2IUQA

Crystal structure of dithionite-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis in complex with tryptamine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 98
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2iuqA01
2AGWA 4X3EA 1JJUB 3HFQA 4XYHA 5EARA 3C99A 3BG0A 4BUJC 4GGDA 4QL1A 4J77A 4A08B 2P9LC 2AGXA 3JRPA 2YNOA 3DXMC 3ODTA 2H47A 3IIYA 4J84A 1TBGA 3F3FA 5JWZA 4ES0A 4JXMA 4YVDA 3SBRA 1MDAH 3PXWD 1OLZA 4PSWB 5EMLB 5KDOB 2CO0C 3IJ1A 1JOFA 4EWRA 4CZYA 3PE7A 5CXCA 3BWSA 4ZOXA 4A09B 4ZOVA 1B9XA 4PBYA 4N14A 4IMMA 3SJLD 2XL3A 4GQ2P 3PVWB 4J78A 4NSXA 4ZOZA 2P9KC 5EMKB 3MXXA 5C9ZB 2YB8B 3I7LA 5IJ7E 5H17A 4GQ1A 2Q7QA 3UVKA 5HE2B 4L3HD 4UI9R 3UVLA 3CIKB 1VYHC 1SQJA 2P9UC 4PXWA 1U2VC 5EM2A 3N0EA 2PM9B 4OWRA 2HJ4A 2OVQB 3FGBA 2I0SA 3SMRA 5B4WA 5EAMA 4FA5D 5AJAA 5CYKA 1S4UX 5TDHB 4QT8A 5A2Qg 2HYEA 2I0RA 3RLMD 3EI1B 3UVNA 4A2LA 3SHFA 4JSNC 5TEFA 5IGQA 4BL0A 3JAMg 2PM6B 4J0WA 2HJBA 3EI4B 3JZGA 3NVNA 2O9KA 4A0AA 3OL2A 2H3XA 2P9PC 4O1QD 3EI2B 4H5IA 1A0RB 1JMXB 3DWLC 4LG9A 4IA9A 3RRMC 4E54A 3I2NA 3SCYA 5I5MA 3IJ0A 4CI2A 4JSPC 4A0BB 4QRJA 2H9LA 4FWWA 1Q47A 3AFCA 3MZKA 3SFZA 1SHYB 2HKRA 2XYIA 3V7DB 2I3TA 2P9SC 4L3GD 5FLXg 4JSVC 3UKUC 3EI3A 4U1EI 3RFHA 3SBQA 5GMKn 2QXVA 1B9YA 3RMZD 2G99A 3ORVD 4A7JA 4ZN4A 4G56B 2H14A 5HE0B 4A2MA 3PSCB 2CO0A 2AGZA 4FHLA 4CZXA 1NEXB 3UKRC 4J0XA 4J73A 4CI1A 4LGNA 2CNXA 1TYQC 1R5MA 4E5ZA 3CFVA 3RFGA 4A08A 3MMYA 4J8BA 4CI8A 2YBAA 4XEIC 5GSAA 4CI3A 4FA1D 3KRWB 2AGLA 2MTAH 5CXBB 3F3PA 4X63B 4D0KA 2OIZA 1MG3A 3OTTA 4FA4D 2IUQA 5FXYA 3JB9L 5GXIA 3RN1D 1FWXA 2H6NA 2W18A 5SXMA 4A09A 5EALA 1N6EA 1K8KC 3N0DA 4J86A 4LG8A 2PM7B 4J82A 4GM8A 4D6VA 4JD2C 3AL8A 2I3SA 2IURA 2HKMA 4GGAA 1U4CA 3L4MD 5CXCB 1PBYB 3IJCA 2CN3A 4PC0A 4FB1D 2Z2PA 4MK0B 2PM9A 3RSEC 2YMUA 2IAAA 5FA5B 3ULEC 5I5IA 2Z2OA 4A11A 3SN6B 2H9MA 4PSXB 3J81g 3EI1A 4J8GA 5FKRA 2XU7A 3EMHA 4PBZA 5TF2A 3FM0A 2OVPB 2H9PA 4ERQA 4FAND 5EM2B 2OK6A 4GGCA 1SQ9A 3OKYA 5I5JA 5CYKB 2QC5A 4L9OA 3L4OD 2UZYB 3RN0D 4A0BA 4TZ4A 3DSMA 4QQEA 2B5MA 4Y7RA 3OL2B 1K32A 4CY1A 4FAVD 2CE9A 1GXRA 3VGZA 2HESX 3SLED 4HDJA 2G9AA 1ERJA 2AH1A 5EAPA 3IKOA 3NVQA 4JT6C 5C2WB 4GMBA 5IGOA 3UVMA 3PXSD 3CFSB 4KFMB 3V5WB 2YNPA 4CY5A 4L1QD 1PI6A 2GNQA 2B5NA 3JPXA 3MKQA 4PNKB 4OZUA 3E0CA 3DXKC 2XL2A 5C2VB 2AQ5A 2B4EA 4X60B 3C9CA 1JMZB 3BG1A 3KRXB 2HXCA 2OVRB 4GZ8A 2UZXB 2Z2NA 4AEZA 3JZNA 1OMWB 3A0FA 5HQGA 1L0QA 2OK4A 4E5ZB 2H68A 3GFCA 3I89A 5AMSA 4J81A 4AOWA 2TRCB 3PVUB 3I7NA 4O3UB 4ERZA 2P9IC 1XKSA 3ZWLB 4Y5RD 5GXHA 3PXTD 4CC9A 2AH0A 5K19A 3JROA 3W15A 2EBSA 3AH8B 2B5LA 3AL8B 4FA9D 3PSLA 4XYIA 5HE1B 3OKWA 2J55H 1QNIA 3MKSB 5H1MA 4JT5C 5THAA 3SBPA 4CY3A 3I7HA 4J87A 3VH0A 3I7KA 5FKTA 3EI4A 4X61B 3C5MA 5FQDA 1XIPA 3V9FA 5HYNB 1XHMA 3B7FA 2IWFA 2IWKA 3EWEA 4J79A 3EI2A 3OW8A 2GC4A 2J56H 4R7AB 1RI6A 5IC7A 4A11B 3GREA 2PBIB 5K1CC 3K27A 5FKSA 3SXTD 3J80g 5HE3B 3C75H 2P9NC 2BBKH 3IIWA 3I7OA 3EG6A 4ZOYA 4K3ID 4GM9A 4A0AB 3NVXA 4O45A 4O9DA 3OKYB 4GM3A 2J57G 5EMJB 2H6QA 4ERYA 5IT9g 3I8CA 4H5JA 3UR4A 4I79A 1P22A 2BCJB 2CN2A 3DM0A 3MZLA 3UVOA 5AFU3 4E54B 1N6DA 1GP2B 3F3GA 4O3TB 4K3JB 4CY2A 4U7AA 1GG2B 1YFQA 2AGYA 3SWSD 3K26A 4ESGA 4Z8LA 3I8EA 4CZVA 3P4FA 4BH6A 2YNNA 3I7PA 1GOTB 5EMMB 5TEEA 1NR0A 2I0TA 2IUVA 4JSXC 5IJ8E 3EU7A 3EI3B 2IUPA 1PGUA 3FRXA 3JZHA 2H9NA 1N6FA 2H13A 1MG2A 3VA6A 1PEVA 5FKQA 2GC7A 2H6KA 2OJYA 4GQBB 2CE8A 3U4YA 3SVWD 5CXBA 3AL9A 5H14A 3OKTA
chains in the Genus database with same CATH superfamily
2AGWA 4AMYA 4X3EA 1JJUB 3HFQA 4XYHA 5EARA 3C99A 3BG0A 4BUJC 4GGDA 4QL1A 1H2WA 4J77A 3GD1I 4A08B 1L5GA 2P9LC 4G1EA 2AGXA 3JRPA 2YNOA 3EQ9A 3DXMC 2EIEA 2H47A 3ODTA 4BCCA 3IIYA 3IULA 4J84A 5HDBA 1TBGA 3F3FA 5JWZA 4ES0A 4JXMA 4Z7QA 4YVDA 3SBRA 1MDAH 3PXWD 1UOQA 2EICA 1OLZA 4PSWB 5EMLB 5KDOB 2CO0C 3IJ1A 2HU7A 5E6SA 1JOFA 4EWRA 4CZYA 3PE7A 1VE6A 3BWSA 5CXCA 4ZOXA 4A09B 4ZOVA 1B9XA 4PBYA 1H2YA 4N14A 4IMMA 3SJLD 2XL3A 3NIGA 4GQ2P 3PVWB 4J78A 4NSXA 4ZOZA 2P9KC 5EMKB 5M5TA 4BCDA 3MXXA 5C9ZB 2YB8B 3I7LA 5IJ7E 5H17A 4GQ1A 5FFGA 3K6SA 2Q7QA 3UVKA 1K3IA 5HE2B 4L3HD 4UI9R 3UVLA 3CIKB 1VYHC 1SQJA 1VE7A 2P9UC 4PXWA 1U2VC 5EM2A 3N0EA 2PM9B 2HJ4A 4OWRA 2OVQB 5C92A 3FGBA 2I0SA 5M5UA 3SMRA 5B4WA 5EAMA 4RE6A 5C86A 4FA5D 5AJAA 5CYKA 1S4UX 5TDHB 4QT8A 5A2Qg 3O4JA 2HYEA 2I0RA 3RLMD 4UM8A 2EIBA 3EI1B 3UVNA 4A2LA 3SHFA 4JSNC 3K71A 1UOPA 5TEFA 4BL0A 4DNVA 5IGQA 5M5RA 3JAMg 2PM6B 4J0WA 2HJBA 3EI4B 3JZGA 3NVNA 2O9KA 4A0AA 3OL2A 4BP8A 4MMXA 2H3XA 2P9PC 4O1QD 3EI2B 4H5IA 1A0RB 3GC3B 1JMXB 3DWLC 4LG9A 4IA9A 2VDOA 3RRMC 4E54A 3I2NA 2JKXA 3SCYA 5I5MA 3IJ0A 4CI2A 3FCUA 4JSPC 4A0BB 4QRJA 3IJEA 4RE5A 2H9LA 3MVDK 4FWWA 1Q47A 3AFCA 2HU5A 3MZKA 3SFZA 1SHYB 2HKRA 4BCBA 3NIFA 1C9LA 1VZ3A 4MMYA 2XYIA 3QHYB 3V7DB 2I3TA 2P9SC 4L3GD 5FLXg 4JSVC 1GOHA 3UKUC 3EI3A 2VDPA 4NC4A 4U1EI 3RFHA 2QXVA 4G55A 1B9YA 3SBQA 3V4VA 4D9SA 5GMKn 3RMZD 2G99A 3ORVD 4A7JA 4ZN4A 4G56B 2H14A 5HE0B 1E8MA 3PSCB 4A2MA 2CO0A 2AGZA 4FHLA 1YR2A 4CZXA 1NEXB 3UKRC 3O4HA 4J0XA 4J73A 4CI1A 4LGNA 2CNXA 1TYQC 1R5MA 4E5ZA 3CFVA 3RFGA 4A08A 3MMYA 4J8BA 3KCIA 4WK2A 2YBAA 4XEIC 4CI8A 3O4IA 2HU8A 3EQ8A 5GSAA 3MUOA 4CI3A 4FA1D 3KRWB 2AGLA 2MTAH 5CXBB 5M61A 3F3PA 4X63B 3T3MA 2VDRA 2OIZA 4D0KA 1MG3A 3OTTA 4FA4D 2VDNA 2IUQA 5FXYA 3JB9L 5GXIA 3RN1D 4NENA 1FWXA 2H6NA 2W18A 5SXMA 4A09A 5EALA 1N6EA 1K8KC 3N0DA 4J86A 4LG8A 3MUNA 2PM7B 4J82A 2XDWA 2WQ8A 4WK4A 4O02A 4DNWA 4GM8A 4D6VA 4JD2C 3AL8A 1JTDB 2I3SA 2VZ3A 1E8NA 2IURA 4NBMA 2HKMA 4GGAA 1UTCA 1U4CA 1U8CA 3L4MD 5CXCB 4AN1A 1PBYB 3DDUA 4AMZA 3IJCA 3IUMA 2CN3A 4PC0A 4FB1D 2Z2PA 4MK0B 2PM9A 3RSEC 2YMUA 2IAAA 4JHPC 5FA5B 3ZDXA 1BPOA 3ULEC 5I5IA 2Z2OA 1JV2A 4A11A 3SN6B 2H9MA 4PSXB 3J81g 3EI1A 3K72A 4J8GA 1H2ZA 3V4PA 5FKRA 2XU7A 3EMHA 4PBZA 5TF2A 3FM0A 2OVPB 2EIDA 2H9PA 4ERQA 4FAND 5EM2B 2OK6A 4GGCA 1SQ9A 3EQ7A 3OKYA 5I5JA 5CYKB 1C9IA 3IUNA 2QC5A 4L9OA 1TYEA 1O6GA 3L4OD 2UZYB 3RN0D 4A0BA 4TZ4A 3DSMA 4QQEA 3ZE2A 2B5MA 4L1MA 3FCSA 4Y7RA 3OL2B 1K32A 4CY1A 1GOFA 4WJKA 4FAVD 2CE9A 1GXRA 1GOGA 3VGZA 2HESX 3ZE1A 3SLED 3QI0A 4HDJA 5M5SA 2G9AA 1ERJA 2AH1A 5EAPA 3IKOA 3NVQA 4JT6C 2VC2A 1I2MB 5C2WB 4GMBA 2XZGA 5IGOA 3UVMA 3PXSD 3CFSB 4KFMB 4NAAA 2YNPA 3V5WB 4CY5A 4L1QD 1PI6A 2GNQA 2XE4A 2B5NA 3JPXA 3MKQA 3ZDZA 4PNKB 4DNUA 4OZUA 3E0CA 3DXKC 2XL2A 4Z7OA 5C2VB 2AQ5A 2B4EA 4X60B 4AX4A 2VDKA 3C9CA 1JMZB 1O6FA 3BG1A 3KRXB 2HXCA 2OVRB 4GZ8A 2UZXB 2Z2NA 4AEZA 3JZNA 4UM9A 2VDLA 1OMWB 3A0FA 5HQGA 5E6RA 4IRZA 1L0QA 2OK4A 3IUJA 2VDMA 4E5ZB 1QFSA 2H68A 3GFCA 3I89A 5AMSA 1A12A 4J81A 4AOWA 2TRCB 3PVUB 3I7NA 4O3UB 4ERZA 2P9IC 1XKSA 3ZWLB 3IURA 4Y5RD 1M1XA 5GXHA 3PXTD 4CC9A 1H2XA 2AH0A 4O2WA 5K19A 3JROA 3W15A 3NIDA 2EBSA 3AH8B 2B5LA 4G1MA 3AL8B 4FA9D 3PSLA 4XYIA 5HE1B 3OKWA 2J55H 1QNIA 3MKSB 5H1MA 2QZPA 4JT5C 5THAA 3SBPA 4CY3A 3I7HA 4J87A 3VH0A 4JHNA 3I7KA 5FKTA 3EI4A 4X61B 3C5MA 5FQDA 1XIPA 4BP9A 3V9FA 5HYNB 1XHMA 3B7FA 2IWFA 2IWKA 4QAMA 2BKLA 3EWEA 4J79A 3EI2A 3OW8A 2GC4A 2J56H 4R7AB 1RI6A 5IC7A 4A11B 3GREA 2PBIB 5K1CC 3K27A 5FKSA 3SXTD 3J80g 5HE3B 3C75H 2P9NC 2BBKH 3VI3A 3IIWA 2QR5A 3I7OA 3EG6A 4ZOYA 1UOOA 4K3ID 4GM9A 4A0AB 3NVXA 4O45A 4GM3A 3OKYB 4O9DA 2J57G 5EMJB 2H6QA 4ERYA 5IT9g 3I8CA 4H5JA 3UR4A 4I79A 3OF7A 1P22A 2BCJB 2CN2A 3DM0A 3MZLA 3UVOA 5AFU3 5FFOA 3IVMA 4E54B 4Z7NA 1N6DA 1QFMA 1GP2B 3VI4A 3F3GA 4O3TB 4K3JB 3IUQA 4CY2A 3O4GA 4U7AA 1GG2B 3T3PA 1YFQA 2AGYA 3ZDYA 3SWSD 2VZ1A 4MMZA 3K26A 4ESGA 4Z8LA 3I8EA 4CZVA 2VDQA 5E6UA 3P4FA 4BH6A 4AN0A 2YNNA 3I7PA 1GOTB 5EMMB 5TEEA 1NR0A 2I0TA 2IUVA 4JSXC 5IJ8E 3EU7A 3EI3B 2IUPA 1PGUA 3FRXA 3JZHA 2H9NA 1VZ2A 1E5TA 1N6FA 2H13A 1MG2A 3VA6A 1PEVA 5FKQA 2GC7A 2H6KA 2OJYA 4WK0A 1T2XA 4GQBB 2CE8A 3ZE0A 5M5VA 3U4YA 3SVWD 5CXBA 3AL9A 5H14A 3OKTA
chains in the Genus database with same CATH topology
2AGWA 4X3EA 1JJUB 3HFQA 4XYHA 5EARA 3C99A 3BG0A 4BUJC 4GGDA 4QL1A 4J77A 4A08B 2P9LC 2AGXA 3JRPA 2YNOA 3DXMC 3ODTA 2H47A 3IIYA 4J84A 1TBGA 3F3FA 5JWZA 4ES0A 4JXMA 4YVDA 3SBRA 1MDAH 3PXWD 1OLZA 4PSWB 5EMLB 5KDOB 2CO0C 3IJ1A 1JOFA 4EWRA 4CZYA 3PE7A 5CXCA 3BWSA 4ZOXA 4A09B 4ZOVA 1B9XA 4PBYA 4N14A 4IMMA 3SJLD 2XL3A 4GQ2P 3PVWB 4J78A 4NSXA 4ZOZA 2P9KC 5EMKB 3MXXA 5C9ZB 2YB8B 3I7LA 5IJ7E 5H17A 4GQ1A 2Q7QA 3UVKA 5HE2B 4L3HD 4UI9R 3UVLA 3CIKB 1VYHC 1SQJA 2P9UC 4PXWA 1U2VC 5EM2A 3N0EA 2PM9B 4OWRA 2HJ4A 2OVQB 3FGBA 2I0SA 3SMRA 5B4WA 5EAMA 4FA5D 5AJAA 5CYKA 1S4UX 5TDHB 4QT8A 5A2Qg 2HYEA 2I0RA 3RLMD 3EI1B 3UVNA 4A2LA 3SHFA 4JSNC 5TEFA 5IGQA 4BL0A 3JAMg 2PM6B 4J0WA 2HJBA 3EI4B 3JZGA 3NVNA 2O9KA 4A0AA 3OL2A 2H3XA 2P9PC 4O1QD 3EI2B 4H5IA 1A0RB 1JMXB 3DWLC 4LG9A 4IA9A 3RRMC 4E54A 3I2NA 3SCYA 5I5MA 3IJ0A 4CI2A 4JSPC 4A0BB 4QRJA 2H9LA 4FWWA 1Q47A 3AFCA 3MZKA 3SFZA 1SHYB 2HKRA 2XYIA 3V7DB 2I3TA 2P9SC 4L3GD 5FLXg 4JSVC 3UKUC 3EI3A 4U1EI 3RFHA 3SBQA 5GMKn 2QXVA 1B9YA 3RMZD 2G99A 3ORVD 4A7JA 4ZN4A 4G56B 2H14A 5HE0B 4A2MA 3PSCB 2CO0A 2AGZA 4FHLA 4CZXA 1NEXB 3UKRC 4J0XA 4J73A 4CI1A 4LGNA 2CNXA 1TYQC 1R5MA 4E5ZA 3CFVA 3RFGA 4A08A 3MMYA 4J8BA 4CI8A 2YBAA 4XEIC 5GSAA 4CI3A 4FA1D 3KRWB 2AGLA 2MTAH 5CXBB 3F3PA 4X63B 4D0KA 2OIZA 1MG3A 3OTTA 4FA4D 2IUQA 5FXYA 3JB9L 5GXIA 3RN1D 1FWXA 2H6NA 2W18A 5SXMA 4A09A 5EALA 1N6EA 1K8KC 3N0DA 4J86A 4LG8A 2PM7B 4J82A 4GM8A 4D6VA 4JD2C 3AL8A 2I3SA 2IURA 2HKMA 4GGAA 1U4CA 3L4MD 5CXCB 1PBYB 3IJCA 2CN3A 4PC0A 4FB1D 2Z2PA 4MK0B 2PM9A 3RSEC 2YMUA 2IAAA 5FA5B 3ULEC 5I5IA 2Z2OA 4A11A 3SN6B 2H9MA 4PSXB 3J81g 3EI1A 4J8GA 5FKRA 2XU7A 3EMHA 4PBZA 5TF2A 3FM0A 2OVPB 2H9PA 4ERQA 4FAND 5EM2B 2OK6A 4GGCA 1SQ9A 3OKYA 5I5JA 5CYKB 2QC5A 4L9OA 3L4OD 2UZYB 3RN0D 4A0BA 4TZ4A 3DSMA 4QQEA 2B5MA 4Y7RA 3OL2B 1K32A 4CY1A 4FAVD 2CE9A 1GXRA 3VGZA 2HESX 3SLED 4HDJA 2G9AA 1ERJA 2AH1A 5EAPA 3IKOA 3NVQA 4JT6C 5C2WB 4GMBA 5IGOA 3UVMA 3PXSD 3CFSB 4KFMB 3V5WB 2YNPA 4CY5A 4L1QD 1PI6A 2GNQA 2B5NA 3JPXA 3MKQA 4PNKB 4OZUA 3E0CA 3DXKC 2XL2A 5C2VB 2AQ5A 2B4EA 4X60B 3C9CA 1JMZB 3BG1A 3KRXB 2HXCA 2OVRB 4GZ8A 2UZXB 2Z2NA 4AEZA 3JZNA 1OMWB 3A0FA 5HQGA 1L0QA 2OK4A 4E5ZB 2H68A 3GFCA 3I89A 5AMSA 4J81A 4AOWA 2TRCB 3PVUB 3I7NA 4O3UB 4ERZA 2P9IC 1XKSA 3ZWLB 4Y5RD 5GXHA 3PXTD 4CC9A 2AH0A 5K19A 3JROA 3W15A 2EBSA 3AH8B 2B5LA 3AL8B 4FA9D 3PSLA 4XYIA 5HE1B 3OKWA 2J55H 1QNIA 3MKSB 5H1MA 4JT5C 5THAA 3SBPA 4CY3A 3I7HA 4J87A 3VH0A 3I7KA 5FKTA 3EI4A 4X61B 3C5MA 5FQDA 1XIPA 3V9FA 5HYNB 1XHMA 3B7FA 2IWFA 2IWKA 3EWEA 4J79A 3EI2A 3OW8A 2GC4A 2J56H 4R7AB 1RI6A 5IC7A 4A11B 3GREA 2PBIB 5K1CC 3K27A 5FKSA 3SXTD 3J80g 5HE3B 3C75H 2P9NC 2BBKH 3IIWA 3I7OA 3EG6A 4ZOYA 4K3ID 4GM9A 4A0AB 3NVXA 4O45A 4O9DA 3OKYB 4GM3A 2J57G 5EMJB 2H6QA 4ERYA 5IT9g 3I8CA 4H5JA 3UR4A 4I79A 1P22A 2BCJB 2CN2A 3DM0A 3MZLA 3UVOA 5AFU3 4E54B 1N6DA 1GP2B 3F3GA 4O3TB 4K3JB 4CY2A 4U7AA 1GG2B 1YFQA 2AGYA 3SWSD 3K26A 4ESGA 4Z8LA 3I8EA 4CZVA 3P4FA 4BH6A 2YNNA 3I7PA 1GOTB 5EMMB 5TEEA 1NR0A 2I0TA 2IUVA 4JSXC 5IJ8E 3EU7A 3EI3B 2IUPA 1PGUA 3FRXA 3JZHA 2H9NA 1N6FA 2H13A 1MG2A 3VA6A 1PEVA 5FKQA 2GC7A 2H6KA 2OJYA 4GQBB 2CE8A 3U4YA 3SVWD 5CXBA 3AL9A 5H14A 3OKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGW A;  4X3E A;  1JJU B;  3HFQ A;  4XYH A;  5EAR A;  3C99 A;  3BG0 A;  4BUJ C;  4GGD A;  4QL1 A;  4J77 A;  4A08 B;  2P9L C;  2AGX A;  3JRP A;  2YNO A;  3DXM C;  3ODT A;  2H47 A;  3IIY A;  4J84 A;  1TBG A;  3F3F A;  5JWZ A;  4ES0 A;  4JXM A;  4YVD A;  3SBR A;  1MDA H;  3PXW D;  1OLZ A;  4PSW B;  5EML B;  5KDO B;  2CO0 C;  3IJ1 A;  1JOF A;  4EWR A;  4CZY A;  3PE7 A;  5CXC A;  3BWS A;  4ZOX A;  4A09 B;  4ZOV A;  1B9X A;  4PBY A;  4N14 A;  4IMM A;  3SJL D;  2XL3 A;  4GQ2 P;  3PVW B;  4J78 A;  4NSX A;  4ZOZ A;  2P9K C;  5EMK B;  3MXX A;  5C9Z B;  2YB8 B;  3I7L A;  5IJ7 E;  5H17 A;  4GQ1 A;  2Q7Q A;  3UVK A;  5HE2 B;  4L3H D;  4UI9 R;  3UVL A;  3CIK B;  1VYH C;  1SQJ A;  2P9U C;  4PXW A;  1U2V C;  5EM2 A;  3N0E A;  2PM9 B;  4OWR A;  2HJ4 A;  2OVQ B;  3FGB A;  2I0S A;  3SMR A;  5B4W A;  5EAM A;  4FA5 D;  5AJA A;  5CYK A;  1S4U X;  5TDH B;  4QT8 A;  5A2Q g;  2HYE A;  2I0R A;  3RLM D;  3EI1 B;  3UVN A;  4A2L A;  3SHF A;  4JSN C;  5TEF A;  5IGQ A;  4BL0 A;  3JAM g;  2PM6 B;  4J0W A;  2HJB A;  3EI4 B;  3JZG A;  3NVN A;  2O9K A;  4A0A A;  3OL2 A;  2H3X A;  2P9P C;  4O1Q D;  3EI2 B;  4H5I A;  1A0R B;  1JMX B;  3DWL C;  4LG9 A;  4IA9 A;  3RRM C;  4E54 A;  3I2N A;  3SCY A;  5I5M A;  3IJ0 A;  4CI2 A;  4JSP C;  4A0B B;  4QRJ A;  2H9L A;  4FWW A;  1Q47 A;  3AFC A;  3MZK A;  3SFZ A;  1SHY B;  2HKR A;  2XYI A;  3V7D B;  2I3T A;  2P9S C;  4L3G D;  5FLX g;  4JSV C;  3UKU C;  3EI3 A;  4U1E I;  3RFH A;  3SBQ A;  5GMK n;  2QXV A;  1B9Y A;  3RMZ D;  2G99 A;  3ORV D;  4A7J A;  4ZN4 A;  4G56 B;  2H14 A;  5HE0 B;  4A2M A;  3PSC B;  2CO0 A;  2AGZ A;  4FHL A;  4CZX A;  1NEX B;  3UKR C;  4J0X A;  4J73 A;  4CI1 A;  4LGN A;  2CNX A;  1TYQ C;  1R5M A;  4E5Z A;  3CFV A;  3RFG A;  4A08 A;  3MMY A;  4J8B A;  4CI8 A;  2YBA A;  4XEI C;  5GSA A;  4CI3 A;  4FA1 D;  3KRW B;  2AGL A;  2MTA H;  5CXB B;  3F3P A;  4X63 B;  4D0K A;  2OIZ A;  1MG3 A;  3OTT A;  4FA4 D;  2IUQ A;  5FXY A;  3JB9 L;  5GXI A;  3RN1 D;  1FWX A;  2H6N A;  2W18 A;  5SXM A;  4A09 A;  5EAL A;  1N6E A;  1K8K C;  3N0D A;  4J86 A;  4LG8 A;  2PM7 B;  4J82 A;  4GM8 A;  4D6V A;  4JD2 C;  3AL8 A;  2I3S A;  2IUR A;  2HKM A;  4GGA A;  1U4C A;  3L4M D;  5CXC B;  1PBY B;  3IJC A;  2CN3 A;  4PC0 A;  4FB1 D;  2Z2P A;  4MK0 B;  2PM9 A;  3RSE C;  2YMU A;  2IAA A;  5FA5 B;  3ULE C;  5I5I A;  2Z2O A;  4A11 A;  3SN6 B;  2H9M A;  4PSX B;  3J81 g;  3EI1 A;  4J8G A;  5FKR A;  2XU7 A;  3EMH A;  4PBZ A;  5TF2 A;  3FM0 A;  2OVP B;  2H9P A;  4ERQ A;  4FAN D;  5EM2 B;  2OK6 A;  4GGC A;  1SQ9 A;  3OKY A;  5I5J A;  5CYK B;  2QC5 A;  4L9O A;  3L4O D;  2UZY B;  3RN0 D;  4A0B A;  4TZ4 A;  3DSM A;  4QQE A;  2B5M A;  4Y7R A;  3OL2 B;  1K32 A;  4CY1 A;  4FAV D;  2CE9 A;  1GXR A;  3VGZ A;  2HES X;  3SLE D;  4HDJ A;  2G9A A;  1ERJ A;  2AH1 A;  5EAP A;  3IKO A;  3NVQ A;  4JT6 C;  5C2W B;  4GMB A;  5IGO A;  3UVM A;  3PXS D;  3CFS B;  4KFM B;  3V5W B;  2YNP A;  4CY5 A;  4L1Q D;  1PI6 A;  2GNQ A;  2B5N A;  3JPX A;  3MKQ A;  4PNK B;  4OZU A;  3E0C A;  3DXK C;  2XL2 A;  5C2V B;  2AQ5 A;  2B4E A;  4X60 B;  3C9C A;  1JMZ B;  3BG1 A;  3KRX B;  2HXC A;  2OVR B;  4GZ8 A;  2UZX B;  2Z2N A;  4AEZ A;  3JZN A;  1OMW B;  3A0F A;  5HQG A;  1L0Q A;  2OK4 A;  4E5Z B;  2H68 A;  3GFC A;  3I89 A;  5AMS A;  4J81 A;  4AOW A;  2TRC B;  3PVU B;  3I7N A;  4O3U B;  4ERZ A;  2P9I C;  1XKS A;  3ZWL B;  4Y5R D;  5GXH A;  3PXT D;  4CC9 A;  2AH0 A;  5K19 A;  3JRO A;  3W15 A;  2EBS A;  3AH8 B;  2B5L A;  3AL8 B;  4FA9 D;  3PSL A;  4XYI A;  5HE1 B;  3OKW A;  2J55 H;  1QNI A;  3MKS B;  5H1M A;  4JT5 C;  5THA A;  3SBP A;  4CY3 A;  3I7H A;  4J87 A;  3VH0 A;  3I7K A;  5FKT A;  3EI4 A;  4X61 B;  3C5M A;  5FQD A;  1XIP A;  3V9F A;  5HYN B;  1XHM A;  3B7F A;  2IWF A;  2IWK A;  3EWE A;  4J79 A;  3EI2 A;  3OW8 A;  2GC4 A;  2J56 H;  4R7A B;  1RI6 A;  5IC7 A;  4A11 B;  3GRE A;  2PBI B;  5K1C C;  3K27 A;  5FKS A;  3SXT D;  3J80 g;  5HE3 B;  3C75 H;  2P9N C;  2BBK H;  3IIW A;  3I7O A;  3EG6 A;  4ZOY A;  4K3I D;  4GM9 A;  4A0A B;  3NVX A;  4O45 A;  4O9D A;  3OKY B;  4GM3 A;  2J57 G;  5EMJ B;  2H6Q A;  4ERY A;  5IT9 g;  3I8C A;  4H5J A;  3UR4 A;  4I79 A;  1P22 A;  2BCJ B;  2CN2 A;  3DM0 A;  3MZL A;  3UVO A;  5AFU 3;  4E54 B;  1N6D A;  1GP2 B;  3F3G A;  4O3T B;  4K3J B;  4CY2 A;  4U7A A;  1GG2 B;  1YFQ A;  2AGY A;  3SWS D;  3K26 A;  4ESG A;  4Z8L A;  3I8E A;  4CZV A;  3P4F A;  4BH6 A;  2YNN A;  3I7P A;  1GOT B;  5EMM B;  5TEE A;  1NR0 A;  2I0T A;  2IUV A;  4JSX C;  5IJ8 E;  3EU7 A;  3EI3 B;  2IUP A;  1PGU A;  3FRX A;  3JZH A;  2H9N A;  1N6F A;  2H13 A;  1MG2 A;  3VA6 A;  1PEV A;  5FKQ A;  2GC7 A;  2H6K A;  2OJY A;  4GQB B;  2CE8 A;  3U4Y A;  3SVW D;  5CXB A;  3AL9 A;  5H14 A;  3OKT A; 
#chains in the Genus database with same CATH topology
 2AGW A;  4AMY A;  4X3E A;  1JJU B;  3HFQ A;  4XYH A;  5EAR A;  3C99 A;  3BG0 A;  4BUJ C;  4GGD A;  4QL1 A;  1H2W A;  4J77 A;  3GD1 I;  4A08 B;  1L5G A;  2P9L C;  4G1E A;  2AGX A;  3JRP A;  2YNO A;  3EQ9 A;  3DXM C;  2EIE A;  2H47 A;  3ODT A;  4BCC A;  3IIY A;  3IUL A;  4J84 A;  5HDB A;  1TBG A;  3F3F A;  5JWZ A;  4ES0 A;  4JXM A;  4Z7Q A;  4YVD A;  3SBR A;  1MDA H;  3PXW D;  1UOQ A;  2EIC A;  1OLZ A;  4PSW B;  5EML B;  5KDO B;  2CO0 C;  3IJ1 A;  2HU7 A;  5E6S A;  1JOF A;  4EWR A;  4CZY A;  3PE7 A;  1VE6 A;  3BWS A;  5CXC A;  4ZOX A;  4A09 B;  4ZOV A;  1B9X A;  4PBY A;  1H2Y A;  4N14 A;  4IMM A;  3SJL D;  2XL3 A;  3NIG A;  4GQ2 P;  3PVW B;  4J78 A;  4NSX A;  4ZOZ A;  2P9K C;  5EMK B;  5M5T A;  4BCD A;  3MXX A;  5C9Z B;  2YB8 B;  3I7L A;  5IJ7 E;  5H17 A;  4GQ1 A;  5FFG A;  3K6S A;  2Q7Q A;  3UVK A;  1K3I A;  5HE2 B;  4L3H D;  4UI9 R;  3UVL A;  3CIK B;  1VYH C;  1SQJ A;  1VE7 A;  2P9U C;  4PXW A;  1U2V C;  5EM2 A;  3N0E A;  2PM9 B;  2HJ4 A;  4OWR A;  2OVQ B;  5C92 A;  3FGB A;  2I0S A;  5M5U A;  3SMR A;  5B4W A;  5EAM A;  4RE6 A;  5C86 A;  4FA5 D;  5AJA A;  5CYK A;  1S4U X;  5TDH B;  4QT8 A;  5A2Q g;  3O4J A;  2HYE A;  2I0R A;  3RLM D;  4UM8 A;  2EIB A;  3EI1 B;  3UVN A;  4A2L A;  3SHF A;  4JSN C;  3K71 A;  1UOP A;  5TEF A;  4BL0 A;  4DNV A;  5IGQ A;  5M5R A;  3JAM g;  2PM6 B;  4J0W A;  2HJB A;  3EI4 B;  3JZG A;  3NVN A;  2O9K A;  4A0A A;  3OL2 A;  4BP8 A;  4MMX A;  2H3X A;  2P9P C;  4O1Q D;  3EI2 B;  4H5I A;  1A0R B;  3GC3 B;  1JMX B;  3DWL C;  4LG9 A;  4IA9 A;  2VDO A;  3RRM C;  4E54 A;  3I2N A;  2JKX A;  3SCY A;  5I5M A;  3IJ0 A;  4CI2 A;  3FCU A;  4JSP C;  4A0B B;  4QRJ A;  3IJE A;  4RE5 A;  2H9L A;  3MVD K;  4FWW A;  1Q47 A;  3AFC A;  2HU5 A;  3MZK A;  3SFZ A;  1SHY B;  2HKR A;  4BCB A;  3NIF A;  1C9L A;  1VZ3 A;  4MMY A;  2XYI A;  3QHY B;  3V7D B;  2I3T A;  2P9S C;  4L3G D;  5FLX g;  4JSV C;  1GOH A;  3UKU C;  3EI3 A;  2VDP A;  4NC4 A;  4U1E I;  3RFH A;  2QXV A;  4G55 A;  1B9Y A;  3SBQ A;  3V4V A;  4D9S A;  5GMK n;  3RMZ D;  2G99 A;  3ORV D;  4A7J A;  4ZN4 A;  4G56 B;  2H14 A;  5HE0 B;  1E8M A;  3PSC B;  4A2M A;  2CO0 A;  2AGZ A;  4FHL A;  1YR2 A;  4CZX A;  1NEX B;  3UKR C;  3O4H A;  4J0X A;  4J73 A;  4CI1 A;  4LGN A;  2CNX A;  1TYQ C;  1R5M A;  4E5Z A;  3CFV A;  3RFG A;  4A08 A;  3MMY A;  4J8B A;  3KCI A;  4WK2 A;  2YBA A;  4XEI C;  4CI8 A;  3O4I A;  2HU8 A;  3EQ8 A;  5GSA A;  3MUO A;  4CI3 A;  4FA1 D;  3KRW B;  2AGL A;  2MTA H;  5CXB B;  5M61 A;  3F3P A;  4X63 B;  3T3M A;  2VDR A;  2OIZ A;  4D0K A;  1MG3 A;  3OTT A;  4FA4 D;  2VDN A;  2IUQ A;  5FXY A;  3JB9 L;  5GXI A;  3RN1 D;  4NEN A;  1FWX A;  2H6N A;  2W18 A;  5SXM A;  4A09 A;  5EAL A;  1N6E A;  1K8K C;  3N0D A;  4J86 A;  4LG8 A;  3MUN A;  2PM7 B;  4J82 A;  2XDW A;  2WQ8 A;  4WK4 A;  4O02 A;  4DNW A;  4GM8 A;  4D6V A;  4JD2 C;  3AL8 A;  1JTD B;  2I3S A;  2VZ3 A;  1E8N A;  2IUR A;  4NBM A;  2HKM A;  4GGA A;  1UTC A;  1U4C A;  1U8C A;  3L4M D;  5CXC B;  4AN1 A;  1PBY B;  3DDU A;  4AMZ A;  3IJC A;  3IUM A;  2CN3 A;  4PC0 A;  4FB1 D;  2Z2P A;  4MK0 B;  2PM9 A;  3RSE C;  2YMU A;  2IAA A;  4JHP C;  5FA5 B;  3ZDX A;  1BPO A;  3ULE C;  5I5I A;  2Z2O A;  1JV2 A;  4A11 A;  3SN6 B;  2H9M A;  4PSX B;  3J81 g;  3EI1 A;  3K72 A;  4J8G A;  1H2Z A;  3V4P A;  5FKR A;  2XU7 A;  3EMH A;  4PBZ A;  5TF2 A;  3FM0 A;  2OVP B;  2EID A;  2H9P A;  4ERQ A;  4FAN D;  5EM2 B;  2OK6 A;  4GGC A;  1SQ9 A;  3EQ7 A;  3OKY A;  5I5J A;  5CYK B;  1C9I A;  3IUN A;  2QC5 A;  4L9O A;  1TYE A;  1O6G A;  3L4O D;  2UZY B;  3RN0 D;  4A0B A;  4TZ4 A;  3DSM A;  4QQE A;  3ZE2 A;  2B5M A;  4L1M A;  3FCS A;  4Y7R A;  3OL2 B;  1K32 A;  4CY1 A;  1GOF A;  4WJK A;  4FAV D;  2CE9 A;  1GXR A;  1GOG A;  3VGZ A;  2HES X;  3ZE1 A;  3SLE D;  3QI0 A;  4HDJ A;  5M5S A;  2G9A A;  1ERJ A;  2AH1 A;  5EAP A;  3IKO A;  3NVQ A;  4JT6 C;  2VC2 A;  1I2M B;  5C2W B;  4GMB A;  2XZG A;  5IGO A;  3UVM A;  3PXS D;  3CFS B;  4KFM B;  4NAA A;  2YNP A;  3V5W B;  4CY5 A;  4L1Q D;  1PI6 A;  2GNQ A;  2XE4 A;  2B5N A;  3JPX A;  3MKQ A;  3ZDZ A;  4PNK B;  4DNU A;  4OZU A;  3E0C A;  3DXK C;  2XL2 A;  4Z7O A;  5C2V B;  2AQ5 A;  2B4E A;  4X60 B;  4AX4 A;  2VDK A;  3C9C A;  1JMZ B;  1O6F A;  3BG1 A;  3KRX B;  2HXC A;  2OVR B;  4GZ8 A;  2UZX B;  2Z2N A;  4AEZ A;  3JZN A;  4UM9 A;  2VDL A;  1OMW B;  3A0F A;  5HQG A;  5E6R A;  4IRZ A;  1L0Q A;  2OK4 A;  3IUJ A;  2VDM A;  4E5Z B;  1QFS A;  2H68 A;  3GFC A;  3I89 A;  5AMS A;  1A12 A;  4J81 A;  4AOW A;  2TRC B;  3PVU B;  3I7N A;  4O3U B;  4ERZ A;  2P9I C;  1XKS A;  3ZWL B;  3IUR A;  4Y5R D;  1M1X A;  5GXH A;  3PXT D;  4CC9 A;  1H2X A;  2AH0 A;  4O2W A;  5K19 A;  3JRO A;  3W15 A;  3NID A;  2EBS A;  3AH8 B;  2B5L A;  4G1M A;  3AL8 B;  4FA9 D;  3PSL A;  4XYI A;  5HE1 B;  3OKW A;  2J55 H;  1QNI A;  3MKS B;  5H1M A;  2QZP A;  4JT5 C;  5THA A;  3SBP A;  4CY3 A;  3I7H A;  4J87 A;  3VH0 A;  4JHN A;  3I7K A;  5FKT A;  3EI4 A;  4X61 B;  3C5M A;  5FQD A;  1XIP A;  4BP9 A;  3V9F A;  5HYN B;  1XHM A;  3B7F A;  2IWF A;  2IWK A;  4QAM A;  2BKL A;  3EWE A;  4J79 A;  3EI2 A;  3OW8 A;  2GC4 A;  2J56 H;  4R7A B;  1RI6 A;  5IC7 A;  4A11 B;  3GRE A;  2PBI B;  5K1C C;  3K27 A;  5FKS A;  3SXT D;  3J80 g;  5HE3 B;  3C75 H;  2P9N C;  2BBK H;  3VI3 A;  3IIW A;  2QR5 A;  3I7O A;  3EG6 A;  4ZOY A;  1UOO A;  4K3I D;  4GM9 A;  4A0A B;  3NVX A;  4O45 A;  4GM3 A;  3OKY B;  4O9D A;  2J57 G;  5EMJ B;  2H6Q A;  4ERY A;  5IT9 g;  3I8C A;  4H5J A;  3UR4 A;  4I79 A;  3OF7 A;  1P22 A;  2BCJ B;  2CN2 A;  3DM0 A;  3MZL A;  3UVO A;  5AFU 3;  5FFO A;  3IVM A;  4E54 B;  4Z7N A;  1N6D A;  1QFM A;  1GP2 B;  3VI4 A;  3F3G A;  4O3T B;  4K3J B;  3IUQ A;  4CY2 A;  3O4G A;  4U7A A;  1GG2 B;  3T3P A;  1YFQ A;  2AGY A;  3ZDY A;  3SWS D;  2VZ1 A;  4MMZ A;  3K26 A;  4ESG A;  4Z8L A;  3I8E A;  4CZV A;  2VDQ A;  5E6U A;  3P4F A;  4BH6 A;  4AN0 A;  2YNN A;  3I7P A;  1GOT B;  5EMM B;  5TEE A;  1NR0 A;  2I0T A;  2IUV A;  4JSX C;  5IJ8 E;  3EU7 A;  3EI3 B;  2IUP A;  1PGU A;  3FRX A;  3JZH A;  2H9N A;  1VZ2 A;  1E5T A;  1N6F A;  2H13 A;  1MG2 A;  3VA6 A;  1PEV A;  5FKQ A;  2GC7 A;  2H6K A;  2OJY A;  4WK0 A;  1T2X A;  4GQB B;  2CE8 A;  3ZE0 A;  5M5V A;  3U4Y A;  3SVW D;  5CXB A;  3AL9 A;  5H14 A;  3OKT A; 
#chains in the Genus database with same CATH homology
 2AGW A;  4X3E A;  1JJU B;  3HFQ A;  4XYH A;  5EAR A;  3C99 A;  3BG0 A;  4BUJ C;  4GGD A;  4QL1 A;  4J77 A;  4A08 B;  2P9L C;  2AGX A;  3JRP A;  2YNO A;  3DXM C;  3ODT A;  2H47 A;  3IIY A;  4J84 A;  1TBG A;  3F3F A;  5JWZ A;  4ES0 A;  4JXM A;  4YVD A;  3SBR A;  1MDA H;  3PXW D;  1OLZ A;  4PSW B;  5EML B;  5KDO B;  2CO0 C;  3IJ1 A;  1JOF A;  4EWR A;  4CZY A;  3PE7 A;  5CXC A;  3BWS A;  4ZOX A;  4A09 B;  4ZOV A;  1B9X A;  4PBY A;  4N14 A;  4IMM A;  3SJL D;  2XL3 A;  4GQ2 P;  3PVW B;  4J78 A;  4NSX A;  4ZOZ A;  2P9K C;  5EMK B;  3MXX A;  5C9Z B;  2YB8 B;  3I7L A;  5IJ7 E;  5H17 A;  4GQ1 A;  2Q7Q A;  3UVK A;  5HE2 B;  4L3H D;  4UI9 R;  3UVL A;  3CIK B;  1VYH C;  1SQJ A;  2P9U C;  4PXW A;  1U2V C;  5EM2 A;  3N0E A;  2PM9 B;  4OWR A;  2HJ4 A;  2OVQ B;  3FGB A;  2I0S A;  3SMR A;  5B4W A;  5EAM A;  4FA5 D;  5AJA A;  5CYK A;  1S4U X;  5TDH B;  4QT8 A;  5A2Q g;  2HYE A;  2I0R A;  3RLM D;  3EI1 B;  3UVN A;  4A2L A;  3SHF A;  4JSN C;  5TEF A;  5IGQ A;  4BL0 A;  3JAM g;  2PM6 B;  4J0W A;  2HJB A;  3EI4 B;  3JZG A;  3NVN A;  2O9K A;  4A0A A;  3OL2 A;  2H3X A;  2P9P C;  4O1Q D;  3EI2 B;  4H5I A;  1A0R B;  1JMX B;  3DWL C;  4LG9 A;  4IA9 A;  3RRM C;  4E54 A;  3I2N A;  3SCY A;  5I5M A;  3IJ0 A;  4CI2 A;  4JSP C;  4A0B B;  4QRJ A;  2H9L A;  4FWW A;  1Q47 A;  3AFC A;  3MZK A;  3SFZ A;  1SHY B;  2HKR A;  2XYI A;  3V7D B;  2I3T A;  2P9S C;  4L3G D;  5FLX g;  4JSV C;  3UKU C;  3EI3 A;  4U1E I;  3RFH A;  3SBQ A;  5GMK n;  2QXV A;  1B9Y A;  3RMZ D;  2G99 A;  3ORV D;  4A7J A;  4ZN4 A;  4G56 B;  2H14 A;  5HE0 B;  4A2M A;  3PSC B;  2CO0 A;  2AGZ A;  4FHL A;  4CZX A;  1NEX B;  3UKR C;  4J0X A;  4J73 A;  4CI1 A;  4LGN A;  2CNX A;  1TYQ C;  1R5M A;  4E5Z A;  3CFV A;  3RFG A;  4A08 A;  3MMY A;  4J8B A;  4CI8 A;  2YBA A;  4XEI C;  5GSA A;  4CI3 A;  4FA1 D;  3KRW B;  2AGL A;  2MTA H;  5CXB B;  3F3P A;  4X63 B;  4D0K A;  2OIZ A;  1MG3 A;  3OTT A;  4FA4 D;  2IUQ A;  5FXY A;  3JB9 L;  5GXI A;  3RN1 D;  1FWX A;  2H6N A;  2W18 A;  5SXM A;  4A09 A;  5EAL A;  1N6E A;  1K8K C;  3N0D A;  4J86 A;  4LG8 A;  2PM7 B;  4J82 A;  4GM8 A;  4D6V A;  4JD2 C;  3AL8 A;  2I3S A;  2IUR A;  2HKM A;  4GGA A;  1U4C A;  3L4M D;  5CXC B;  1PBY B;  3IJC A;  2CN3 A;  4PC0 A;  4FB1 D;  2Z2P A;  4MK0 B;  2PM9 A;  3RSE C;  2YMU A;  2IAA A;  5FA5 B;  3ULE C;  5I5I A;  2Z2O A;  4A11 A;  3SN6 B;  2H9M A;  4PSX B;  3J81 g;  3EI1 A;  4J8G A;  5FKR A;  2XU7 A;  3EMH A;  4PBZ A;  5TF2 A;  3FM0 A;  2OVP B;  2H9P A;  4ERQ A;  4FAN D;  5EM2 B;  2OK6 A;  4GGC A;  1SQ9 A;  3OKY A;  5I5J A;  5CYK B;  2QC5 A;  4L9O A;  3L4O D;  2UZY B;  3RN0 D;  4A0B A;  4TZ4 A;  3DSM A;  4QQE A;  2B5M A;  4Y7R A;  3OL2 B;  1K32 A;  4CY1 A;  4FAV D;  2CE9 A;  1GXR A;  3VGZ A;  2HES X;  3SLE D;  4HDJ A;  2G9A A;  1ERJ A;  2AH1 A;  5EAP A;  3IKO A;  3NVQ A;  4JT6 C;  5C2W B;  4GMB A;  5IGO A;  3UVM A;  3PXS D;  3CFS B;  4KFM B;  3V5W B;  2YNP A;  4CY5 A;  4L1Q D;  1PI6 A;  2GNQ A;  2B5N A;  3JPX A;  3MKQ A;  4PNK B;  4OZU A;  3E0C A;  3DXK C;  2XL2 A;  5C2V B;  2AQ5 A;  2B4E A;  4X60 B;  3C9C A;  1JMZ B;  3BG1 A;  3KRX B;  2HXC A;  2OVR B;  4GZ8 A;  2UZX B;  2Z2N A;  4AEZ A;  3JZN A;  1OMW B;  3A0F A;  5HQG A;  1L0Q A;  2OK4 A;  4E5Z B;  2H68 A;  3GFC A;  3I89 A;  5AMS A;  4J81 A;  4AOW A;  2TRC B;  3PVU B;  3I7N A;  4O3U B;  4ERZ A;  2P9I C;  1XKS A;  3ZWL B;  4Y5R D;  5GXH A;  3PXT D;  4CC9 A;  2AH0 A;  5K19 A;  3JRO A;  3W15 A;  2EBS A;  3AH8 B;  2B5L A;  3AL8 B;  4FA9 D;  3PSL A;  4XYI A;  5HE1 B;  3OKW A;  2J55 H;  1QNI A;  3MKS B;  5H1M A;  4JT5 C;  5THA A;  3SBP A;  4CY3 A;  3I7H A;  4J87 A;  3VH0 A;  3I7K A;  5FKT A;  3EI4 A;  4X61 B;  3C5M A;  5FQD A;  1XIP A;  3V9F A;  5HYN B;  1XHM A;  3B7F A;  2IWF A;  2IWK A;  3EWE A;  4J79 A;  3EI2 A;  3OW8 A;  2GC4 A;  2J56 H;  4R7A B;  1RI6 A;  5IC7 A;  4A11 B;  3GRE A;  2PBI B;  5K1C C;  3K27 A;  5FKS A;  3SXT D;  3J80 g;  5HE3 B;  3C75 H;  2P9N C;  2BBK H;  3IIW A;  3I7O A;  3EG6 A;  4ZOY A;  4K3I D;  4GM9 A;  4A0A B;  3NVX A;  4O45 A;  4O9D A;  3OKY B;  4GM3 A;  2J57 G;  5EMJ B;  2H6Q A;  4ERY A;  5IT9 g;  3I8C A;  4H5J A;  3UR4 A;  4I79 A;  1P22 A;  2BCJ B;  2CN2 A;  3DM0 A;  3MZL A;  3UVO A;  5AFU 3;  4E54 B;  1N6D A;  1GP2 B;  3F3G A;  4O3T B;  4K3J B;  4CY2 A;  4U7A A;  1GG2 B;  1YFQ A;  2AGY A;  3SWS D;  3K26 A;  4ESG A;  4Z8L A;  3I8E A;  4CZV A;  3P4F A;  4BH6 A;  2YNN A;  3I7P A;  1GOT B;  5EMM B;  5TEE A;  1NR0 A;  2I0T A;  2IUV A;  4JSX C;  5IJ8 E;  3EU7 A;  3EI3 B;  2IUP A;  1PGU A;  3FRX A;  3JZH A;  2H9N A;  1N6F A;  2H13 A;  1MG2 A;  3VA6 A;  1PEV A;  5FKQ A;  2GC7 A;  2H6K A;  2OJY A;  4GQB B;  2CE8 A;  3U4Y A;  3SVW D;  5CXB A;  3AL9 A;  5H14 A;  3OKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...