5EAMA

Crystal structure of human wdr5 in complex with compound 9o
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structure-Based Optimization of a Small Molecule Antagonist of the Interaction Between WD Repeat-Containing Protein 5 (WDR5) and Mixed-Lineage Leukemia 1 (MLL1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 105
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5eamA00
2CNXA 4J81A 5C2WB 3PVWB 4GM8A 4AEZA 4XEIC 5AMSA 4A09A 2XL3A 5I5MA 1GXRA 5C2VB 2H6NA 3L4MD 2O9KA 3DSMA 3I7KA 3EI3B 3L4OD 4GMBA 4L3HD 4QT8A 5C9ZB 2AH0A 3SHFA 4X3EA 3IKOA 4GGDA 2GC4A 3MXXA 4A0BA 3UVMA 3AL9A 2H6QA 3B7FA 1QNIA 3EI4B 3RFGA 1NR0A 3MZKA 3PSLA 3RFHA 4A2LA 1ERJA 5HYNB 2EBSA 4ZOYA 3AFCA 2Z2NA 3EI1B 1B9XA 2IUPA 5FKSA 4CY3A 3VH0A 4FWWA 5HE2B 5FQDA 3OKYB 4JT6C 4GGAA 4FA1D 5CYKB 4CY1A 3EG6A 5EARA 5IT9g 1Q47A 3I89A 3SBRA 5IGQA 3JZGA 4L9OA 4D0KA 2BCJB 3JPXA 5A2Qg 4E54B 4X63B 5H17A 5K1CC 2Z2PA 4PSWB 3MZLA 1SHYB 1VYHC 4FAND 3ORVD 4TZ4A 4J73A 5HE0B 3EI4A 2IUQA 5KDOB 2J55H 2HKMA 2YBAA 4Z8LA 4CY2A 2H13A 3NVQA 3GREA 4MK0B 2J56H 2AGZA 3V7DB 5H1MA 3EI1A 5TDHB 4A11B 2B5MA 2HJBA 2IUVA 1TYQC 2IURA 4FHLA 4Y7RA 5IGOA 5CYKA 4K3JB 4X60B 4BUJC 5K19A 4QRJA 2AGLA 3OW8A 4FAVD 4JSNC 3U4YA 4EWRA 4A7JA 4J82A 3ODTA 5FKQA 4E54A 2H68A 5CXBB 3I2NA 3SN6B 2B4EA 3IJ0A 4ERQA 4O3UB 3I8EA 3N0DA 2YNOA 2P9IC 3UVKA 3I7PA 4GGCA 2CE8A 2IAAA 2OIZA 3EMHA 4A0AA 2HKRA 4J78A 2I3TA 4PXWA 3CFSB 2QC5A 4JT5C 3PVUB 4ZN4A 1K8KC 5AFU3 4ZOZA 3ULEC 4J87A 1N6EA 3SXTD 4IMMA 1MG3A 2UZYB 3MMYA 3JRPA 3UKRC 3JAMg 3RLMD 4A11A 5CXCB 3I8CA 3OL2B 5TEEA 2QXVA 1MG2A 3BG0A 5HQGA 3C9CA 2AGWA 4OWRA 2XYIA 2OVQB 3DWLC 4H5JA 1P22A 4FB1D 2H9LA 2H9PA 2W18A 3ZWLB 4CZYA 4QL1A 3OKWA 4ESGA 4FA5D 3F3PA 4FA9D 3JB9L 4L3GD 5CXBA 3JZHA 3IJCA 4IA9A 4CI3A 3RSEC 4CI1A 5EMKB 4JSPC 3RN0D 1N6DA 3F3GA 4A2MA 5AJAA 4UI9R 3DXKC 3SBPA 3JROA 5CXCA 3OL2A 4J86A 2CO0A 4PNKB 5EAMA 3EI3A 2H6KA 5THAA 4I79A 3RN1D 2H14A 4A08B 3EWEA 3VGZA 3EI2B 2G9AA 2Q7QA 3N0EA 2MTAH 2I0RA 4KFMB 3FRXA 1U4CA 3UKUC 5IJ7E 2B5NA 1L0QA 5JWZA 1RI6A 2YNNA 2TRCB 2PM9B 3PXSD 3J81g 1A0RB 5IC7A 4U1EI 1U2VC 4GQBB 3OKYA 4CI8A 4O3TB 3FGBA 3V9FA 4FA4D 4GM9A 2OVPB 5B4WA 2H47A 3I7HA 5GMKn 3J80g 1MDAH 4D6VA 2H9NA 2Z2OA 2J57G 1XKSA 2PM7B 2UZXB 3KRWB 1GP2B 4J84A 2P9SC 1OLZA 4CI2A 2CE9A 2AGXA 5SXMA 3P4FA 4A08A 1N6FA 4U7AA 1JMXB 4E5ZB 3EI2A 2YB8B 3FM0A 5FA5B 4JSVC 4CY5A 3SBQA 2PM9A 3MKSB 4CC9A 1OMWB 4BH6A 4ZOXA 3NVNA 5HE3B 1TBGA 3W15A 5I5IA 1SQJA 1XHMA 4BL0A 1JMZB 1PEVA 3F3FA 2GNQA 5TF2A 3VA6A 2B5LA 4PC0A 2XU7A 3PXTD 4CZVA 3I7OA 4ERYA 4GQ2P 2IWFA 3V5WB 3A0FA 4ERZA 2AQ5A 3E0CA 3PSCB 5I5JA 5FKRA 4E5ZA 4GM3A 3UVOA 2IWKA 3BG1A 3SFZA 4O1QD 1FWXA 2YMUA 3RRMC 1YFQA 4J8GA 4J0WA 2HYEA 4ZOVA 2OK6A 2P9NC 4J77A 1SQ9A 1S4UX 3I7LA 3SJLD 3AL8B 1PBYB 2HXCA 3PE7A 1NEXB 5GSAA 3SCYA 5GXIA 4HDJA 5H14A 2PBIB 4GQ1A 4LG9A 3DXMC 3SLED 5IJ8E 3BWSA 4O9DA 4AOWA 4J0XA 2BBKH 3IIWA 4L1QD 4O45A 3K27A 2CN3A 4PSXB 5FXYA 2CN2A 2HJ4A 4K3ID 3C5MA 1B9YA 2XL2A 2G99A 3OTTA 2H9MA 4XYHA 4JSXC 5GXHA 4H5IA 4GZ8A 5FLXg 5EM2B 3CFVA 5EMJB 2CO0C 4LGNA 3IJ1A 4JD2C 2P9UC 2P9LC 4YVDA 3KRXB 5EMMB 3GFCA 3PXWD 3DM0A 4G56B 4XYIA 2PM6B 3K26A 2AGYA 4A0AB 4PBZA 2P9KC 3CIKB 3SVWD 3UVLA 2P9PC 4ES0A 1XIPA 1K32A 4A09B 2HESX 3AL8A 5FKTA 5HE1B 3SWSD 1R5MA 2OJYA 4OZUA 3RMZD 3C75H 5EALA 1JOFA 3UR4A 4J79A 2GC7A 2H3XA 4JXMA 4NSXA 2I3SA 2OVRB 3UVNA 3I7NA 2I0SA 3EU7A 4QQEA 4R7AB 2I0TA 3C99A 3AH8B 3IIYA 4A0BB 3MKQA 2YNPA 3SMRA 4X61B 3OKTA 5EM2A 4J8BA 4N14A 1GOTB 1PI6A 4CZXA 5TEFA 2AH1A 3HFQA 1PGUA 1GG2B 5EMLB 2OK4A 3JZNA 4Y5RD 4LG8A 4PBYA 1JJUB 3NVXA 5EAPA
chains in the Genus database with same CATH superfamily
2CNXA 4J81A 5C2WB 3PVWB 4GM8A 4AEZA 4XEIC 1YR2A 2HU8A 5AMSA 4A09A 2XL3A 5I5MA 4BCBA 4UM9A 4MMYA 1GXRA 5C2VB 2H6NA 3L4MD 4DNVA 2O9KA 3DSMA 3I7KA 4JHPC 4G1MA 5M5VA 4BCDA 3EI3B 3L4OD 4GMBA 2VDNA 4L3HD 4QT8A 5C9ZB 2AH0A 3SHFA 4X3EA 3IKOA 1H2YA 4GGDA 2GC4A 1L5GA 3MXXA 4A0BA 3UVMA 3V4VA 3AL9A 2H6QA 3B7FA 1QNIA 1I2MB 3EI4B 3RFGA 1NR0A 3MZKA 3PSLA 3RFHA 1VE6A 4A2LA 1ERJA 5HYNB 3ZE0A 2EBSA 4ZOYA 3AFCA 4WK4A 2VDQA 2Z2NA 5FFOA 1GOGA 3EQ9A 3EI1B 1B9XA 2IUPA 5FKSA 4CY3A 5M5SA 3VH0A 4FWWA 5HE2B 3KCIA 5FQDA 3OKYB 4JT6C 4GGAA 4FA1D 5CYKB 4CY1A 3EG6A 1TYEA 5EARA 5IT9g 3ZDYA 1Q47A 3I89A 3SBRA 5IGQA 3JZGA 4L9OA 4D0KA 2BCJB 3JPXA 4G1EA 3EQ7A 4DNWA 5A2Qg 3GD1I 4E54B 1GOFA 4X63B 2VDRA 5H17A 5K1CC 2Z2PA 4PSWB 3MZLA 3FCSA 1SHYB 1VYHC 4FAND 3ORVD 4TZ4A 4J73A 5HE0B 3EI4A 2IUQA 5KDOB 2J55H 2HKMA 2YBAA 3IULA 4Z8LA 3MUNA 1JTDB 4CY2A 2H13A 3NVQA 4L1MA 3GREA 4MK0B 2J56H 2AGZA 2XE4A 3V7DB 5H1MA 3EI1A 2JKXA 3ZE2A 4AN1A 1UTCA 3K72A 1H2WA 1E8MA 5M61A 5TDHB 4A11B 2B5MA 2HJBA 2IUVA 1TYQC 2IURA 4FHLA 1VZ3A 4Y7RA 4AMZA 3V4PA 5IGOA 5CYKA 4K3JB 4X60B 2VDOA 4BUJC 5K19A 4QRJA 2AGLA 3OW8A 4WK2A 4FAVD 5M5RA 4JSNC 3U4YA 4EWRA 4A7JA 4J82A 4WJKA 3ODTA 5FKQA 4E54A 2H68A 5CXBB 3I2NA 3SN6B 2B4EA 3IJ0A 4ERQA 4O3UB 3I8EA 3N0DA 4D9SA 2YNOA 2P9IC 1UOQA 3UVKA 3I7PA 4GGCA 2CE8A 2IAAA 2OIZA 3EMHA 4A0AA 2HKRA 4J78A 2I3TA 4PXWA 3CFSB 2QC5A 3NIDA 3O4JA 4JT5C 3GC3B 3PVUB 4ZN4A 1K8KC 5AFU3 4ZOZA 3ULEC 2HU5A 4J87A 1N6EA 3SXTD 4IMMA 4QAMA 1MG3A 4O02A 2UZYB 3MMYA 3JRPA 3UKRC 3JAMg 3RLMD 4A11A 5CXCB 3I8CA 3OL2B 3NIGA 5TEEA 2QXVA 1MG2A 3BG0A 4UM8A 5HQGA 3C9CA 2AGWA 4OWRA 2XYIA 3IUQA 3DWLC 2OVQB 4H5JA 1P22A 3FCUA 3QHYB 4FB1D 2H9LA 1C9LA 2W18A 3ZWLB 4CZYA 4QL1A 3OKWA 2VDLA 4ESGA 4FA5D 3F3PA 4FA9D 4BCCA 3JB9L 4L3GD 5CXBA 3JZHA 3IJCA 3IJEA 4IA9A 4CI3A 2VZ1A 1VZ2A 3RSEC 4CI1A 5EMKB 4JSPC 3RN0D 3QI0A 1UOOA 1N6DA 5C86A 3F3GA 4NAAA 2HU7A 3NVXA 3O4IA 4DNUA 4A2MA 5AJAA 2BKLA 4UI9R 1E5TA 3DXKC 3SBPA 3JROA 5CXCA 3OL2A 2EIBA 4J86A 4BP9A 3OF7A 2CO0A 4PNKB 5EAMA 3EI3A 2H6KA 5THAA 3T3PA 4I79A 3RN1D 3ZE1A 5C92A 2H14A 4A08B 1A12A 3EWEA 3VGZA 3K71A 3EI2B 2G9AA 2Q7QA 5E6RA 3N0EA 2MTAH 2I0RA 3IUJA 3FRXA 1U4CA 4KFMB 3UKUC 5IJ7E 3IUMA 2B5NA 1L0QA 5JWZA 1RI6A 2YNNA 2TRCB 2PM9B 3PXSD 3J81g 5HDBA 1A0RB 5IC7A 3IURA 4U1EI 3MVDK 1U2VC 4GQBB 4NBMA 3OKYA 4CI8A 3MUOA 4O3TB 3FGBA 3NIFA 3V9FA 4FA4D 2XZGA 4GM9A 2OVPB 5B4WA 2H47A 3I7HA 5GMKn 3J80g 1MDAH 4D6VA 2H9NA 2Z2OA 2J57G 1XKSA 2PM7B 2UZXB 3KRWB 1GP2B 4J84A 2P9SC 3EQ8A 1OLZA 4G55A 4CI2A 2CE9A 2AGXA 2XDWA 4NC4A 5SXMA 3P4FA 4A08A 1N6FA 4RE5A 4U7AA 1JMXB 2VZ3A 4E5ZB 3EI2A 2YB8B 3FM0A 5FA5B 1O6FA 3O4GA 4JSVC 2EIEA 1JV2A 4CY5A 3SBQA 2PM9A 3MKSB 4CC9A 1OMWB 4BH6A 4ZOXA 3NVNA 5HE3B 1TBGA 1E8NA 4AMYA 3W15A 5I5IA 1SQJA 5E6SA 1XHMA 4BL0A 4MMZA 4RE6A 1JMZB 4Z7OA 1PEVA 3F3FA 2GNQA 5TF2A 3VA6A 2B5LA 4PC0A 2XU7A 5M5TA 3PXTD 4CZVA 2WQ8A 3I7OA 5FFGA 4ERYA 4GQ2P 4JHNA 4O2WA 2IWFA 3V5WB 3A0FA 4ERZA 2AQ5A 2VDMA 3E0CA 3PSCB 5I5JA 5FKRA 4E5ZA 4GM3A 3UVOA 2IWKA 3BG1A 3SFZA 4O1QD 1FWXA 2YMUA 3RRMC 1YFQA 4J8GA 4J0WA 2HYEA 4ZOVA 2OK6A 2QR5A 2P9NC 2QZPA 1QFSA 4J77A 1SQ9A 1S4UX 3I7LA 3SJLD 3AL8B 1PBYB 2HXCA 1T2XA 4IRZA 3PE7A 2VC2A 1NEXB 1VE7A 5GSAA 3SCYA 5GXIA 4HDJA 3ZDZA 5H14A 1O6GA 2PBIB 4GQ1A 4LG9A 3DXMC 2VDPA 3SLED 5IJ8E 3BWSA 4O9DA 4AOWA 4J0XA 2BBKH 3IIWA 4L1QD 4O45A 3K27A 2CN3A 4PSXB 5FXYA 2CN2A 2HJ4A 4MMXA 4K3ID 3C5MA 1B9YA 1GOHA 2XL2A 2G99A 3OTTA 3VI3A 2H9MA 4XYHA 5E6UA 1H2ZA 4JSXC 5GXHA 4H5IA 4GZ8A 5FLXg 5EM2B 3CFVA 5EMJB 2EICA 2CO0C 4LGNA 3IJ1A 4JD2C 1K3IA 2VDKA 4AN0A 4Z7QA 3O4HA 3DDUA 2P9UC 2P9LC 4YVDA 3KRXB 5EMMB 1M1XA 3GFCA 3PXWD 3DM0A 4WK0A 4BP8A 4G56B 4XYIA 2PM6B 3K26A 2AGYA 4A0AB 4PBZA 2P9KC 3CIKB 3SVWD 3IUNA 3IVMA 1H2XA 1BPOA 1UOPA 1U8CA 3UVLA 2P9PC 4ES0A 1XIPA 1K32A 4A09B 4NENA 2HESX 4AX4A 3AL8A 5FKTA 5HE1B 3SWSD 1R5MA 2OJYA 4OZUA 3RMZD 3C75H 2EIDA 5EALA 1JOFA 3UR4A 4J79A 2GC7A 3K6SA 2H3XA 4JXMA 4NSXA 2I3SA 2OVRB 3UVNA 3I7NA 2I0SA 1C9IA 3EU7A 4QQEA 4R7AB 2I0TA 3C99A 3AH8B 4Z7NA 3IIYA 4A0BB 3MKQA 2YNPA 3ZDXA 3SMRA 4X61B 3T3MA 3OKTA 5EM2A 4J8BA 4N14A 1GOTB 1PI6A 4CZXA 5TEFA 2AH1A 3HFQA 1PGUA 1QFMA 1GG2B 5EMLB 2OK4A 3JZNA 4Y5RD 3VI4A 5M5UA 4LG8A 4PBYA 1JJUB 2H9PA 5EAPA
chains in the Genus database with same CATH topology
2CNXA 4J81A 5C2WB 3PVWB 4GM8A 4AEZA 4XEIC 5AMSA 4A09A 2XL3A 5I5MA 1GXRA 5C2VB 2H6NA 3L4MD 2O9KA 3DSMA 3I7KA 3EI3B 3L4OD 4GMBA 4L3HD 4QT8A 5C9ZB 2AH0A 3SHFA 4X3EA 3IKOA 4GGDA 2GC4A 3MXXA 4A0BA 3UVMA 3AL9A 2H6QA 3B7FA 1QNIA 3EI4B 3RFGA 1NR0A 3MZKA 3PSLA 3RFHA 4A2LA 1ERJA 5HYNB 2EBSA 4ZOYA 3AFCA 2Z2NA 3EI1B 1B9XA 2IUPA 5FKSA 4CY3A 3VH0A 4FWWA 5HE2B 5FQDA 3OKYB 4JT6C 4GGAA 4FA1D 5CYKB 4CY1A 3EG6A 5EARA 5IT9g 1Q47A 3I89A 3SBRA 5IGQA 3JZGA 4L9OA 4D0KA 2BCJB 3JPXA 5A2Qg 4E54B 4X63B 5H17A 5K1CC 2Z2PA 4PSWB 3MZLA 1SHYB 1VYHC 4FAND 3ORVD 4TZ4A 4J73A 5HE0B 3EI4A 2IUQA 5KDOB 2J55H 2HKMA 2YBAA 4Z8LA 4CY2A 2H13A 3NVQA 3GREA 4MK0B 2J56H 2AGZA 3V7DB 5H1MA 3EI1A 5TDHB 4A11B 2B5MA 2HJBA 2IUVA 1TYQC 2IURA 4FHLA 4Y7RA 5IGOA 5CYKA 4K3JB 4X60B 4BUJC 5K19A 4QRJA 2AGLA 3OW8A 4FAVD 4JSNC 3U4YA 4EWRA 4A7JA 4J82A 3ODTA 5FKQA 4E54A 2H68A 5CXBB 3I2NA 3SN6B 2B4EA 3IJ0A 4ERQA 4O3UB 3I8EA 3N0DA 2YNOA 2P9IC 3UVKA 3I7PA 4GGCA 2CE8A 2IAAA 2OIZA 3EMHA 4A0AA 2HKRA 4J78A 2I3TA 4PXWA 3CFSB 2QC5A 4JT5C 3PVUB 4ZN4A 1K8KC 5AFU3 4ZOZA 3ULEC 4J87A 1N6EA 3SXTD 4IMMA 1MG3A 2UZYB 3MMYA 3JRPA 3UKRC 3JAMg 3RLMD 4A11A 5CXCB 3I8CA 3OL2B 5TEEA 2QXVA 1MG2A 3BG0A 5HQGA 3C9CA 2AGWA 4OWRA 2XYIA 2OVQB 3DWLC 4H5JA 1P22A 4FB1D 2H9LA 2H9PA 2W18A 3ZWLB 4CZYA 4QL1A 3OKWA 4ESGA 4FA5D 3F3PA 4FA9D 3JB9L 4L3GD 5CXBA 3JZHA 3IJCA 4IA9A 4CI3A 3RSEC 4CI1A 5EMKB 4JSPC 3RN0D 1N6DA 3F3GA 4A2MA 5AJAA 4UI9R 3DXKC 3SBPA 3JROA 5CXCA 3OL2A 4J86A 2CO0A 4PNKB 5EAMA 3EI3A 2H6KA 5THAA 4I79A 3RN1D 2H14A 4A08B 3EWEA 3VGZA 3EI2B 2G9AA 2Q7QA 3N0EA 2MTAH 2I0RA 4KFMB 3FRXA 1U4CA 3UKUC 5IJ7E 2B5NA 1L0QA 5JWZA 1RI6A 2YNNA 2TRCB 2PM9B 3PXSD 3J81g 1A0RB 5IC7A 4U1EI 1U2VC 4GQBB 3OKYA 4CI8A 4O3TB 3FGBA 3V9FA 4FA4D 4GM9A 2OVPB 5B4WA 2H47A 3I7HA 5GMKn 3J80g 1MDAH 4D6VA 2H9NA 2Z2OA 2J57G 1XKSA 2PM7B 2UZXB 3KRWB 1GP2B 4J84A 2P9SC 1OLZA 4CI2A 2CE9A 2AGXA 5SXMA 3P4FA 4A08A 1N6FA 4U7AA 1JMXB 4E5ZB 3EI2A 2YB8B 3FM0A 5FA5B 4JSVC 4CY5A 3SBQA 2PM9A 3MKSB 4CC9A 1OMWB 4BH6A 4ZOXA 3NVNA 5HE3B 1TBGA 3W15A 5I5IA 1SQJA 1XHMA 4BL0A 1JMZB 1PEVA 3F3FA 2GNQA 5TF2A 3VA6A 2B5LA 4PC0A 2XU7A 3PXTD 4CZVA 3I7OA 4ERYA 4GQ2P 2IWFA 3V5WB 3A0FA 4ERZA 2AQ5A 3E0CA 3PSCB 5I5JA 5FKRA 4E5ZA 4GM3A 3UVOA 2IWKA 3BG1A 3SFZA 4O1QD 1FWXA 2YMUA 3RRMC 1YFQA 4J8GA 4J0WA 2HYEA 4ZOVA 2OK6A 2P9NC 4J77A 1SQ9A 1S4UX 3I7LA 3SJLD 3AL8B 1PBYB 2HXCA 3PE7A 1NEXB 5GSAA 3SCYA 5GXIA 4HDJA 5H14A 2PBIB 4GQ1A 4LG9A 3DXMC 3SLED 5IJ8E 3BWSA 4O9DA 4AOWA 4J0XA 2BBKH 3IIWA 4L1QD 4O45A 3K27A 2CN3A 4PSXB 5FXYA 2CN2A 2HJ4A 4K3ID 3C5MA 1B9YA 2XL2A 2G99A 3OTTA 2H9MA 4XYHA 4JSXC 5GXHA 4H5IA 4GZ8A 5FLXg 5EM2B 3CFVA 5EMJB 2CO0C 4LGNA 3IJ1A 4JD2C 2P9UC 2P9LC 4YVDA 3KRXB 5EMMB 3GFCA 3PXWD 3DM0A 4G56B 4XYIA 2PM6B 3K26A 2AGYA 4A0AB 4PBZA 2P9KC 3CIKB 3SVWD 3UVLA 2P9PC 4ES0A 1XIPA 1K32A 4A09B 2HESX 3AL8A 5FKTA 5HE1B 3SWSD 1R5MA 2OJYA 4OZUA 3RMZD 3C75H 5EALA 1JOFA 3UR4A 4J79A 2GC7A 2H3XA 4JXMA 4NSXA 2I3SA 2OVRB 3UVNA 3I7NA 2I0SA 3EU7A 4QQEA 4R7AB 2I0TA 3C99A 3AH8B 3IIYA 4A0BB 3MKQA 2YNPA 3SMRA 4X61B 3OKTA 5EM2A 4J8BA 4N14A 1GOTB 1PI6A 4CZXA 5TEFA 2AH1A 3HFQA 1PGUA 1GG2B 5EMLB 2OK4A 3JZNA 4Y5RD 4LG8A 4PBYA 1JJUB 3NVXA 5EAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNX A;  4J81 A;  5C2W B;  3PVW B;  4GM8 A;  4AEZ A;  4XEI C;  5AMS A;  4A09 A;  2XL3 A;  5I5M A;  1GXR A;  5C2V B;  2H6N A;  3L4M D;  2O9K A;  3DSM A;  3I7K A;  3EI3 B;  3L4O D;  4GMB A;  4L3H D;  4QT8 A;  5C9Z B;  2AH0 A;  3SHF A;  4X3E A;  3IKO A;  4GGD A;  2GC4 A;  3MXX A;  4A0B A;  3UVM A;  3AL9 A;  2H6Q A;  3B7F A;  1QNI A;  3EI4 B;  3RFG A;  1NR0 A;  3MZK A;  3PSL A;  3RFH A;  4A2L A;  1ERJ A;  5HYN B;  2EBS A;  4ZOY A;  3AFC A;  2Z2N A;  3EI1 B;  1B9X A;  2IUP A;  5FKS A;  4CY3 A;  3VH0 A;  4FWW A;  5HE2 B;  5FQD A;  3OKY B;  4JT6 C;  4GGA A;  4FA1 D;  5CYK B;  4CY1 A;  3EG6 A;  5EAR A;  5IT9 g;  1Q47 A;  3I89 A;  3SBR A;  5IGQ A;  3JZG A;  4L9O A;  4D0K A;  2BCJ B;  3JPX A;  5A2Q g;  4E54 B;  4X63 B;  5H17 A;  5K1C C;  2Z2P A;  4PSW B;  3MZL A;  1SHY B;  1VYH C;  4FAN D;  3ORV D;  4TZ4 A;  4J73 A;  5HE0 B;  3EI4 A;  2IUQ A;  5KDO B;  2J55 H;  2HKM A;  2YBA A;  4Z8L A;  4CY2 A;  2H13 A;  3NVQ A;  3GRE A;  4MK0 B;  2J56 H;  2AGZ A;  3V7D B;  5H1M A;  3EI1 A;  5TDH B;  4A11 B;  2B5M A;  2HJB A;  2IUV A;  1TYQ C;  2IUR A;  4FHL A;  4Y7R A;  5IGO A;  5CYK A;  4K3J B;  4X60 B;  4BUJ C;  5K19 A;  4QRJ A;  2AGL A;  3OW8 A;  4FAV D;  4JSN C;  3U4Y A;  4EWR A;  4A7J A;  4J82 A;  3ODT A;  5FKQ A;  4E54 A;  2H68 A;  5CXB B;  3I2N A;  3SN6 B;  2B4E A;  3IJ0 A;  4ERQ A;  4O3U B;  3I8E A;  3N0D A;  2YNO A;  2P9I C;  3UVK A;  3I7P A;  4GGC A;  2CE8 A;  2IAA A;  2OIZ A;  3EMH A;  4A0A A;  2HKR A;  4J78 A;  2I3T A;  4PXW A;  3CFS B;  2QC5 A;  4JT5 C;  3PVU B;  4ZN4 A;  1K8K C;  5AFU 3;  4ZOZ A;  3ULE C;  4J87 A;  1N6E A;  3SXT D;  4IMM A;  1MG3 A;  2UZY B;  3MMY A;  3JRP A;  3UKR C;  3JAM g;  3RLM D;  4A11 A;  5CXC B;  3I8C A;  3OL2 B;  5TEE A;  2QXV A;  1MG2 A;  3BG0 A;  5HQG A;  3C9C A;  2AGW A;  4OWR A;  2XYI A;  2OVQ B;  3DWL C;  4H5J A;  1P22 A;  4FB1 D;  2H9L A;  2H9P A;  2W18 A;  3ZWL B;  4CZY A;  4QL1 A;  3OKW A;  4ESG A;  4FA5 D;  3F3P A;  4FA9 D;  3JB9 L;  4L3G D;  5CXB A;  3JZH A;  3IJC A;  4IA9 A;  4CI3 A;  3RSE C;  4CI1 A;  5EMK B;  4JSP C;  3RN0 D;  1N6D A;  3F3G A;  4A2M A;  5AJA A;  4UI9 R;  3DXK C;  3SBP A;  3JRO A;  5CXC A;  3OL2 A;  4J86 A;  2CO0 A;  4PNK B;  5EAM A;  3EI3 A;  2H6K A;  5THA A;  4I79 A;  3RN1 D;  2H14 A;  4A08 B;  3EWE A;  3VGZ A;  3EI2 B;  2G9A A;  2Q7Q A;  3N0E A;  2MTA H;  2I0R A;  4KFM B;  3FRX A;  1U4C A;  3UKU C;  5IJ7 E;  2B5N A;  1L0Q A;  5JWZ A;  1RI6 A;  2YNN A;  2TRC B;  2PM9 B;  3PXS D;  3J81 g;  1A0R B;  5IC7 A;  4U1E I;  1U2V C;  4GQB B;  3OKY A;  4CI8 A;  4O3T B;  3FGB A;  3V9F A;  4FA4 D;  4GM9 A;  2OVP B;  5B4W A;  2H47 A;  3I7H A;  5GMK n;  3J80 g;  1MDA H;  4D6V A;  2H9N A;  2Z2O A;  2J57 G;  1XKS A;  2PM7 B;  2UZX B;  3KRW B;  1GP2 B;  4J84 A;  2P9S C;  1OLZ A;  4CI2 A;  2CE9 A;  2AGX A;  5SXM A;  3P4F A;  4A08 A;  1N6F A;  4U7A A;  1JMX B;  4E5Z B;  3EI2 A;  2YB8 B;  3FM0 A;  5FA5 B;  4JSV C;  4CY5 A;  3SBQ A;  2PM9 A;  3MKS B;  4CC9 A;  1OMW B;  4BH6 A;  4ZOX A;  3NVN A;  5HE3 B;  1TBG A;  3W15 A;  5I5I A;  1SQJ A;  1XHM A;  4BL0 A;  1JMZ B;  1PEV A;  3F3F A;  2GNQ A;  5TF2 A;  3VA6 A;  2B5L A;  4PC0 A;  2XU7 A;  3PXT D;  4CZV A;  3I7O A;  4ERY A;  4GQ2 P;  2IWF A;  3V5W B;  3A0F A;  4ERZ A;  2AQ5 A;  3E0C A;  3PSC B;  5I5J A;  5FKR A;  4E5Z A;  4GM3 A;  3UVO A;  2IWK A;  3BG1 A;  3SFZ A;  4O1Q D;  1FWX A;  2YMU A;  3RRM C;  1YFQ A;  4J8G A;  4J0W A;  2HYE A;  4ZOV A;  2OK6 A;  2P9N C;  4J77 A;  1SQ9 A;  1S4U X;  3I7L A;  3SJL D;  3AL8 B;  1PBY B;  2HXC A;  3PE7 A;  1NEX B;  5GSA A;  3SCY A;  5GXI A;  4HDJ A;  5H14 A;  2PBI B;  4GQ1 A;  4LG9 A;  3DXM C;  3SLE D;  5IJ8 E;  3BWS A;  4O9D A;  4AOW A;  4J0X A;  2BBK H;  3IIW A;  4L1Q D;  4O45 A;  3K27 A;  2CN3 A;  4PSX B;  5FXY A;  2CN2 A;  2HJ4 A;  4K3I D;  3C5M A;  1B9Y A;  2XL2 A;  2G99 A;  3OTT A;  2H9M A;  4XYH A;  4JSX C;  5GXH A;  4H5I A;  4GZ8 A;  5FLX g;  5EM2 B;  3CFV A;  5EMJ B;  2CO0 C;  4LGN A;  3IJ1 A;  4JD2 C;  2P9U C;  2P9L C;  4YVD A;  3KRX B;  5EMM B;  3GFC A;  3PXW D;  3DM0 A;  4G56 B;  4XYI A;  2PM6 B;  3K26 A;  2AGY A;  4A0A B;  4PBZ A;  2P9K C;  3CIK B;  3SVW D;  3UVL A;  2P9P C;  4ES0 A;  1XIP A;  1K32 A;  4A09 B;  2HES X;  3AL8 A;  5FKT A;  5HE1 B;  3SWS D;  1R5M A;  2OJY A;  4OZU A;  3RMZ D;  3C75 H;  5EAL A;  1JOF A;  3UR4 A;  4J79 A;  2GC7 A;  2H3X A;  4JXM A;  4NSX A;  2I3S A;  2OVR B;  3UVN A;  3I7N A;  2I0S A;  3EU7 A;  4QQE A;  4R7A B;  2I0T A;  3C99 A;  3AH8 B;  3IIY A;  4A0B B;  3MKQ A;  2YNP A;  3SMR A;  4X61 B;  3OKT A;  5EM2 A;  4J8B A;  4N14 A;  1GOT B;  1PI6 A;  4CZX A;  5TEF A;  2AH1 A;  3HFQ A;  1PGU A;  1GG2 B;  5EML B;  2OK4 A;  3JZN A;  4Y5R D;  4LG8 A;  4PBY A;  1JJU B;  3NVX A;  5EAP A; 
#chains in the Genus database with same CATH topology
 2CNX A;  4J81 A;  5C2W B;  3PVW B;  4GM8 A;  4AEZ A;  4XEI C;  1YR2 A;  2HU8 A;  5AMS A;  4A09 A;  2XL3 A;  5I5M A;  4BCB A;  4UM9 A;  4MMY A;  1GXR A;  5C2V B;  2H6N A;  3L4M D;  4DNV A;  2O9K A;  3DSM A;  3I7K A;  4JHP C;  4G1M A;  5M5V A;  4BCD A;  3EI3 B;  3L4O D;  4GMB A;  2VDN A;  4L3H D;  4QT8 A;  5C9Z B;  2AH0 A;  3SHF A;  4X3E A;  3IKO A;  1H2Y A;  4GGD A;  2GC4 A;  1L5G A;  3MXX A;  4A0B A;  3UVM A;  3V4V A;  3AL9 A;  2H6Q A;  3B7F A;  1QNI A;  1I2M B;  3EI4 B;  3RFG A;  1NR0 A;  3MZK A;  3PSL A;  3RFH A;  1VE6 A;  4A2L A;  1ERJ A;  5HYN B;  3ZE0 A;  2EBS A;  4ZOY A;  3AFC A;  4WK4 A;  2VDQ A;  2Z2N A;  5FFO A;  1GOG A;  3EQ9 A;  3EI1 B;  1B9X A;  2IUP A;  5FKS A;  4CY3 A;  5M5S A;  3VH0 A;  4FWW A;  5HE2 B;  3KCI A;  5FQD A;  3OKY B;  4JT6 C;  4GGA A;  4FA1 D;  5CYK B;  4CY1 A;  3EG6 A;  1TYE A;  5EAR A;  5IT9 g;  3ZDY A;  1Q47 A;  3I89 A;  3SBR A;  5IGQ A;  3JZG A;  4L9O A;  4D0K A;  2BCJ B;  3JPX A;  4G1E A;  3EQ7 A;  4DNW A;  5A2Q g;  3GD1 I;  4E54 B;  1GOF A;  4X63 B;  2VDR A;  5H17 A;  5K1C C;  2Z2P A;  4PSW B;  3MZL A;  3FCS A;  1SHY B;  1VYH C;  4FAN D;  3ORV D;  4TZ4 A;  4J73 A;  5HE0 B;  3EI4 A;  2IUQ A;  5KDO B;  2J55 H;  2HKM A;  2YBA A;  3IUL A;  4Z8L A;  3MUN A;  1JTD B;  4CY2 A;  2H13 A;  3NVQ A;  4L1M A;  3GRE A;  4MK0 B;  2J56 H;  2AGZ A;  2XE4 A;  3V7D B;  5H1M A;  3EI1 A;  2JKX A;  3ZE2 A;  4AN1 A;  1UTC A;  3K72 A;  1H2W A;  1E8M A;  5M61 A;  5TDH B;  4A11 B;  2B5M A;  2HJB A;  2IUV A;  1TYQ C;  2IUR A;  4FHL A;  1VZ3 A;  4Y7R A;  4AMZ A;  3V4P A;  5IGO A;  5CYK A;  4K3J B;  4X60 B;  2VDO A;  4BUJ C;  5K19 A;  4QRJ A;  2AGL A;  3OW8 A;  4WK2 A;  4FAV D;  5M5R A;  4JSN C;  3U4Y A;  4EWR A;  4A7J A;  4J82 A;  4WJK A;  3ODT A;  5FKQ A;  4E54 A;  2H68 A;  5CXB B;  3I2N A;  3SN6 B;  2B4E A;  3IJ0 A;  4ERQ A;  4O3U B;  3I8E A;  3N0D A;  4D9S A;  2YNO A;  2P9I C;  1UOQ A;  3UVK A;  3I7P A;  4GGC A;  2CE8 A;  2IAA A;  2OIZ A;  3EMH A;  4A0A A;  2HKR A;  4J78 A;  2I3T A;  4PXW A;  3CFS B;  2QC5 A;  3NID A;  3O4J A;  4JT5 C;  3GC3 B;  3PVU B;  4ZN4 A;  1K8K C;  5AFU 3;  4ZOZ A;  3ULE C;  2HU5 A;  4J87 A;  1N6E A;  3SXT D;  4IMM A;  4QAM A;  1MG3 A;  4O02 A;  2UZY B;  3MMY A;  3JRP A;  3UKR C;  3JAM g;  3RLM D;  4A11 A;  5CXC B;  3I8C A;  3OL2 B;  3NIG A;  5TEE A;  2QXV A;  1MG2 A;  3BG0 A;  4UM8 A;  5HQG A;  3C9C A;  2AGW A;  4OWR A;  2XYI A;  3IUQ A;  3DWL C;  2OVQ B;  4H5J A;  1P22 A;  3FCU A;  3QHY B;  4FB1 D;  2H9L A;  1C9L A;  2W18 A;  3ZWL B;  4CZY A;  4QL1 A;  3OKW A;  2VDL A;  4ESG A;  4FA5 D;  3F3P A;  4FA9 D;  4BCC A;  3JB9 L;  4L3G D;  5CXB A;  3JZH A;  3IJC A;  3IJE A;  4IA9 A;  4CI3 A;  2VZ1 A;  1VZ2 A;  3RSE C;  4CI1 A;  5EMK B;  4JSP C;  3RN0 D;  3QI0 A;  1UOO A;  1N6D A;  5C86 A;  3F3G A;  4NAA A;  2HU7 A;  3NVX A;  3O4I A;  4DNU A;  4A2M A;  5AJA A;  2BKL A;  4UI9 R;  1E5T A;  3DXK C;  3SBP A;  3JRO A;  5CXC A;  3OL2 A;  2EIB A;  4J86 A;  4BP9 A;  3OF7 A;  2CO0 A;  4PNK B;  5EAM A;  3EI3 A;  2H6K A;  5THA A;  3T3P A;  4I79 A;  3RN1 D;  3ZE1 A;  5C92 A;  2H14 A;  4A08 B;  1A12 A;  3EWE A;  3VGZ A;  3K71 A;  3EI2 B;  2G9A A;  2Q7Q A;  5E6R A;  3N0E A;  2MTA H;  2I0R A;  3IUJ A;  3FRX A;  1U4C A;  4KFM B;  3UKU C;  5IJ7 E;  3IUM A;  2B5N A;  1L0Q A;  5JWZ A;  1RI6 A;  2YNN A;  2TRC B;  2PM9 B;  3PXS D;  3J81 g;  5HDB A;  1A0R B;  5IC7 A;  3IUR A;  4U1E I;  3MVD K;  1U2V C;  4GQB B;  4NBM A;  3OKY A;  4CI8 A;  3MUO A;  4O3T B;  3FGB A;  3NIF A;  3V9F A;  4FA4 D;  2XZG A;  4GM9 A;  2OVP B;  5B4W A;  2H47 A;  3I7H A;  5GMK n;  3J80 g;  1MDA H;  4D6V A;  2H9N A;  2Z2O A;  2J57 G;  1XKS A;  2PM7 B;  2UZX B;  3KRW B;  1GP2 B;  4J84 A;  2P9S C;  3EQ8 A;  1OLZ A;  4G55 A;  4CI2 A;  2CE9 A;  2AGX A;  2XDW A;  4NC4 A;  5SXM A;  3P4F A;  4A08 A;  1N6F A;  4RE5 A;  4U7A A;  1JMX B;  2VZ3 A;  4E5Z B;  3EI2 A;  2YB8 B;  3FM0 A;  5FA5 B;  1O6F A;  3O4G A;  4JSV C;  2EIE A;  1JV2 A;  4CY5 A;  3SBQ A;  2PM9 A;  3MKS B;  4CC9 A;  1OMW B;  4BH6 A;  4ZOX A;  3NVN A;  5HE3 B;  1TBG A;  1E8N A;  4AMY A;  3W15 A;  5I5I A;  1SQJ A;  5E6S A;  1XHM A;  4BL0 A;  4MMZ A;  4RE6 A;  1JMZ B;  4Z7O A;  1PEV A;  3F3F A;  2GNQ A;  5TF2 A;  3VA6 A;  2B5L A;  4PC0 A;  2XU7 A;  5M5T A;  3PXT D;  4CZV A;  2WQ8 A;  3I7O A;  5FFG A;  4ERY A;  4GQ2 P;  4JHN A;  4O2W A;  2IWF A;  3V5W B;  3A0F A;  4ERZ A;  2AQ5 A;  2VDM A;  3E0C A;  3PSC B;  5I5J A;  5FKR A;  4E5Z A;  4GM3 A;  3UVO A;  2IWK A;  3BG1 A;  3SFZ A;  4O1Q D;  1FWX A;  2YMU A;  3RRM C;  1YFQ A;  4J8G A;  4J0W A;  2HYE A;  4ZOV A;  2OK6 A;  2QR5 A;  2P9N C;  2QZP A;  1QFS A;  4J77 A;  1SQ9 A;  1S4U X;  3I7L A;  3SJL D;  3AL8 B;  1PBY B;  2HXC A;  1T2X A;  4IRZ A;  3PE7 A;  2VC2 A;  1NEX B;  1VE7 A;  5GSA A;  3SCY A;  5GXI A;  4HDJ A;  3ZDZ A;  5H14 A;  1O6G A;  2PBI B;  4GQ1 A;  4LG9 A;  3DXM C;  2VDP A;  3SLE D;  5IJ8 E;  3BWS A;  4O9D A;  4AOW A;  4J0X A;  2BBK H;  3IIW A;  4L1Q D;  4O45 A;  3K27 A;  2CN3 A;  4PSX B;  5FXY A;  2CN2 A;  2HJ4 A;  4MMX A;  4K3I D;  3C5M A;  1B9Y A;  1GOH A;  2XL2 A;  2G99 A;  3OTT A;  3VI3 A;  2H9M A;  4XYH A;  5E6U A;  1H2Z A;  4JSX C;  5GXH A;  4H5I A;  4GZ8 A;  5FLX g;  5EM2 B;  3CFV A;  5EMJ B;  2EIC A;  2CO0 C;  4LGN A;  3IJ1 A;  4JD2 C;  1K3I A;  2VDK A;  4AN0 A;  4Z7Q A;  3O4H A;  3DDU A;  2P9U C;  2P9L C;  4YVD A;  3KRX B;  5EMM B;  1M1X A;  3GFC A;  3PXW D;  3DM0 A;  4WK0 A;  4BP8 A;  4G56 B;  4XYI A;  2PM6 B;  3K26 A;  2AGY A;  4A0A B;  4PBZ A;  2P9K C;  3CIK B;  3SVW D;  3IUN A;  3IVM A;  1H2X A;  1BPO A;  1UOP A;  1U8C A;  3UVL A;  2P9P C;  4ES0 A;  1XIP A;  1K32 A;  4A09 B;  4NEN A;  2HES X;  4AX4 A;  3AL8 A;  5FKT A;  5HE1 B;  3SWS D;  1R5M A;  2OJY A;  4OZU A;  3RMZ D;  3C75 H;  2EID A;  5EAL A;  1JOF A;  3UR4 A;  4J79 A;  2GC7 A;  3K6S A;  2H3X A;  4JXM A;  4NSX A;  2I3S A;  2OVR B;  3UVN A;  3I7N A;  2I0S A;  1C9I A;  3EU7 A;  4QQE A;  4R7A B;  2I0T A;  3C99 A;  3AH8 B;  4Z7N A;  3IIY A;  4A0B B;  3MKQ A;  2YNP A;  3ZDX A;  3SMR A;  4X61 B;  3T3M A;  3OKT A;  5EM2 A;  4J8B A;  4N14 A;  1GOT B;  1PI6 A;  4CZX A;  5TEF A;  2AH1 A;  3HFQ A;  1PGU A;  1QFM A;  1GG2 B;  5EML B;  2OK4 A;  3JZN A;  4Y5R D;  3VI4 A;  5M5U A;  4LG8 A;  4PBY A;  1JJU B;  2H9P A;  5EAP A; 
#chains in the Genus database with same CATH homology
 2CNX A;  4J81 A;  5C2W B;  3PVW B;  4GM8 A;  4AEZ A;  4XEI C;  5AMS A;  4A09 A;  2XL3 A;  5I5M A;  1GXR A;  5C2V B;  2H6N A;  3L4M D;  2O9K A;  3DSM A;  3I7K A;  3EI3 B;  3L4O D;  4GMB A;  4L3H D;  4QT8 A;  5C9Z B;  2AH0 A;  3SHF A;  4X3E A;  3IKO A;  4GGD A;  2GC4 A;  3MXX A;  4A0B A;  3UVM A;  3AL9 A;  2H6Q A;  3B7F A;  1QNI A;  3EI4 B;  3RFG A;  1NR0 A;  3MZK A;  3PSL A;  3RFH A;  4A2L A;  1ERJ A;  5HYN B;  2EBS A;  4ZOY A;  3AFC A;  2Z2N A;  3EI1 B;  1B9X A;  2IUP A;  5FKS A;  4CY3 A;  3VH0 A;  4FWW A;  5HE2 B;  5FQD A;  3OKY B;  4JT6 C;  4GGA A;  4FA1 D;  5CYK B;  4CY1 A;  3EG6 A;  5EAR A;  5IT9 g;  1Q47 A;  3I89 A;  3SBR A;  5IGQ A;  3JZG A;  4L9O A;  4D0K A;  2BCJ B;  3JPX A;  5A2Q g;  4E54 B;  4X63 B;  5H17 A;  5K1C C;  2Z2P A;  4PSW B;  3MZL A;  1SHY B;  1VYH C;  4FAN D;  3ORV D;  4TZ4 A;  4J73 A;  5HE0 B;  3EI4 A;  2IUQ A;  5KDO B;  2J55 H;  2HKM A;  2YBA A;  4Z8L A;  4CY2 A;  2H13 A;  3NVQ A;  3GRE A;  4MK0 B;  2J56 H;  2AGZ A;  3V7D B;  5H1M A;  3EI1 A;  5TDH B;  4A11 B;  2B5M A;  2HJB A;  2IUV A;  1TYQ C;  2IUR A;  4FHL A;  4Y7R A;  5IGO A;  5CYK A;  4K3J B;  4X60 B;  4BUJ C;  5K19 A;  4QRJ A;  2AGL A;  3OW8 A;  4FAV D;  4JSN C;  3U4Y A;  4EWR A;  4A7J A;  4J82 A;  3ODT A;  5FKQ A;  4E54 A;  2H68 A;  5CXB B;  3I2N A;  3SN6 B;  2B4E A;  3IJ0 A;  4ERQ A;  4O3U B;  3I8E A;  3N0D A;  2YNO A;  2P9I C;  3UVK A;  3I7P A;  4GGC A;  2CE8 A;  2IAA A;  2OIZ A;  3EMH A;  4A0A A;  2HKR A;  4J78 A;  2I3T A;  4PXW A;  3CFS B;  2QC5 A;  4JT5 C;  3PVU B;  4ZN4 A;  1K8K C;  5AFU 3;  4ZOZ A;  3ULE C;  4J87 A;  1N6E A;  3SXT D;  4IMM A;  1MG3 A;  2UZY B;  3MMY A;  3JRP A;  3UKR C;  3JAM g;  3RLM D;  4A11 A;  5CXC B;  3I8C A;  3OL2 B;  5TEE A;  2QXV A;  1MG2 A;  3BG0 A;  5HQG A;  3C9C A;  2AGW A;  4OWR A;  2XYI A;  2OVQ B;  3DWL C;  4H5J A;  1P22 A;  4FB1 D;  2H9L A;  2H9P A;  2W18 A;  3ZWL B;  4CZY A;  4QL1 A;  3OKW A;  4ESG A;  4FA5 D;  3F3P A;  4FA9 D;  3JB9 L;  4L3G D;  5CXB A;  3JZH A;  3IJC A;  4IA9 A;  4CI3 A;  3RSE C;  4CI1 A;  5EMK B;  4JSP C;  3RN0 D;  1N6D A;  3F3G A;  4A2M A;  5AJA A;  4UI9 R;  3DXK C;  3SBP A;  3JRO A;  5CXC A;  3OL2 A;  4J86 A;  2CO0 A;  4PNK B;  5EAM A;  3EI3 A;  2H6K A;  5THA A;  4I79 A;  3RN1 D;  2H14 A;  4A08 B;  3EWE A;  3VGZ A;  3EI2 B;  2G9A A;  2Q7Q A;  3N0E A;  2MTA H;  2I0R A;  4KFM B;  3FRX A;  1U4C A;  3UKU C;  5IJ7 E;  2B5N A;  1L0Q A;  5JWZ A;  1RI6 A;  2YNN A;  2TRC B;  2PM9 B;  3PXS D;  3J81 g;  1A0R B;  5IC7 A;  4U1E I;  1U2V C;  4GQB B;  3OKY A;  4CI8 A;  4O3T B;  3FGB A;  3V9F A;  4FA4 D;  4GM9 A;  2OVP B;  5B4W A;  2H47 A;  3I7H A;  5GMK n;  3J80 g;  1MDA H;  4D6V A;  2H9N A;  2Z2O A;  2J57 G;  1XKS A;  2PM7 B;  2UZX B;  3KRW B;  1GP2 B;  4J84 A;  2P9S C;  1OLZ A;  4CI2 A;  2CE9 A;  2AGX A;  5SXM A;  3P4F A;  4A08 A;  1N6F A;  4U7A A;  1JMX B;  4E5Z B;  3EI2 A;  2YB8 B;  3FM0 A;  5FA5 B;  4JSV C;  4CY5 A;  3SBQ A;  2PM9 A;  3MKS B;  4CC9 A;  1OMW B;  4BH6 A;  4ZOX A;  3NVN A;  5HE3 B;  1TBG A;  3W15 A;  5I5I A;  1SQJ A;  1XHM A;  4BL0 A;  1JMZ B;  1PEV A;  3F3F A;  2GNQ A;  5TF2 A;  3VA6 A;  2B5L A;  4PC0 A;  2XU7 A;  3PXT D;  4CZV A;  3I7O A;  4ERY A;  4GQ2 P;  2IWF A;  3V5W B;  3A0F A;  4ERZ A;  2AQ5 A;  3E0C A;  3PSC B;  5I5J A;  5FKR A;  4E5Z A;  4GM3 A;  3UVO A;  2IWK A;  3BG1 A;  3SFZ A;  4O1Q D;  1FWX A;  2YMU A;  3RRM C;  1YFQ A;  4J8G A;  4J0W A;  2HYE A;  4ZOV A;  2OK6 A;  2P9N C;  4J77 A;  1SQ9 A;  1S4U X;  3I7L A;  3SJL D;  3AL8 B;  1PBY B;  2HXC A;  3PE7 A;  1NEX B;  5GSA A;  3SCY A;  5GXI A;  4HDJ A;  5H14 A;  2PBI B;  4GQ1 A;  4LG9 A;  3DXM C;  3SLE D;  5IJ8 E;  3BWS A;  4O9D A;  4AOW A;  4J0X A;  2BBK H;  3IIW A;  4L1Q D;  4O45 A;  3K27 A;  2CN3 A;  4PSX B;  5FXY A;  2CN2 A;  2HJ4 A;  4K3I D;  3C5M A;  1B9Y A;  2XL2 A;  2G99 A;  3OTT A;  2H9M A;  4XYH A;  4JSX C;  5GXH A;  4H5I A;  4GZ8 A;  5FLX g;  5EM2 B;  3CFV A;  5EMJ B;  2CO0 C;  4LGN A;  3IJ1 A;  4JD2 C;  2P9U C;  2P9L C;  4YVD A;  3KRX B;  5EMM B;  3GFC A;  3PXW D;  3DM0 A;  4G56 B;  4XYI A;  2PM6 B;  3K26 A;  2AGY A;  4A0A B;  4PBZ A;  2P9K C;  3CIK B;  3SVW D;  3UVL A;  2P9P C;  4ES0 A;  1XIP A;  1K32 A;  4A09 B;  2HES X;  3AL8 A;  5FKT A;  5HE1 B;  3SWS D;  1R5M A;  2OJY A;  4OZU A;  3RMZ D;  3C75 H;  5EAL A;  1JOF A;  3UR4 A;  4J79 A;  2GC7 A;  2H3X A;  4JXM A;  4NSX A;  2I3S A;  2OVR B;  3UVN A;  3I7N A;  2I0S A;  3EU7 A;  4QQE A;  4R7A B;  2I0T A;  3C99 A;  3AH8 B;  3IIY A;  4A0B B;  3MKQ A;  2YNP A;  3SMR A;  4X61 B;  3OKT A;  5EM2 A;  4J8B A;  4N14 A;  1GOT B;  1PI6 A;  4CZX A;  5TEF A;  2AH1 A;  3HFQ A;  1PGU A;  1GG2 B;  5EML B;  2OK4 A;  3JZN A;  4Y5R D;  4LG8 A;  4PBY A;  1JJU B;  3NVX A;  5EAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...