3IJCA 3IJ1A 4NAAA 4BUJC 2HXCA 2OJYA 2PM9B 2H6KA 5M5UA 3PXSD 1H2ZA 2IAAA 2J57G 3GFCA 4UM9A 4ZN4A 2BBKH 4J8BA 4IRZA 2G99A 5IJ7E 3EQ8A 2AGZA 5I5IA 4CY3A 5HDBA 3SHFA 2YMUA 4XYIA 3MZLA 3UVLA 4GZ8A 3F3FA 3T3PA 5M5VA 3IURA 5FKSA 2EIDA 4D9SA 1QFMA 4GGAA 4BCCA 4J81A 3K27A 4IA9A 3RFGA 3N0EA 3EI2A 2VDMA 4RE5A 4G55A 3AH8B 3C9CA 5HE2B 5GMKn 1XHMA 4X61B 2H3XA 3MXXA 5M5SA 3I8CA 2PBIB 4CI3A 4ESGA 4MK0B 3SWSD 4A0BB 5TEEA 5HE0B 3JPXA 5K1CC 3IIWA 2TRCB 4O45A 1GOFA 3F3PA 4J73A 4FAVD 3SCYA 3PSLA 1VE6A 4Y5RD 4E5ZB 4AX4A 3RN1D 4QAMA 4GQ2P 4JHPC 2H6QA 1Q47A 2EICA 1NEXB 3ZWLB 2AGYA 1XIPA 5IGQA 1H2YA 4A11B 4AEZA 3FCSA 4L1QD 1GOHA 3NVQA 3GREA 2HJ4A 4E54B 2HJBA 2YNOA 4JSNC 3J81g 3AL8A 1OLZA 2H9NA 4U1EI 2EBSA 2YNNA 5C92A 3EI1B 2O9KA 5HYNB 3E0CA 4A09A 2QR5A 3IUJA 5A2Qg 2Q7QA 3SN6B 2P9SC 5AMSA 1VE7A 2PM7B 2IUQA 3OKYB 3UKUC 4XYHA 3MMYA 1QNIA 2XZGA 3IJEA 5FKTA 4BCDA 4JD2C 4JSPC 5FKRA 2VDPA 1UTCA 3UVMA 1O6FA 3DWLC 4X63B 5CXBA 4AN0A 3SVWD 2VDOA 2XYIA 1GG2B 4GM8A 4A7JA 1JMXB 4XEIC 4A08A 3L4MD 2P9NC 3ORVD 5FQDA 5FA5B 2OIZA 2W18A 3MKSB 2Z2PA 4J79A 2XL3A 4A2LA 4J8GA 5HQGA 2OK4A 4JSXC 2VC2A 2HKRA 4ES0A 2XU7A 3UR4A 4G1EA 1XKSA 4EWRA 4JSVC 5EARA 3FM0A 3DDUA 3KCIA 4FA1D 3K71A 2OVPB 3SBRA 2Z2NA 4ZOYA 3DXMC 3B7FA 5C9ZB 1K32A 3VH0A 2P9UC 3PVUB 2XL2A 3MVDK 3JRPA 4PBYA 5EAPA 3QI0A 3IUMA 2AH1A 3RFHA 4FB1D 3VA6A 4ZOVA 4FWWA 1E8NA 5I5JA 5M5TA 3ZDXA 1T2XA 3FGBA 3JROA 4D6VA 3OTTA 4QRJA 1UOQA 2H6NA 5M5RA 4OWRA 1S4UX 3IKOA 4MMXA 4J0WA 3OW8A 2CE8A 3DM0A 3GD1I 4DNVA 1U2VC 4R7AB 3ULEC 4FHLA 4CZVA 3I7KA 1VZ2A 2OVRB 3GC3B 3CIKB 3MUNA 5CYKA 4JT5C 4RE6A 3EMHA 2PM9A 3K26A 2VDQA 5EM2B
chains in the Genus database with same CATH topology
3I7NA 3EI3B 3RRMC 5H1MA 2IWKA 2BCJB 3IIYA 3OKTA 2H9PA 4I79A 4G56B 5AJAA 5H17A 2AGWA 3I7HA 2HKMA 2CO0A 3DSMA 4FA5D 3JZGA 4PSXB 3RSEC 4KFMB 1NR0A 4OZUA 2B5LA 1JOFA 4L9OA 4CY2A 4LG9A 3V9FA 2UZXB 3JAMg 1B9YA 4TZ4A 4QT8A 5CXCB 4BL0A 2H14A 4J82A 2J56H 1JMZB 3CFVA 4FA4D 5GXHA 1GXRA 4ERZA 4CY1A 2IUVA 1PGUA 3PE7A 5THAA 3AL9A 4GGDA 4E5ZA 5EMMB 2P9IC 1SQJA 2B4EA 4PNKB 4BH6A 3OL2A 4A11A 4UI9R 1SHYB 4PBZA 4X3EA 3MKQA 5C2VB 3P4FA 4GQ1A 4E54A 2CE9A 2YB8B 2H9MA 4CC9A 2YBAA 1P22A 3EI1A 1K8KC 3W15A 1MDAH 4NSXA 3BWSA 1VYHC 1ERJA 5I5MA 4ZOZA 3EI4A 3U4YA 4FA9D 5IJ8E 4PSWB 2QC5A 4JT6C 3OKYA 3I2NA 2H13A 3RN0D 3L4OD 5EMKB 4A0AA 5EAMA 1TYQC 5GXIA 1L0QA 5SXMA 3UKRC 4ERQA 3BG0A 2QXVA 4H5JA 3I7OA 1FWXA 5B4WA 3SLED 2I0RA 2IUPA 2UZYB 2I3TA 3PXWD 5HE3B 3UVKA 1R5MA 4O9DA 1A0RB 5EMLB 5TEFA 2H9LA 4L3HD 4J86A 2OK6A 2CO0C 2IURA 5GSAA 4CI2A 5C2WB 2OVQB 4J87A 2I0TA 5H14A 4O3TB 5FXYA 2YNPA 1GP2B 1N6FA 4GQBB 3EI2B 4LG8A 2P9LC 1YFQA 4CI8A 4IMMA 1PEVA 2CN2A 4O1QD 2Z2OA 3ODTA 4N14A 4O3UB 3UVNA 5IT9g 4GMBA 5EALA 3BG1A 3JZHA 3NVXA 3I89A 4D0KA 3FRXA 4K3JB 1SQ9A 4CZYA 3VGZA 4J78A 4PXWA 4HDJA 3UVOA 5TDHB 2GC7A 1MG3A 3SMRA 4YVDA 2AQ5A 2GC4A 3RLMD 1GOTB 3PSCB 3AL8B 5EM2A 2J55H 3EG6A 3EI3A 4A0BA 4CI1A 4A09B 4X60B 4QQEA 5FKQA 2AH0A 4GM9A 4A2MA 2I3SA 3PVWB 4Z8LA 1OMWB 1U4CA 3I8EA 4Y7RA 3OL2B 4ERYA 5EMJB 5CXBB 2I0SA 3C5MA 5HE1B 5KDOB 3A0FA 5CXCA 5TF2A 5AFU3 4H5IA 4CY5A 2GNQA 4J84A 2HYEA 3SJLD 4A08B 3C75H 4CZXA 3J80g 1PBYB 5K19A 2AGXA 3KRWB 3HFQA 3MZKA 5IC7A 1MG2A 1RI6A 2H47A 3EI4B 3SXTD 2P9PC 3SBPA 5FLXg 4QL1A 2HESX 3V5WB 3RMZD 4A0AB 2P9KC 2B5MA 2IWFA 2AGLA 4GGCA 3AFCA 2H68A 3KRXB 1N6EA 4JXMA 3I7LA 4J0XA 3C99A 3N0DA 4K3ID 3JZNA 3CFSB 2CNXA 2PM6B 4PC0A 1PI6A 3EWEA 3EU7A 2B5NA 4GM3A 2CN3A 1TBGA 4LGNA 3NVNA 4L3GD 2G9AA 5IGOA 4AOWA 3PXTD 3F3GA 3V7DB 3SFZA 5JWZA 3OKWA 1JJUB 4ZOXA 4FAND 4J77A 3JB9L 2MTAH 3DXKC 3SBQA 3I7PA 5CYKB 4U7AA 1B9XA 3IJ0A 1N6DA 3IJCA 3IJ1A 4BUJC 2HXCA 2OJYA 2PM9B 2H6KA 3PXSD 2IAAA 2J57G 3GFCA 4ZN4A 2BBKH 4J8BA 2G99A 5IJ7E 5I5IA 2AGZA 4CY3A 3SHFA 2YMUA 4XYIA 3MZLA 3UVLA 4GZ8A 3F3FA 5FKSA 4GGAA 4J81A 3K27A 4IA9A 3RFGA 3N0EA 3EI2A 3AH8B 3C9CA 5HE2B 5GMKn 1XHMA 4X61B 2H3XA 3MXXA 3I8CA 2PBIB 4CI3A 4ESGA 4MK0B 3SWSD 4A0BB 5TEEA 5HE0B 3JPXA 5K1CC 3IIWA 2TRCB 4O45A 3F3PA 4J73A 4FAVD 3SCYA 3PSLA 4Y5RD 4E5ZB 3RN1D 4GQ2P 2H6QA 1Q47A 1NEXB 3ZWLB 2AGYA 1XIPA 5IGQA 4A11B 4AEZA 4L1QD 3NVQA 3GREA 2HJ4A 4E54B 2HJBA 2YNOA 4JSNC 3J81g 3AL8A 1OLZA 2H9NA 4U1EI 2EBSA 2YNNA 3EI1B 2O9KA 5HYNB 3E0CA 4A09A 5A2Qg 2Q7QA 3SN6B 2P9SC 5AMSA 2PM7B 2IUQA 3OKYB 3UKUC 4XYHA 3MMYA 1QNIA 5FKTA 4JD2C 4JSPC 5FKRA 3UVMA 3DWLC 4X63B 5CXBA 3SVWD 2XYIA 1GG2B 4GM8A 4A7JA 1JMXB 4XEIC 4A08A 3L4MD 2P9NC 3ORVD 5FQDA 5FA5B 2OIZA 2W18A 3MKSB 2Z2PA 4J79A 2XL3A 4A2LA 4J8GA 5HQGA 2OK4A 4JSXC 2HKRA 4ES0A 2XU7A 3UR4A 1XKSA 4EWRA 4JSVC 5EARA 3FM0A 4FA1D 2OVPB 3SBRA 2Z2NA 4ZOYA 3DXMC 3B7FA 5C9ZB 1K32A 3VH0A 2P9UC 3PVUB 2XL2A 3JRPA 4PBYA 5EAPA 2AH1A 3RFHA 4FB1D 3VA6A 4ZOVA 4FWWA 5I5JA 3FGBA 3JROA 4D6VA 3OTTA 4QRJA 2H6NA 4OWRA 1S4UX 3IKOA 4J0WA 3OW8A 2CE8A 3DM0A 1U2VC 4R7AB 3ULEC 4FHLA 4CZVA 3I7KA 2OVRB 3CIKB 5CYKA 4JT5C 3EMHA 2PM9A 3K26A 5EM2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7N A;  3EI3 B;  3RRM C;  5H1M A;  2IWK A;  2BCJ B;  3IIY A;  3OKT A;  2H9P A;  4I79 A;  4G56 B;  5AJA A;  5H17 A;  2AGW A;  3I7H A;  2HKM A;  2CO0 A;  3DSM A;  4FA5 D;  3JZG A;  4PSX B;  3RSE C;  4KFM B;  1NR0 A;  4OZU A;  2B5L A;  1JOF A;  4L9O A;  4CY2 A;  4LG9 A;  3V9F A;  2UZX B;  3JAM g;  1B9Y A;  4TZ4 A;  4QT8 A;  5CXC B;  4BL0 A;  2H14 A;  4J82 A;  2J56 H;  1JMZ B;  3CFV A;  4FA4 D;  5GXH A;  1GXR A;  4ERZ A;  4CY1 A;  2IUV A;  1PGU A;  3PE7 A;  5THA A;  3AL9 A;  4GGD A;  4E5Z A;  5EMM B;  2P9I C;  1SQJ A;  2B4E A;  4PNK B;  4BH6 A;  3OL2 A;  4A11 A;  4UI9 R;  1SHY B;  4PBZ A;  4X3E A;  3MKQ A;  5C2V B;  3P4F A;  4GQ1 A;  4E54 A;  2CE9 A;  2YB8 B;  2H9M A;  4CC9 A;  2YBA A;  1P22 A;  3EI1 A;  1K8K C;  3W15 A;  1MDA H;  4NSX A;  3BWS A;  1VYH C;  1ERJ A;  5I5M A;  4ZOZ A;  3EI4 A;  3U4Y A;  4FA9 D;  5IJ8 E;  4PSW B;  2QC5 A;  4JT6 C;  3OKY A;  3I2N A;  2H13 A;  3RN0 D;  3L4O D;  5EMK B;  4A0A A;  5EAM A;  1TYQ C;  5GXI A;  1L0Q A;  5SXM A;  3UKR C;  4ERQ A;  3BG0 A;  2QXV A;  4H5J A;  3I7O A;  1FWX A;  5B4W A;  3SLE D;  2I0R A;  2IUP A;  2UZY B;  2I3T A;  3PXW D;  5HE3 B;  3UVK A;  1R5M A;  4O9D A;  1A0R B;  5EML B;  5TEF A;  2H9L A;  4L3H D;  4J86 A;  2OK6 A;  2CO0 C;  2IUR A;  5GSA A;  4CI2 A;  5C2W B;  2OVQ B;  4J87 A;  2I0T A;  5H14 A;  4O3T B;  5FXY A;  2YNP A;  1GP2 B;  1N6F A;  4GQB B;  3EI2 B;  4LG8 A;  2P9L C;  1YFQ A;  4CI8 A;  4IMM A;  1PEV A;  2CN2 A;  4O1Q D;  2Z2O A;  3ODT A;  4N14 A;  4O3U B;  3UVN A;  5IT9 g;  4GMB A;  5EAL A;  3BG1 A;  3JZH A;  3NVX A;  3I89 A;  4D0K A;  3FRX A;  4K3J B;  1SQ9 A;  4CZY A;  3VGZ A;  4J78 A;  4PXW A;  4HDJ A;  3UVO A;  5TDH B;  2GC7 A;  1MG3 A;  3SMR A;  4YVD A;  2AQ5 A;  2GC4 A;  3RLM D;  1GOT B;  3PSC B;  3AL8 B;  5EM2 A;  2J55 H;  3EG6 A;  3EI3 A;  4A0B A;  4CI1 A;  4A09 B;  4X60 B;  4QQE A;  5FKQ A;  2AH0 A;  4GM9 A;  4A2M A;  2I3S A;  3PVW B;  4Z8L A;  1OMW B;  1U4C A;  3I8E A;  4Y7R A;  3OL2 B;  4ERY A;  5EMJ B;  5CXB B;  2I0S A;  3C5M A;  5HE1 B;  5KDO B;  3A0F A;  5CXC A;  5TF2 A;  5AFU 3;  4H5I A;  4CY5 A;  2GNQ A;  4J84 A;  2HYE A;  3SJL D;  4A08 B;  3C75 H;  4CZX A;  3J80 g;  1PBY B;  5K19 A;  2AGX A;  3KRW B;  3HFQ A;  3MZK A;  5IC7 A;  1MG2 A;  1RI6 A;  2H47 A;  3EI4 B;  3SXT D;  2P9P C;  3SBP A;  5FLX g;  4QL1 A;  2HES X;  3V5W B;  3RMZ D;  4A0A B;  2P9K C;  2B5M A;  2IWF A;  2AGL A;  4GGC A;  3AFC A;  2H68 A;  3KRX B;  1N6E A;  4JXM A;  3I7L A;  4J0X A;  3C99 A;  3N0D A;  4K3I D;  3JZN A;  3CFS B;  2CNX A;  2PM6 B;  4PC0 A;  1PI6 A;  3EWE A;  3EU7 A;  2B5N A;  4GM3 A;  2CN3 A;  1TBG A;  4LGN A;  3NVN A;  4L3G D;  2G9A A;  5IGO A;  4AOW A;  3PXT D;  3F3G A;  3V7D B;  3SFZ A;  5JWZ A;  3OKW A;  1JJU B;  4ZOX A;  4FAN D;  4J77 A;  3JB9 L;  2MTA H;  3DXK C;  3SBQ A;  3I7P A;  5CYK B;  4U7A A;  1B9X A;  3IJ0 A;  1N6D A;  3IJC A;  3IJ1 A;  4BUJ C;  2HXC A;  2OJY A;  2PM9 B;  2H6K A;  3PXS D;  2IAA A;  2J57 G;  3GFC A;  4ZN4 A;  2BBK H;  4J8B A;  2G99 A;  5IJ7 E;  5I5I A;  2AGZ A;  4CY3 A;  3SHF A;  2YMU A;  4XYI A;  3MZL A;  3UVL A;  4GZ8 A;  3F3F A;  5FKS A;  4GGA A;  4J81 A;  3K27 A;  4IA9 A;  3RFG A;  3N0E A;  3EI2 A;  3AH8 B;  3C9C A;  5HE2 B;  5GMK n;  1XHM A;  4X61 B;  2H3X A;  3MXX A;  3I8C A;  2PBI B;  4CI3 A;  4ESG A;  4MK0 B;  3SWS D;  4A0B B;  5TEE A;  5HE0 B;  3JPX A;  5K1C C;  3IIW A;  2TRC B;  4O45 A;  3F3P A;  4J73 A;  4FAV D;  3SCY A;  3PSL A;  4Y5R D;  4E5Z B;  3RN1 D;  4GQ2 P;  2H6Q A;  1Q47 A;  1NEX B;  3ZWL B;  2AGY A;  1XIP A;  5IGQ A;  4A11 B;  4AEZ A;  4L1Q D;  3NVQ A;  3GRE A;  2HJ4 A;  4E54 B;  2HJB A;  2YNO A;  4JSN C;  3J81 g;  3AL8 A;  1OLZ A;  2H9N A;  4U1E I;  2EBS A;  2YNN A;  3EI1 B;  2O9K A;  5HYN B;  3E0C A;  4A09 A;  5A2Q g;  2Q7Q A;  3SN6 B;  2P9S C;  5AMS A;  2PM7 B;  2IUQ A;  3OKY B;  3UKU C;  4XYH A;  3MMY A;  1QNI A;  5FKT A;  4JD2 C;  4JSP C;  5FKR A;  3UVM A;  3DWL C;  4X63 B;  5CXB A;  3SVW D;  2XYI A;  1GG2 B;  4GM8 A;  4A7J A;  1JMX B;  4XEI C;  4A08 A;  3L4M D;  2P9N C;  3ORV D;  5FQD A;  5FA5 B;  2OIZ A;  2W18 A;  3MKS B;  2Z2P A;  4J79 A;  2XL3 A;  4A2L A;  4J8G A;  5HQG A;  2OK4 A;  4JSX C;  2HKR A;  4ES0 A;  2XU7 A;  3UR4 A;  1XKS A;  4EWR A;  4JSV C;  5EAR A;  3FM0 A;  4FA1 D;  2OVP B;  3SBR A;  2Z2N A;  4ZOY A;  3DXM C;  3B7F A;  5C9Z B;  1K32 A;  3VH0 A;  2P9U C;  3PVU B;  2XL2 A;  3JRP A;  4PBY A;  5EAP A;  2AH1 A;  3RFH A;  4FB1 D;  3VA6 A;  4ZOV A;  4FWW A;  5I5J A;  3FGB A;  3JRO A;  4D6V A;  3OTT A;  4QRJ A;  2H6N A;  4OWR A;  1S4U X;  3IKO A;  4J0W A;  3OW8 A;  2CE8 A;  3DM0 A;  1U2V C;  4R7A B;  3ULE C;  4FHL A;  4CZV A;  3I7K A;  2OVR B;  3CIK B;  5CYK A;  4JT5 C;  3EMH A;  2PM9 A;  3K26 A;  5EM2 B; 
#chains in the Genus database with same CATH topology
 3I7N A;  3EI3 B;  3RRM C;  5H1M A;  2IWK A;  4NC4 A;  2BCJ B;  3IIY A;  3OKT A;  2H9P A;  4I79 A;  4G56 B;  1K3I A;  5AJA A;  5H17 A;  2VZ1 A;  3T3M A;  2AGW A;  3I7H A;  2HKM A;  2CO0 A;  3DSM A;  4FA5 D;  3JZG A;  3QHY B;  4PSX B;  3RSE C;  3ZE1 A;  4KFM B;  1NR0 A;  4OZU A;  2B5L A;  1L5G A;  1JOF A;  4L9O A;  2HU5 A;  4CY2 A;  4LG9 A;  3V9F A;  2UZX B;  3JAM g;  1B9Y A;  4WJK A;  4TZ4 A;  4QT8 A;  5CXC B;  4BL0 A;  2H14 A;  3OF7 A;  4J82 A;  2J56 H;  1JMZ B;  5E6U A;  3CFV A;  1QFS A;  4AMY A;  1BPO A;  4FA4 D;  5GXH A;  1GXR A;  4ERZ A;  1VZ3 A;  4CY1 A;  2IUV A;  3IUL A;  1PGU A;  3PE7 A;  5FFG A;  3VI3 A;  5THA A;  3AL9 A;  4DNU A;  2QZP A;  4GGD A;  4E5Z A;  5EMM B;  2VDN A;  2P9I C;  1SQJ A;  2B4E A;  4PNK B;  4BH6 A;  1YR2 A;  4WK0 A;  3O4I A;  3OL2 A;  4A11 A;  2VZ3 A;  4UI9 R;  5M61 A;  1SHY B;  4PBZ A;  4X3E A;  3MKQ A;  3EQ7 A;  5C2V B;  3P4F A;  4GQ1 A;  4O02 A;  3VI4 A;  4E54 A;  2CE9 A;  2YB8 B;  2H9M A;  4CC9 A;  2YBA A;  1P22 A;  3EI1 A;  1K8K C;  1E5T A;  3ZE2 A;  3W15 A;  1MDA H;  4NSX A;  3BWS A;  1VYH C;  1ERJ A;  5I5M A;  4ZOZ A;  3NIF A;  3EI4 A;  3U4Y A;  4FA9 D;  5IJ8 E;  4MMY A;  4PSW B;  4DNW A;  2QC5 A;  4JT6 C;  3OKY A;  3I2N A;  2H13 A;  3RN0 D;  3L4O D;  5EMK B;  4A0A A;  5EAM A;  1TYQ C;  5FFO A;  5GXI A;  1L0Q A;  4L1M A;  5SXM A;  3UKR C;  4ERQ A;  2JKX A;  3BG0 A;  1M1X A;  2QXV A;  4H5J A;  4Z7Q A;  3I7O A;  1FWX A;  5B4W A;  3SLE D;  2I0R A;  2IUP A;  2UZY B;  4NBM A;  2I3T A;  3PXW D;  5HE3 B;  3UVK A;  1R5M A;  4O9D A;  1A0R B;  5EML B;  5TEF A;  1JV2 A;  2H9L A;  4L3H D;  4J86 A;  2OK6 A;  3NIG A;  2CO0 C;  2EIB A;  2IUR A;  4MMZ A;  5GSA A;  4CI2 A;  4BCB A;  5C2W B;  5E6S A;  2EIE A;  2OVQ B;  4J87 A;  2I0T A;  5H14 A;  4O3T B;  5FXY A;  4Z7O A;  2YNP A;  1GP2 B;  1N6F A;  4UM8 A;  4GQB B;  3EI2 B;  4LG8 A;  3O4J A;  3IVM A;  2P9L C;  1UOP A;  1YFQ A;  4CI8 A;  4IMM A;  1PEV A;  2CN2 A;  4O1Q D;  2Z2O A;  3ODT A;  4N14 A;  4O3U B;  2HU8 A;  3UVN A;  5IT9 g;  2VDK A;  4GMB A;  1TYE A;  5EAL A;  3BG1 A;  3JZH A;  3NVX A;  3V4P A;  3I89 A;  4D0K A;  3FRX A;  4K3J B;  1SQ9 A;  4CZY A;  3VGZ A;  4J78 A;  4PXW A;  3O4H A;  4HDJ A;  4Z7N A;  3UVO A;  4BP8 A;  5TDH B;  4AMZ A;  2GC7 A;  4NEN A;  4BP9 A;  1MG3 A;  3SMR A;  4YVD A;  2AQ5 A;  2GC4 A;  1H2W A;  3RLM D;  3ZDY A;  1GOT B;  3PSC B;  3AL8 B;  5EM2 A;  2J55 H;  3EG6 A;  1H2X A;  3ZE0 A;  3EI3 A;  4A0B A;  4CI1 A;  3V4V A;  4A09 B;  4X60 B;  5C86 A;  1E8M A;  4QQE A;  1A12 A;  2XE4 A;  5FKQ A;  2AH0 A;  4GM9 A;  4A2M A;  2I3S A;  3PVW B;  3EQ9 A;  4Z8L A;  1OMW B;  1U4C A;  3I8E A;  4Y7R A;  3OL2 B;  1GOG A;  4ERY A;  5EMJ B;  5CXB B;  4WK2 A;  2I0S A;  3C5M A;  5HE1 B;  5KDO B;  3A0F A;  5CXC A;  5TF2 A;  1C9I A;  5AFU 3;  1JTD B;  4H5I A;  4CY5 A;  2VDR A;  2GNQ A;  4J84 A;  2HYE A;  3SJL D;  4A08 B;  3C75 H;  4CZX A;  3J80 g;  1PBY B;  1C9L A;  5K19 A;  3ZDZ A;  2AGX A;  3KRW B;  3HFQ A;  1UOO A;  3MZK A;  5IC7 A;  1MG2 A;  1RI6 A;  2H47 A;  3EI4 B;  3SXT D;  1U8C A;  2P9P C;  2XDW A;  3SBP A;  5FLX g;  4QL1 A;  2HES X;  3V5W B;  3IUN A;  3RMZ D;  4A0A B;  2P9K C;  2B5M A;  2IWF A;  2AGL A;  3AFC A;  1I2M B;  4GGC A;  2H68 A;  3KRX B;  1N6E A;  4WK4 A;  4JXM A;  3I7L A;  4J0X A;  3C99 A;  3K72 A;  2WQ8 A;  3N0D A;  4K3I D;  3JZN A;  4JHN A;  3CFS B;  2CNX A;  2PM6 B;  4PC0 A;  1PI6 A;  3EWE A;  3EU7 A;  3O4G A;  2B5N A;  4GM3 A;  2CN3 A;  1TBG A;  4LGN A;  3NVN A;  4L3G D;  2G9A A;  4O2W A;  5IGO A;  4AOW A;  3NID A;  3PXT D;  3K6S A;  3F3G A;  3FCU A;  5E6R A;  3SFZ A;  3V7D B;  5JWZ A;  3MUO A;  1JJU B;  2HU7 A;  3OKW A;  2BKL A;  4ZOX A;  4FAN D;  4J77 A;  2VDL A;  3JB9 L;  4G1M A;  2MTA H;  3DXK C;  4AN1 A;  3SBQ A;  3I7P A;  5CYK B;  4U7A A;  3IUQ A;  1B9X A;  3IJ0 A;  1O6G A;  1N6D A;  3IJC A;  3IJ1 A;  4NAA A;  4BUJ C;  2HXC A;  2OJY A;  2PM9 B;  2H6K A;  5M5U A;  3PXS D;  1H2Z A;  2IAA A;  2J57 G;  3GFC A;  4UM9 A;  4ZN4 A;  2BBK H;  4J8B A;  4IRZ A;  2G99 A;  5IJ7 E;  3EQ8 A;  2AGZ A;  5I5I A;  4CY3 A;  5HDB A;  3SHF A;  2YMU A;  4XYI A;  3MZL A;  3UVL A;  4GZ8 A;  3F3F A;  3T3P A;  5M5V A;  3IUR A;  5FKS A;  2EID A;  4D9S A;  1QFM A;  4GGA A;  4BCC A;  4J81 A;  3K27 A;  4IA9 A;  3RFG A;  3N0E A;  3EI2 A;  2VDM A;  4RE5 A;  4G55 A;  3AH8 B;  3C9C A;  5HE2 B;  5GMK n;  1XHM A;  4X61 B;  2H3X A;  3MXX A;  5M5S A;  3I8C A;  2PBI B;  4CI3 A;  4ESG A;  4MK0 B;  3SWS D;  4A0B B;  5TEE A;  5HE0 B;  3JPX A;  5K1C C;  3IIW A;  2TRC B;  4O45 A;  1GOF A;  3F3P A;  4J73 A;  4FAV D;  3SCY A;  3PSL A;  1VE6 A;  4Y5R D;  4E5Z B;  4AX4 A;  3RN1 D;  4QAM A;  4GQ2 P;  4JHP C;  2H6Q A;  1Q47 A;  2EIC A;  1NEX B;  3ZWL B;  2AGY A;  1XIP A;  5IGQ A;  1H2Y A;  4A11 B;  4AEZ A;  3FCS A;  4L1Q D;  1GOH A;  3NVQ A;  3GRE A;  2HJ4 A;  4E54 B;  2HJB A;  2YNO A;  4JSN C;  3J81 g;  3AL8 A;  1OLZ A;  2H9N A;  4U1E I;  2EBS A;  2YNN A;  5C92 A;  3EI1 B;  2O9K A;  5HYN B;  3E0C A;  4A09 A;  2QR5 A;  3IUJ A;  5A2Q g;  2Q7Q A;  3SN6 B;  2P9S C;  5AMS A;  1VE7 A;  2PM7 B;  2IUQ A;  3OKY B;  3UKU C;  4XYH A;  3MMY A;  1QNI A;  2XZG A;  3IJE A;  5FKT A;  4BCD A;  4JD2 C;  4JSP C;  5FKR A;  2VDP A;  1UTC A;  3UVM A;  1O6F A;  3DWL C;  4X63 B;  5CXB A;  4AN0 A;  3SVW D;  2VDO A;  2XYI A;  1GG2 B;  4GM8 A;  4A7J A;  1JMX B;  4XEI C;  4A08 A;  3L4M D;  2P9N C;  3ORV D;  5FQD A;  5FA5 B;  2OIZ A;  2W18 A;  3MKS B;  2Z2P A;  4J79 A;  2XL3 A;  4A2L A;  4J8G A;  5HQG A;  2OK4 A;  4JSX C;  2VC2 A;  2HKR A;  4ES0 A;  2XU7 A;  3UR4 A;  4G1E A;  1XKS A;  4EWR A;  4JSV C;  5EAR A;  3FM0 A;  3DDU A;  3KCI A;  4FA1 D;  3K71 A;  2OVP B;  3SBR A;  2Z2N A;  4ZOY A;  3DXM C;  3B7F A;  5C9Z B;  1K32 A;  3VH0 A;  2P9U C;  3PVU B;  2XL2 A;  3MVD K;  3JRP A;  4PBY A;  5EAP A;  3QI0 A;  3IUM A;  2AH1 A;  3RFH A;  4FB1 D;  3VA6 A;  4ZOV A;  4FWW A;  1E8N A;  5I5J A;  5M5T A;  3ZDX A;  1T2X A;  3FGB A;  3JRO A;  4D6V A;  3OTT A;  4QRJ A;  1UOQ A;  2H6N A;  5M5R A;  4OWR A;  1S4U X;  3IKO A;  4MMX A;  4J0W A;  3OW8 A;  2CE8 A;  3DM0 A;  3GD1 I;  4DNV A;  1U2V C;  4R7A B;  3ULE C;  4FHL A;  4CZV A;  3I7K A;  1VZ2 A;  2OVR B;  3GC3 B;  3CIK B;  3MUN A;  5CYK A;  4JT5 C;  4RE6 A;  3EMH A;  2PM9 A;  3K26 A;  2VDQ A;  5EM2 B; 
#chains in the Genus database with same CATH homology
 3I7N A;  3EI3 B;  3RRM C;  5H1M A;  2IWK A;  2BCJ B;  3IIY A;  3OKT A;  2H9P A;  4I79 A;  4G56 B;  5AJA A;  5H17 A;  2AGW A;  3I7H A;  2HKM A;  2CO0 A;  3DSM A;  4FA5 D;  3JZG A;  4PSX B;  3RSE C;  4KFM B;  1NR0 A;  4OZU A;  2B5L A;  1JOF A;  4L9O A;  4CY2 A;  4LG9 A;  3V9F A;  2UZX B;  3JAM g;  1B9Y A;  4TZ4 A;  4QT8 A;  5CXC B;  4BL0 A;  2H14 A;  4J82 A;  2J56 H;  1JMZ B;  3CFV A;  4FA4 D;  5GXH A;  1GXR A;  4ERZ A;  4CY1 A;  2IUV A;  1PGU A;  3PE7 A;  5THA A;  3AL9 A;  4GGD A;  4E5Z A;  5EMM B;  2P9I C;  1SQJ A;  2B4E A;  4PNK B;  4BH6 A;  3OL2 A;  4A11 A;  4UI9 R;  1SHY B;  4PBZ A;  4X3E A;  3MKQ A;  5C2V B;  3P4F A;  4GQ1 A;  4E54 A;  2CE9 A;  2YB8 B;  2H9M A;  4CC9 A;  2YBA A;  1P22 A;  3EI1 A;  1K8K C;  3W15 A;  1MDA H;  4NSX A;  3BWS A;  1VYH C;  1ERJ A;  5I5M A;  4ZOZ A;  3EI4 A;  3U4Y A;  4FA9 D;  5IJ8 E;  4PSW B;  2QC5 A;  4JT6 C;  3OKY A;  3I2N A;  2H13 A;  3RN0 D;  3L4O D;  5EMK B;  4A0A A;  5EAM A;  1TYQ C;  5GXI A;  1L0Q A;  5SXM A;  3UKR C;  4ERQ A;  3BG0 A;  2QXV A;  4H5J A;  3I7O A;  1FWX A;  5B4W A;  3SLE D;  2I0R A;  2IUP A;  2UZY B;  2I3T A;  3PXW D;  5HE3 B;  3UVK A;  1R5M A;  4O9D A;  1A0R B;  5EML B;  5TEF A;  2H9L A;  4L3H D;  4J86 A;  2OK6 A;  2CO0 C;  2IUR A;  5GSA A;  4CI2 A;  5C2W B;  2OVQ B;  4J87 A;  2I0T A;  5H14 A;  4O3T B;  5FXY A;  2YNP A;  1GP2 B;  1N6F A;  4GQB B;  3EI2 B;  4LG8 A;  2P9L C;  1YFQ A;  4CI8 A;  4IMM A;  1PEV A;  2CN2 A;  4O1Q D;  2Z2O A;  3ODT A;  4N14 A;  4O3U B;  3UVN A;  5IT9 g;  4GMB A;  5EAL A;  3BG1 A;  3JZH A;  3NVX A;  3I89 A;  4D0K A;  3FRX A;  4K3J B;  1SQ9 A;  4CZY A;  3VGZ A;  4J78 A;  4PXW A;  4HDJ A;  3UVO A;  5TDH B;  2GC7 A;  1MG3 A;  3SMR A;  4YVD A;  2AQ5 A;  2GC4 A;  3RLM D;  1GOT B;  3PSC B;  3AL8 B;  5EM2 A;  2J55 H;  3EG6 A;  3EI3 A;  4A0B A;  4CI1 A;  4A09 B;  4X60 B;  4QQE A;  5FKQ A;  2AH0 A;  4GM9 A;  4A2M A;  2I3S A;  3PVW B;  4Z8L A;  1OMW B;  1U4C A;  3I8E A;  4Y7R A;  3OL2 B;  4ERY A;  5EMJ B;  5CXB B;  2I0S A;  3C5M A;  5HE1 B;  5KDO B;  3A0F A;  5CXC A;  5TF2 A;  5AFU 3;  4H5I A;  4CY5 A;  2GNQ A;  4J84 A;  2HYE A;  3SJL D;  4A08 B;  3C75 H;  4CZX A;  3J80 g;  1PBY B;  5K19 A;  2AGX A;  3KRW B;  3HFQ A;  3MZK A;  5IC7 A;  1MG2 A;  1RI6 A;  2H47 A;  3EI4 B;  3SXT D;  2P9P C;  3SBP A;  5FLX g;  4QL1 A;  2HES X;  3V5W B;  3RMZ D;  4A0A B;  2P9K C;  2B5M A;  2IWF A;  2AGL A;  4GGC A;  3AFC A;  2H68 A;  3KRX B;  1N6E A;  4JXM A;  3I7L A;  4J0X A;  3C99 A;  3N0D A;  4K3I D;  3JZN A;  3CFS B;  2CNX A;  2PM6 B;  4PC0 A;  1PI6 A;  3EWE A;  3EU7 A;  2B5N A;  4GM3 A;  2CN3 A;  1TBG A;  4LGN A;  3NVN A;  4L3G D;  2G9A A;  5IGO A;  4AOW A;  3PXT D;  3F3G A;  3V7D B;  3SFZ A;  5JWZ A;  3OKW A;  1JJU B;  4ZOX A;  4FAN D;  4J77 A;  3JB9 L;  2MTA H;  3DXK C;  3SBQ A;  3I7P A;  5CYK B;  4U7A A;  1B9X A;  3IJ0 A;  1N6D A;  3IJC A;  3IJ1 A;  4BUJ C;  2HXC A;  2OJY A;  2PM9 B;  2H6K A;  3PXS D;  2IAA A;  2J57 G;  3GFC A;  4ZN4 A;  2BBK H;  4J8B A;  2G99 A;  5IJ7 E;  5I5I A;  2AGZ A;  4CY3 A;  3SHF A;  2YMU A;  4XYI A;  3MZL A;  3UVL A;  4GZ8 A;  3F3F A;  5FKS A;  4GGA A;  4J81 A;  3K27 A;  4IA9 A;  3RFG A;  3N0E A;  3EI2 A;  3AH8 B;  3C9C A;  5HE2 B;  5GMK n;  1XHM A;  4X61 B;  2H3X A;  3MXX A;  3I8C A;  2PBI B;  4CI3 A;  4ESG A;  4MK0 B;  3SWS D;  4A0B B;  5TEE A;  5HE0 B;  3JPX A;  5K1C C;  3IIW A;  2TRC B;  4O45 A;  3F3P A;  4J73 A;  4FAV D;  3SCY A;  3PSL A;  4Y5R D;  4E5Z B;  3RN1 D;  4GQ2 P;  2H6Q A;  1Q47 A;  1NEX B;  3ZWL B;  2AGY A;  1XIP A;  5IGQ A;  4A11 B;  4AEZ A;  4L1Q D;  3NVQ A;  3GRE A;  2HJ4 A;  4E54 B;  2HJB A;  2YNO A;  4JSN C;  3J81 g;  3AL8 A;  1OLZ A;  2H9N A;  4U1E I;  2EBS A;  2YNN A;  3EI1 B;  2O9K A;  5HYN B;  3E0C A;  4A09 A;  5A2Q g;  2Q7Q A;  3SN6 B;  2P9S C;  5AMS A;  2PM7 B;  2IUQ A;  3OKY B;  3UKU C;  4XYH A;  3MMY A;  1QNI A;  5FKT A;  4JD2 C;  4JSP C;  5FKR A;  3UVM A;  3DWL C;  4X63 B;  5CXB A;  3SVW D;  2XYI A;  1GG2 B;  4GM8 A;  4A7J A;  1JMX B;  4XEI C;  4A08 A;  3L4M D;  2P9N C;  3ORV D;  5FQD A;  5FA5 B;  2OIZ A;  2W18 A;  3MKS B;  2Z2P A;  4J79 A;  2XL3 A;  4A2L A;  4J8G A;  5HQG A;  2OK4 A;  4JSX C;  2HKR A;  4ES0 A;  2XU7 A;  3UR4 A;  1XKS A;  4EWR A;  4JSV C;  5EAR A;  3FM0 A;  4FA1 D;  2OVP B;  3SBR A;  2Z2N A;  4ZOY A;  3DXM C;  3B7F A;  5C9Z B;  1K32 A;  3VH0 A;  2P9U C;  3PVU B;  2XL2 A;  3JRP A;  4PBY A;  5EAP A;  2AH1 A;  3RFH A;  4FB1 D;  3VA6 A;  4ZOV A;  4FWW A;  5I5J A;  3FGB A;  3JRO A;  4D6V A;  3OTT A;  4QRJ A;  2H6N A;  4OWR A;  1S4U X;  3IKO A;  4J0W A;  3OW8 A;  2CE8 A;  3DM0 A;  1U2V C;  4R7A B;  3ULE C;  4FHL A;  4CZV A;  3I7K A;  2OVR B;  3CIK B;  5CYK A;  4JT5 C;  3EMH A;  2PM9 A;  3K26 A;  5EM2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...