2IUQA

Crystal structure of dithionite-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis in complex with tryptamine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
total genus 98
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2iuqA01
4ERQA 4GQ2P 2W18A 4XYHA 4HDJA 4FHLA 3SN6B 2BCJB 3UVKA 3NVQA 3ORVD 1S4UX 2H6KA 3C9CA 2H3XA 3IIWA 5CXBB 5CXBA 3MKSB 4A11A 4CI1A 4OWRA 2J56H 3N0DA 4A0AA 3E0CA 3OKYB 3I2NA 3OKTA 5I5IA 2H47A 4JSXC 2HXCA 3KRXB 3PSLA 2HYEA 5HE0B 1U4CA 3RN0D 2P9PC 5EM2A 4L1QD 4E54B 4E54A 3JB9L 5C9ZB 5A2Qg 2GC7A 1OLZA 1Q47A 5K1CC 3A0FA 4O9DA 4H5IA 2EBSA 3EI4A 2PM9A 4JD2C 4JSVC 4J8BA 4U7AA 4ERZA 3SBRA 1MG2A 3I8EA 4XEIC 2UZXB 4GGDA 3I7OA 1MG3A 4GQBB 3RN1D 2J57G 4IA9A 5I5MA 1SQ9A 3I89A 1P22A 3SVWD 4LG9A 4BL0A 2QC5A 4XYIA 1PEVA 4LG8A 3JZGA 2P9NC 1XIPA 2CN3A 4IMMA 2YBAA 2AQ5A 3L4OD 5TEFA 1GG2B 3MMYA 2J55H 4A2MA 4KFMB 3AL8B 4PC0A 2CO0A 3AL8A 3GFCA 1FWXA 4A09B 4A09A 1K8KC 4N14A 2OJYA 4D6VA 2H6QA 1L0QA 4X63B 3AL9A 3IKOA 5HE2B 3ULEC 5CYKA 4MK0B 3PXTD 3EI1B 3EU7A 3MZKA 2HJ4A 3RFHA 2H6NA 2I3SA 5KDOB 3VH0A 4QQEA 4J86A 1XHMA 2IUVA 4A08B 2AGZA 5EAPA 4A08A 3EG6A 3RSEC 3EWEA 5C2WB 4ESGA 5EALA 2IURA 4I79A 3I8CA 3B7FA 4FA9D 5H17A 3IJ1A 4ZOZA 4CY1A 3I7NA 4A0BA 2B5LA 1ERJA 5CXCB 4J78A 4O3TB 4FA1D 1YFQA 3EI2A 3DXMC 3SXTD 4QL1A 5B4WA 2IAAA 3SLED 1OMWB 4PSWB 3L4MD 4Y7RA 3C99A 1N6EA 5GMKn 1U2VC 4QT8A 3IJCA 5IJ7E 3JZHA 3CIKB 1GOTB 4J82A 2Z2NA 2YNNA 3OW8A 5AJAA 2P9IC 2H9LA 2CE9A 4A11B 3BG0A 2H9MA 3OTTA 1N6DA 4FA5D 4A0AB 5TF2A 2TRCB 4J81A 4QRJA 3DWLC 4K3JB 3EI3A 3FGBA 5TEEA 3FM0A 4ZOXA 1XKSA 5EMKB 4JXMA 2GNQA 4TZ4A 5IJ8E 1K32A 3SMRA 2Q7QA 5EM2B 5TDHB 4FA4D 3OKWA 3JZNA 3I7KA 3PSCB 2AGWA 2AGYA 2P9SC 5EARA 2B5MA 5H1MA 3PXSD 1SQJA 3NVNA 4JSNC 2OVPB 3EI4B 2PM9B 4Z8LA 3SHFA 2XL2A 2CE8A 3GREA 4CI3A 2OK4A 4GM3A 3MZLA 4CI8A 3RLMD 3SWSD 1JJUB 4JT5C 5FQDA 1GP2B 3NVXA 3JPXA 3PXWD 2AH1A 3EMHA 4L9OA 3P4FA 3JROA 4CZVA 3V7DB 5THAA 5IGQA 4CY3A 5AFU3 3VA6A 5IC7A 5JWZA 5FXYA 2G9AA 2IWKA 2H9NA 3F3GA 4L3GD 4X60B 2HESX 5I5JA 3F3FA 3MKQA 4AOWA 4FAVD 2MTAH 5CYKB 3SJLD 4AEZA 4ZOYA 2OIZA 5HE1B 2AGLA 2IUPA 5GSAA 4CY5A 1JOFA 4ES0A 3UR4A 1N6FA 2P9LC 5FLXg 2YNOA 1SHYB 1TBGA 5EAMA 4PBZA 5K19A 1B9YA 4GGCA 4G56B 4GMBA 4JT6C 2OVQB 4LGNA 2PBIB 2XL3A 2IUQA 2GC4A 3SBQA 4A0BB 2Z2PA 2B5NA 3EI2B 4UI9R 2QXVA 4CC9A 3FRXA 3KRWB 4A7JA 4J79A 2H9PA 2AGXA 4PNKB 4K3ID 3PVWB 1NR0A 4GGAA 3W15A 2IWFA 3MXXA 3RFGA 3U4YA 3HFQA 2YMUA 3C5MA 4FB1D 2PM6B 4CZYA 3C75H 3PVUB 4FAND 3ODTA 4GM8A 5IT9g 4D0KA 3UVOA 3F3PA 4J87A 3J81g 5FKQA 5HQGA 2HJBA 2P9UC 2HKMA 3K27A 2H14A 3I7HA 3EI3B 2HKRA 3N0EA 3VGZA 4YVDA 3OL2B 3OL2A 3V9FA 4FWWA 4L3HD 2H13A 4J73A 4NSXA 2I0TA 3UKUC 5EMMB 3BWSA 3OKYA 1JMZB 1GXRA 2I3TA 3J80g 4X61B 5EMLB 3RRMC 3UVLA 2I0RA 4JSPC 3RMZD 3JRPA 5FKRA 5SXMA 3SCYA 4J77A 2OVRB 4O3UB 3PE7A 4BH6A 4E5ZB 3AH8B 2P9KC 4E5ZA 4O1QD 5IGOA 1NEXB 2XYIA 2BBKH 3K26A 4J0XA 1B9XA 1JMXB 4PSXB 4J8GA 1TYQC 2PM7B 2B4EA 2CO0C 1PBYB 4O45A 4U1EI 3DXKC 1R5MA 3CFSB 3ZWLB 4J84A 4ZN4A 5GXHA 2CN2A 3IIYA 2YNPA 4X3EA 4OZUA 1QNIA 5EMJB 4ERYA 4GZ8A 4BUJC 3I7PA 4PXWA 4CI2A 3BG1A 1MDAH 4EWRA 2OK6A 2H68A 4CY2A 4GQ1A 3DM0A 2AH0A 3IJ0A 5HE3B 2CNXA 2O9KA 3V5WB 5FKTA 4CZXA 3EI1A 4R7AB 3UVMA 4Y5RD 3DSMA 4ZOVA 4H5JA 5FA5B 4J0WA 3JAMg 1A0RB 5FKSA 2I0SA 2G99A 4PBYA 2UZYB 3CFVA 5GXIA 5AMSA 1VYHC 3UKRC 5C2VB 1RI6A 5H14A 3UVNA 4GM9A 3SBPA 2Z2OA 3SFZA 5CXCA 4A2LA 1PGUA 5HYNB 2XU7A 2YB8B 1PI6A 3AFCA 3I7LA
chains in the Genus database with same CATH superfamily
4ERQA 3EQ8A 4GQ2P 2W18A 4XYHA 1GOHA 4HDJA 4FHLA 3SN6B 2BCJB 3UVKA 2VDNA 3NVQA 3ORVD 1S4UX 2H6KA 1H2XA 3C9CA 2H3XA 3IIWA 5CXBB 5CXBA 3MKSB 4A11A 4CI1A 4OWRA 2VZ1A 2J56H 3N0DA 4A0AA 3E0CA 2QZPA 3I2NA 3OKYB 3OKTA 5I5IA 2VDPA 2H47A 4JSXC 2HXCA 3KRXB 3PSLA 2HYEA 1C9IA 5HE0B 1U4CA 3RN0D 3VI4A 1O6GA 2HU7A 4O2WA 2P9PC 5EM2A 4L1QD 5C92A 4E54B 4E54A 3JB9L 5C9ZB 4NC4A 4RE5A 5A2Qg 2GC7A 1OLZA 1Q47A 5K1CC 4Z7QA 3A0FA 4O9DA 4H5IA 2EBSA 3EI4A 2PM9A 4JD2C 4JSVC 4AX4A 4J8BA 3IVMA 4U7AA 4ERZA 3SBRA 1MG2A 3GC3B 3I8EA 4XEIC 2UZXB 4GGDA 3I7OA 1MG3A 4GQBB 3RN1D 2J57G 1I2MB 4IA9A 5I5MA 1SQ9A 3I89A 1P22A 3SVWD 4LG9A 4BL0A 2QC5A 4XYIA 1PEVA 4LG8A 3JZGA 3FCUA 2P9NC 1XIPA 2CN3A 4IMMA 2YBAA 2AQ5A 3L4OD 5TEFA 1GG2B 3MMYA 2J55H 4A2MA 4KFMB 3IULA 3AL8B 4NAAA 2CO0A 3AL8A 3IJEA 3GFCA 4PC0A 2VDMA 1FWXA 1U8CA 4A09B 4A09A 1K8KC 4N14A 2OJYA 4D6VA 2H6QA 1L0QA 4X63B 3V4VA 3AL9A 3IKOA 5HE2B 3ULEC 5CYKA 4MK0B 3PXTD 3EI1B 3EU7A 3K72A 3MZKA 4G1MA 2HJ4A 3RFHA 3ZDYA 2H6NA 2I3SA 4DNWA 5KDOB 4QQEA 3VH0A 3IURA 4JHPC 4UM9A 4J86A 1XHMA 2IUVA 4BCCA 2AGZA 5EAPA 4A08B 4A08A 3EG6A 3RSEC 3EWEA 3QHYB 5C2WB 3ZE2A 4ESGA 5EALA 2IURA 4I79A 3MUNA 3I8CA 1E8MA 4DNVA 3B7FA 4NENA 4FA9D 5H17A 3IJ1A 4ZOZA 4CY1A 3KCIA 3I7NA 4A0BA 2WQ8A 2B5LA 1ERJA 5CXCB 4J78A 4O3TB 4FA1D 5FFOA 1YFQA 3EI2A 1BPOA 3DXMC 4WK0A 3ZDZA 4BCDA 3SXTD 1YR2A 4QL1A 5B4WA 2IAAA 3SLED 1OMWB 4PSWB 3L4MD 4Y7RA 3C99A 4G55A 1N6EA 5M5VA 5GMKn 1U2VC 4QT8A 3IJCA 5IJ7E 3JZHA 3CIKB 3O4JA 1GOTB 2QR5A 4J82A 2Z2NA 3ZE0A 2YNNA 3OW8A 1A12A 2P9IC 5AJAA 2H9LA 1UOQA 5M5RA 2CE9A 2XDWA 4A11B 5M61A 3OF7A 3BG0A 2H9MA 3OTTA 1N6DA 4FA5D 4A0AB 5TF2A 2TRCB 1O6FA 4J81A 4QRJA 3DWLC 4K3JB 3EI3A 3FGBA 5TEEA 4Z7OA 3FM0A 4ZOXA 1XKSA 5EMKB 2BKLA 4JXMA 5M5UA 2GNQA 4TZ4A 5IJ8E 1K32A 3SMRA 4BP9A 2Q7QA 5EM2B 5TDHB 2VZ3A 4FA4D 3OKWA 3JZNA 1UOOA 3I7KA 3PSCB 2AGWA 2AGYA 2P9SC 5EARA 2B5MA 5H1MA 4AN1A 2VDRA 3PXSD 1SQJA 3NVNA 5E6SA 2OVPB 4JSNC 3EI4B 2EIDA 2PM9B 4Z8LA 4AMZA 3IUQA 3SHFA 2XL2A 2CE8A 2VDQA 3GREA 4CI3A 2EIBA 4UM8A 2OK4A 3NIFA 4GM3A 1VZ3A 3MZLA 4CI8A 3RLMD 3SWSD 1JJUB 4JT5C 2XZGA 5FQDA 1GP2B 3NVXA 3JPXA 3PXWD 2AH1A 3EMHA 4AN0A 1UOPA 4L9OA 3P4FA 3JROA 1QFSA 4WK4A 4WJKA 4CZVA 3MVDK 3V7DB 3IUMA 5THAA 5IGQA 5HDBA 4CY3A 5AFU3 3VA6A 5IC7A 5JWZA 5FXYA 2G9AA 3K71A 2IWKA 2H9NA 3F3GA 4L3GD 4X60B 2HESX 5I5JA 3F3FA 3MKQA 4AOWA 4AMYA 4FAVD 2MTAH 3GD1I 1E8NA 5CYKB 3SJLD 4AEZA 4ZOYA 2OIZA 5HE1B 2AGLA 2IUPA 4D9SA 5GSAA 4CY5A 1JOFA 4BP8A 1QFMA 1M1XA 4ES0A 3UR4A 1N6FA 1JV2A 2P9LC 3MUOA 4RE6A 5FLXg 2YNOA 1H2YA 1SHYB 1TBGA 5EAMA 4O02A 4PBZA 5K19A 1B9YA 2VC2A 4GGCA 4L1MA 4G56B 3ZE1A 2XE4A 4GMBA 4JT6C 2OVQB 4LGNA 1UTCA 2PBIB 2XL3A 5FFGA 2IUQA 2GC4A 3SBQA 4A0BB 2Z2PA 2B5NA 3K6SA 3EI2B 4UI9R 2QXVA 3O4IA 3FRXA 3KRWB 4CC9A 5C86A 4A7JA 4J79A 2H9PA 2AGXA 4PNKB 4K3ID 3PVWB 3T3PA 4MMZA 1NR0A 1H2ZA 4GGAA 3W15A 1K3IA 2IWFA 3MXXA 3RFGA 3U4YA 3HFQA 2YMUA 4MMXA 3T3MA 3C5MA 4FB1D 2PM6B 4CZYA 3C75H 3PVUB 2HU8A 4FAND 3ODTA 4GM8A 5IT9g 4D0KA 3UVOA 3F3PA 4J87A 3J81g 1JTDB 2VDLA 5FKQA 5HQGA 2HJBA 4MMYA 2P9UC 2HKMA 3K27A 2H14A 4QAMA 3I7HA 5E6UA 3EI3B 2HKRA 3N0EA 3VGZA 3QI0A 4WK2A 4DNUA 4YVDA 3OL2B 3OL2A 1TYEA 3V9FA 1H2WA 3O4HA 4FWWA 4L3HD 2H13A 4J73A 4NSXA 2I0TA 3UKUC 3V4PA 5EMMB 3BWSA 3OKYA 1JMZB 1GXRA 2I3TA 3J80g 3NIDA 4X61B 5EMLB 3RRMC 3UVLA 3ZDXA 2I0RA 4JSPC 4NBMA 3RMZD 3JRPA 5FKRA 5SXMA 3SCYA 4J77A 2OVRB 4O3UB 3PE7A 1VZ2A 3IUNA 3VI3A 4BH6A 5M5TA 4E5ZB 3AH8B 2P9KC 4E5ZA 4O1QD 4BCBA 5IGOA 1NEXB 2XYIA 2BBKH 3EQ9A 3K26A 4J0XA 1B9XA 1JMXB 4PSXB 4J8GA 5M5SA 1TYQC 2PM7B 2B4EA 2CO0C 1PBYB 4O45A 2VDOA 4U1EI 3DXKC 1R5MA 3CFSB 2VDKA 3ZWLB 4J84A 1GOGA 4ZN4A 5GXHA 2CN2A 3IIYA 3IUJA 1VE6A 2YNPA 4X3EA 4OZUA 1QNIA 5EMJB 4ERYA 4GZ8A 4BUJC 3I7PA 4PXWA 5E6RA 4CI2A 3BG1A 1MDAH 4EWRA 2OK6A 2H68A 4CY2A 4GQ1A 3DM0A 2AH0A 3IJ0A 5HE3B 2HU5A 2CNXA 4IRZA 2O9KA 3V5WB 4JHNA 5FKTA 4CZXA 3EI1A 1T2XA 4R7AB 3DDUA 3UVMA 4Y5RD 3DSMA 4ZOVA 4H5JA 1C9LA 5FA5B 1VE7A 4J0WA 3JAMg 1A0RB 5FKSA 2I0SA 2G99A 4PBYA 2UZYB 3CFVA 1GOFA 5GXIA 1E5TA 3EQ7A 5AMSA 1VYHC 3UKRC 5C2VB 3FCSA 1RI6A 2EICA 5H14A 3UVNA 4GM9A 4G1EA 4Z7NA 3SBPA 2Z2OA 3NIGA 1L5GA 2EIEA 3O4GA 3SFZA 5CXCA 4A2LA 1PGUA 5HYNB 2XU7A 2YB8B 2JKXA 1PI6A 3AFCA 3I7LA
chains in the Genus database with same CATH topology
4ERQA 4GQ2P 2W18A 4XYHA 4HDJA 4FHLA 3SN6B 2BCJB 3UVKA 3NVQA 3ORVD 1S4UX 2H6KA 3C9CA 2H3XA 3IIWA 5CXBB 5CXBA 3MKSB 4A11A 4CI1A 4OWRA 2J56H 3N0DA 4A0AA 3E0CA 3OKYB 3I2NA 3OKTA 5I5IA 2H47A 4JSXC 2HXCA 3KRXB 3PSLA 2HYEA 5HE0B 1U4CA 3RN0D 2P9PC 5EM2A 4L1QD 4E54B 4E54A 3JB9L 5C9ZB 5A2Qg 2GC7A 1OLZA 1Q47A 5K1CC 3A0FA 4O9DA 4H5IA 2EBSA 3EI4A 2PM9A 4JD2C 4JSVC 4J8BA 4U7AA 4ERZA 3SBRA 1MG2A 3I8EA 4XEIC 2UZXB 4GGDA 3I7OA 1MG3A 4GQBB 3RN1D 2J57G 4IA9A 5I5MA 1SQ9A 3I89A 1P22A 3SVWD 4LG9A 4BL0A 2QC5A 4XYIA 1PEVA 4LG8A 3JZGA 2P9NC 1XIPA 2CN3A 4IMMA 2YBAA 2AQ5A 3L4OD 5TEFA 1GG2B 3MMYA 2J55H 4A2MA 4KFMB 3AL8B 4PC0A 2CO0A 3AL8A 3GFCA 1FWXA 4A09B 4A09A 1K8KC 4N14A 2OJYA 4D6VA 2H6QA 1L0QA 4X63B 3AL9A 3IKOA 5HE2B 3ULEC 5CYKA 4MK0B 3PXTD 3EI1B 3EU7A 3MZKA 2HJ4A 3RFHA 2H6NA 2I3SA 5KDOB 3VH0A 4QQEA 4J86A 1XHMA 2IUVA 4A08B 2AGZA 5EAPA 4A08A 3EG6A 3RSEC 3EWEA 5C2WB 4ESGA 5EALA 2IURA 4I79A 3I8CA 3B7FA 4FA9D 5H17A 3IJ1A 4ZOZA 4CY1A 3I7NA 4A0BA 2B5LA 1ERJA 5CXCB 4J78A 4O3TB 4FA1D 1YFQA 3EI2A 3DXMC 3SXTD 4QL1A 5B4WA 2IAAA 3SLED 1OMWB 4PSWB 3L4MD 4Y7RA 3C99A 1N6EA 5GMKn 1U2VC 4QT8A 3IJCA 5IJ7E 3JZHA 3CIKB 1GOTB 4J82A 2Z2NA 2YNNA 3OW8A 5AJAA 2P9IC 2H9LA 2CE9A 4A11B 3BG0A 2H9MA 3OTTA 1N6DA 4FA5D 4A0AB 5TF2A 2TRCB 4J81A 4QRJA 3DWLC 4K3JB 3EI3A 3FGBA 5TEEA 3FM0A 4ZOXA 1XKSA 5EMKB 4JXMA 2GNQA 4TZ4A 5IJ8E 1K32A 3SMRA 2Q7QA 5EM2B 5TDHB 4FA4D 3OKWA 3JZNA 3I7KA 3PSCB 2AGWA 2AGYA 2P9SC 5EARA 2B5MA 5H1MA 3PXSD 1SQJA 3NVNA 4JSNC 2OVPB 3EI4B 2PM9B 4Z8LA 3SHFA 2XL2A 2CE8A 3GREA 4CI3A 2OK4A 4GM3A 3MZLA 4CI8A 3RLMD 3SWSD 1JJUB 4JT5C 5FQDA 1GP2B 3NVXA 3JPXA 3PXWD 2AH1A 3EMHA 4L9OA 3P4FA 3JROA 4CZVA 3V7DB 5THAA 5IGQA 4CY3A 5AFU3 3VA6A 5IC7A 5JWZA 5FXYA 2G9AA 2IWKA 2H9NA 3F3GA 4L3GD 4X60B 2HESX 5I5JA 3F3FA 3MKQA 4AOWA 4FAVD 2MTAH 5CYKB 3SJLD 4AEZA 4ZOYA 2OIZA 5HE1B 2AGLA 2IUPA 5GSAA 4CY5A 1JOFA 4ES0A 3UR4A 1N6FA 2P9LC 5FLXg 2YNOA 1SHYB 1TBGA 5EAMA 4PBZA 5K19A 1B9YA 4GGCA 4G56B 4GMBA 4JT6C 2OVQB 4LGNA 2PBIB 2XL3A 2IUQA 2GC4A 3SBQA 4A0BB 2Z2PA 2B5NA 3EI2B 4UI9R 2QXVA 4CC9A 3FRXA 3KRWB 4A7JA 4J79A 2H9PA 2AGXA 4PNKB 4K3ID 3PVWB 1NR0A 4GGAA 3W15A 2IWFA 3MXXA 3RFGA 3U4YA 3HFQA 2YMUA 3C5MA 4FB1D 2PM6B 4CZYA 3C75H 3PVUB 4FAND 3ODTA 4GM8A 5IT9g 4D0KA 3UVOA 3F3PA 4J87A 3J81g 5FKQA 5HQGA 2HJBA 2P9UC 2HKMA 3K27A 2H14A 3I7HA 3EI3B 2HKRA 3N0EA 3VGZA 4YVDA 3OL2B 3OL2A 3V9FA 4FWWA 4L3HD 2H13A 4J73A 4NSXA 2I0TA 3UKUC 5EMMB 3BWSA 3OKYA 1JMZB 1GXRA 2I3TA 3J80g 4X61B 5EMLB 3RRMC 3UVLA 2I0RA 4JSPC 3RMZD 3JRPA 5FKRA 5SXMA 3SCYA 4J77A 2OVRB 4O3UB 3PE7A 4BH6A 4E5ZB 3AH8B 2P9KC 4E5ZA 4O1QD 5IGOA 1NEXB 2XYIA 2BBKH 3K26A 4J0XA 1B9XA 1JMXB 4PSXB 4J8GA 1TYQC 2PM7B 2B4EA 2CO0C 1PBYB 4O45A 4U1EI 3DXKC 1R5MA 3CFSB 3ZWLB 4J84A 4ZN4A 5GXHA 2CN2A 3IIYA 2YNPA 4X3EA 4OZUA 1QNIA 5EMJB 4ERYA 4GZ8A 4BUJC 3I7PA 4PXWA 4CI2A 3BG1A 1MDAH 4EWRA 2OK6A 2H68A 4CY2A 4GQ1A 3DM0A 2AH0A 3IJ0A 5HE3B 2CNXA 2O9KA 3V5WB 5FKTA 4CZXA 3EI1A 4R7AB 3UVMA 4Y5RD 3DSMA 4ZOVA 4H5JA 5FA5B 4J0WA 3JAMg 1A0RB 5FKSA 2I0SA 2G99A 4PBYA 2UZYB 3CFVA 5GXIA 5AMSA 1VYHC 3UKRC 5C2VB 1RI6A 5H14A 3UVNA 4GM9A 3SBPA 2Z2OA 3SFZA 5CXCA 4A2LA 1PGUA 5HYNB 2XU7A 2YB8B 1PI6A 3AFCA 3I7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ERQ A;  4GQ2 P;  2W18 A;  4XYH A;  4HDJ A;  4FHL A;  3SN6 B;  2BCJ B;  3UVK A;  3NVQ A;  3ORV D;  1S4U X;  2H6K A;  3C9C A;  2H3X A;  3IIW A;  5CXB B;  5CXB A;  3MKS B;  4A11 A;  4CI1 A;  4OWR A;  2J56 H;  3N0D A;  4A0A A;  3E0C A;  3OKY B;  3I2N A;  3OKT A;  5I5I A;  2H47 A;  4JSX C;  2HXC A;  3KRX B;  3PSL A;  2HYE A;  5HE0 B;  1U4C A;  3RN0 D;  2P9P C;  5EM2 A;  4L1Q D;  4E54 B;  4E54 A;  3JB9 L;  5C9Z B;  5A2Q g;  2GC7 A;  1OLZ A;  1Q47 A;  5K1C C;  3A0F A;  4O9D A;  4H5I A;  2EBS A;  3EI4 A;  2PM9 A;  4JD2 C;  4JSV C;  4J8B A;  4U7A A;  4ERZ A;  3SBR A;  1MG2 A;  3I8E A;  4XEI C;  2UZX B;  4GGD A;  3I7O A;  1MG3 A;  4GQB B;  3RN1 D;  2J57 G;  4IA9 A;  5I5M A;  1SQ9 A;  3I89 A;  1P22 A;  3SVW D;  4LG9 A;  4BL0 A;  2QC5 A;  4XYI A;  1PEV A;  4LG8 A;  3JZG A;  2P9N C;  1XIP A;  2CN3 A;  4IMM A;  2YBA A;  2AQ5 A;  3L4O D;  5TEF A;  1GG2 B;  3MMY A;  2J55 H;  4A2M A;  4KFM B;  3AL8 B;  4PC0 A;  2CO0 A;  3AL8 A;  3GFC A;  1FWX A;  4A09 B;  4A09 A;  1K8K C;  4N14 A;  2OJY A;  4D6V A;  2H6Q A;  1L0Q A;  4X63 B;  3AL9 A;  3IKO A;  5HE2 B;  3ULE C;  5CYK A;  4MK0 B;  3PXT D;  3EI1 B;  3EU7 A;  3MZK A;  2HJ4 A;  3RFH A;  2H6N A;  2I3S A;  5KDO B;  3VH0 A;  4QQE A;  4J86 A;  1XHM A;  2IUV A;  4A08 B;  2AGZ A;  5EAP A;  4A08 A;  3EG6 A;  3RSE C;  3EWE A;  5C2W B;  4ESG A;  5EAL A;  2IUR A;  4I79 A;  3I8C A;  3B7F A;  4FA9 D;  5H17 A;  3IJ1 A;  4ZOZ A;  4CY1 A;  3I7N A;  4A0B A;  2B5L A;  1ERJ A;  5CXC B;  4J78 A;  4O3T B;  4FA1 D;  1YFQ A;  3EI2 A;  3DXM C;  3SXT D;  4QL1 A;  5B4W A;  2IAA A;  3SLE D;  1OMW B;  4PSW B;  3L4M D;  4Y7R A;  3C99 A;  1N6E A;  5GMK n;  1U2V C;  4QT8 A;  3IJC A;  5IJ7 E;  3JZH A;  3CIK B;  1GOT B;  4J82 A;  2Z2N A;  2YNN A;  3OW8 A;  5AJA A;  2P9I C;  2H9L A;  2CE9 A;  4A11 B;  3BG0 A;  2H9M A;  3OTT A;  1N6D A;  4FA5 D;  4A0A B;  5TF2 A;  2TRC B;  4J81 A;  4QRJ A;  3DWL C;  4K3J B;  3EI3 A;  3FGB A;  5TEE A;  3FM0 A;  4ZOX A;  1XKS A;  5EMK B;  4JXM A;  2GNQ A;  4TZ4 A;  5IJ8 E;  1K32 A;  3SMR A;  2Q7Q A;  5EM2 B;  5TDH B;  4FA4 D;  3OKW A;  3JZN A;  3I7K A;  3PSC B;  2AGW A;  2AGY A;  2P9S C;  5EAR A;  2B5M A;  5H1M A;  3PXS D;  1SQJ A;  3NVN A;  4JSN C;  2OVP B;  3EI4 B;  2PM9 B;  4Z8L A;  3SHF A;  2XL2 A;  2CE8 A;  3GRE A;  4CI3 A;  2OK4 A;  4GM3 A;  3MZL A;  4CI8 A;  3RLM D;  3SWS D;  1JJU B;  4JT5 C;  5FQD A;  1GP2 B;  3NVX A;  3JPX A;  3PXW D;  2AH1 A;  3EMH A;  4L9O A;  3P4F A;  3JRO A;  4CZV A;  3V7D B;  5THA A;  5IGQ A;  4CY3 A;  5AFU 3;  3VA6 A;  5IC7 A;  5JWZ A;  5FXY A;  2G9A A;  2IWK A;  2H9N A;  3F3G A;  4L3G D;  4X60 B;  2HES X;  5I5J A;  3F3F A;  3MKQ A;  4AOW A;  4FAV D;  2MTA H;  5CYK B;  3SJL D;  4AEZ A;  4ZOY A;  2OIZ A;  5HE1 B;  2AGL A;  2IUP A;  5GSA A;  4CY5 A;  1JOF A;  4ES0 A;  3UR4 A;  1N6F A;  2P9L C;  5FLX g;  2YNO A;  1SHY B;  1TBG A;  5EAM A;  4PBZ A;  5K19 A;  1B9Y A;  4GGC A;  4G56 B;  4GMB A;  4JT6 C;  2OVQ B;  4LGN A;  2PBI B;  2XL3 A;  2IUQ A;  2GC4 A;  3SBQ A;  4A0B B;  2Z2P A;  2B5N A;  3EI2 B;  4UI9 R;  2QXV A;  4CC9 A;  3FRX A;  3KRW B;  4A7J A;  4J79 A;  2H9P A;  2AGX A;  4PNK B;  4K3I D;  3PVW B;  1NR0 A;  4GGA A;  3W15 A;  2IWF A;  3MXX A;  3RFG A;  3U4Y A;  3HFQ A;  2YMU A;  3C5M A;  4FB1 D;  2PM6 B;  4CZY A;  3C75 H;  3PVU B;  4FAN D;  3ODT A;  4GM8 A;  5IT9 g;  4D0K A;  3UVO A;  3F3P A;  4J87 A;  3J81 g;  5FKQ A;  5HQG A;  2HJB A;  2P9U C;  2HKM A;  3K27 A;  2H14 A;  3I7H A;  3EI3 B;  2HKR A;  3N0E A;  3VGZ A;  4YVD A;  3OL2 B;  3OL2 A;  3V9F A;  4FWW A;  4L3H D;  2H13 A;  4J73 A;  4NSX A;  2I0T A;  3UKU C;  5EMM B;  3BWS A;  3OKY A;  1JMZ B;  1GXR A;  2I3T A;  3J80 g;  4X61 B;  5EML B;  3RRM C;  3UVL A;  2I0R A;  4JSP C;  3RMZ D;  3JRP A;  5FKR A;  5SXM A;  3SCY A;  4J77 A;  2OVR B;  4O3U B;  3PE7 A;  4BH6 A;  4E5Z B;  3AH8 B;  2P9K C;  4E5Z A;  4O1Q D;  5IGO A;  1NEX B;  2XYI A;  2BBK H;  3K26 A;  4J0X A;  1B9X A;  1JMX B;  4PSX B;  4J8G A;  1TYQ C;  2PM7 B;  2B4E A;  2CO0 C;  1PBY B;  4O45 A;  4U1E I;  3DXK C;  1R5M A;  3CFS B;  3ZWL B;  4J84 A;  4ZN4 A;  5GXH A;  2CN2 A;  3IIY A;  2YNP A;  4X3E A;  4OZU A;  1QNI A;  5EMJ B;  4ERY A;  4GZ8 A;  4BUJ C;  3I7P A;  4PXW A;  4CI2 A;  3BG1 A;  1MDA H;  4EWR A;  2OK6 A;  2H68 A;  4CY2 A;  4GQ1 A;  3DM0 A;  2AH0 A;  3IJ0 A;  5HE3 B;  2CNX A;  2O9K A;  3V5W B;  5FKT A;  4CZX A;  3EI1 A;  4R7A B;  3UVM A;  4Y5R D;  3DSM A;  4ZOV A;  4H5J A;  5FA5 B;  4J0W A;  3JAM g;  1A0R B;  5FKS A;  2I0S A;  2G99 A;  4PBY A;  2UZY B;  3CFV A;  5GXI A;  5AMS A;  1VYH C;  3UKR C;  5C2V B;  1RI6 A;  5H14 A;  3UVN A;  4GM9 A;  3SBP A;  2Z2O A;  3SFZ A;  5CXC A;  4A2L A;  1PGU A;  5HYN B;  2XU7 A;  2YB8 B;  1PI6 A;  3AFC A;  3I7L A; 
#chains in the Genus database with same CATH topology
 4ERQ A;  3EQ8 A;  4GQ2 P;  2W18 A;  4XYH A;  1GOH A;  4HDJ A;  4FHL A;  3SN6 B;  2BCJ B;  3UVK A;  2VDN A;  3NVQ A;  3ORV D;  1S4U X;  2H6K A;  1H2X A;  3C9C A;  2H3X A;  3IIW A;  5CXB B;  5CXB A;  3MKS B;  4A11 A;  4CI1 A;  4OWR A;  2VZ1 A;  2J56 H;  3N0D A;  4A0A A;  3E0C A;  2QZP A;  3I2N A;  3OKY B;  3OKT A;  5I5I A;  2VDP A;  2H47 A;  4JSX C;  2HXC A;  3KRX B;  3PSL A;  2HYE A;  1C9I A;  5HE0 B;  1U4C A;  3RN0 D;  3VI4 A;  1O6G A;  2HU7 A;  4O2W A;  2P9P C;  5EM2 A;  4L1Q D;  5C92 A;  4E54 B;  4E54 A;  3JB9 L;  5C9Z B;  4NC4 A;  4RE5 A;  5A2Q g;  2GC7 A;  1OLZ A;  1Q47 A;  5K1C C;  4Z7Q A;  3A0F A;  4O9D A;  4H5I A;  2EBS A;  3EI4 A;  2PM9 A;  4JD2 C;  4JSV C;  4AX4 A;  4J8B A;  3IVM A;  4U7A A;  4ERZ A;  3SBR A;  1MG2 A;  3GC3 B;  3I8E A;  4XEI C;  2UZX B;  4GGD A;  3I7O A;  1MG3 A;  4GQB B;  3RN1 D;  2J57 G;  1I2M B;  4IA9 A;  5I5M A;  1SQ9 A;  3I89 A;  1P22 A;  3SVW D;  4LG9 A;  4BL0 A;  2QC5 A;  4XYI A;  1PEV A;  4LG8 A;  3JZG A;  3FCU A;  2P9N C;  1XIP A;  2CN3 A;  4IMM A;  2YBA A;  2AQ5 A;  3L4O D;  5TEF A;  1GG2 B;  3MMY A;  2J55 H;  4A2M A;  4KFM B;  3IUL A;  3AL8 B;  4NAA A;  2CO0 A;  3AL8 A;  3IJE A;  3GFC A;  4PC0 A;  2VDM A;  1FWX A;  1U8C A;  4A09 B;  4A09 A;  1K8K C;  4N14 A;  2OJY A;  4D6V A;  2H6Q A;  1L0Q A;  4X63 B;  3V4V A;  3AL9 A;  3IKO A;  5HE2 B;  3ULE C;  5CYK A;  4MK0 B;  3PXT D;  3EI1 B;  3EU7 A;  3K72 A;  3MZK A;  4G1M A;  2HJ4 A;  3RFH A;  3ZDY A;  2H6N A;  2I3S A;  4DNW A;  5KDO B;  4QQE A;  3VH0 A;  3IUR A;  4JHP C;  4UM9 A;  4J86 A;  1XHM A;  2IUV A;  4BCC A;  2AGZ A;  5EAP A;  4A08 B;  4A08 A;  3EG6 A;  3RSE C;  3EWE A;  3QHY B;  5C2W B;  3ZE2 A;  4ESG A;  5EAL A;  2IUR A;  4I79 A;  3MUN A;  3I8C A;  1E8M A;  4DNV A;  3B7F A;  4NEN A;  4FA9 D;  5H17 A;  3IJ1 A;  4ZOZ A;  4CY1 A;  3KCI A;  3I7N A;  4A0B A;  2WQ8 A;  2B5L A;  1ERJ A;  5CXC B;  4J78 A;  4O3T B;  4FA1 D;  5FFO A;  1YFQ A;  3EI2 A;  1BPO A;  3DXM C;  4WK0 A;  3ZDZ A;  4BCD A;  3SXT D;  1YR2 A;  4QL1 A;  5B4W A;  2IAA A;  3SLE D;  1OMW B;  4PSW B;  3L4M D;  4Y7R A;  3C99 A;  4G55 A;  1N6E A;  5M5V A;  5GMK n;  1U2V C;  4QT8 A;  3IJC A;  5IJ7 E;  3JZH A;  3CIK B;  3O4J A;  1GOT B;  2QR5 A;  4J82 A;  2Z2N A;  3ZE0 A;  2YNN A;  3OW8 A;  1A12 A;  2P9I C;  5AJA A;  2H9L A;  1UOQ A;  5M5R A;  2CE9 A;  2XDW A;  4A11 B;  5M61 A;  3OF7 A;  3BG0 A;  2H9M A;  3OTT A;  1N6D A;  4FA5 D;  4A0A B;  5TF2 A;  2TRC B;  1O6F A;  4J81 A;  4QRJ A;  3DWL C;  4K3J B;  3EI3 A;  3FGB A;  5TEE A;  4Z7O A;  3FM0 A;  4ZOX A;  1XKS A;  5EMK B;  2BKL A;  4JXM A;  5M5U A;  2GNQ A;  4TZ4 A;  5IJ8 E;  1K32 A;  3SMR A;  4BP9 A;  2Q7Q A;  5EM2 B;  5TDH B;  2VZ3 A;  4FA4 D;  3OKW A;  3JZN A;  1UOO A;  3I7K A;  3PSC B;  2AGW A;  2AGY A;  2P9S C;  5EAR A;  2B5M A;  5H1M A;  4AN1 A;  2VDR A;  3PXS D;  1SQJ A;  3NVN A;  5E6S A;  2OVP B;  4JSN C;  3EI4 B;  2EID A;  2PM9 B;  4Z8L A;  4AMZ A;  3IUQ A;  3SHF A;  2XL2 A;  2CE8 A;  2VDQ A;  3GRE A;  4CI3 A;  2EIB A;  4UM8 A;  2OK4 A;  3NIF A;  4GM3 A;  1VZ3 A;  3MZL A;  4CI8 A;  3RLM D;  3SWS D;  1JJU B;  4JT5 C;  2XZG A;  5FQD A;  1GP2 B;  3NVX A;  3JPX A;  3PXW D;  2AH1 A;  3EMH A;  4AN0 A;  1UOP A;  4L9O A;  3P4F A;  3JRO A;  1QFS A;  4WK4 A;  4WJK A;  4CZV A;  3MVD K;  3V7D B;  3IUM A;  5THA A;  5IGQ A;  5HDB A;  4CY3 A;  5AFU 3;  3VA6 A;  5IC7 A;  5JWZ A;  5FXY A;  2G9A A;  3K71 A;  2IWK A;  2H9N A;  3F3G A;  4L3G D;  4X60 B;  2HES X;  5I5J A;  3F3F A;  3MKQ A;  4AOW A;  4AMY A;  4FAV D;  2MTA H;  3GD1 I;  1E8N A;  5CYK B;  3SJL D;  4AEZ A;  4ZOY A;  2OIZ A;  5HE1 B;  2AGL A;  2IUP A;  4D9S A;  5GSA A;  4CY5 A;  1JOF A;  4BP8 A;  1QFM A;  1M1X A;  4ES0 A;  3UR4 A;  1N6F A;  1JV2 A;  2P9L C;  3MUO A;  4RE6 A;  5FLX g;  2YNO A;  1H2Y A;  1SHY B;  1TBG A;  5EAM A;  4O02 A;  4PBZ A;  5K19 A;  1B9Y A;  2VC2 A;  4GGC A;  4L1M A;  4G56 B;  3ZE1 A;  2XE4 A;  4GMB A;  4JT6 C;  2OVQ B;  4LGN A;  1UTC A;  2PBI B;  2XL3 A;  5FFG A;  2IUQ A;  2GC4 A;  3SBQ A;  4A0B B;  2Z2P A;  2B5N A;  3K6S A;  3EI2 B;  4UI9 R;  2QXV A;  3O4I A;  3FRX A;  3KRW B;  4CC9 A;  5C86 A;  4A7J A;  4J79 A;  2H9P A;  2AGX A;  4PNK B;  4K3I D;  3PVW B;  3T3P A;  4MMZ A;  1NR0 A;  1H2Z A;  4GGA A;  3W15 A;  1K3I A;  2IWF A;  3MXX A;  3RFG A;  3U4Y A;  3HFQ A;  2YMU A;  4MMX A;  3T3M A;  3C5M A;  4FB1 D;  2PM6 B;  4CZY A;  3C75 H;  3PVU B;  2HU8 A;  4FAN D;  3ODT A;  4GM8 A;  5IT9 g;  4D0K A;  3UVO A;  3F3P A;  4J87 A;  3J81 g;  1JTD B;  2VDL A;  5FKQ A;  5HQG A;  2HJB A;  4MMY A;  2P9U C;  2HKM A;  3K27 A;  2H14 A;  4QAM A;  3I7H A;  5E6U A;  3EI3 B;  2HKR A;  3N0E A;  3VGZ A;  3QI0 A;  4WK2 A;  4DNU A;  4YVD A;  3OL2 B;  3OL2 A;  1TYE A;  3V9F A;  1H2W A;  3O4H A;  4FWW A;  4L3H D;  2H13 A;  4J73 A;  4NSX A;  2I0T A;  3UKU C;  3V4P A;  5EMM B;  3BWS A;  3OKY A;  1JMZ B;  1GXR A;  2I3T A;  3J80 g;  3NID A;  4X61 B;  5EML B;  3RRM C;  3UVL A;  3ZDX A;  2I0R A;  4JSP C;  4NBM A;  3RMZ D;  3JRP A;  5FKR A;  5SXM A;  3SCY A;  4J77 A;  2OVR B;  4O3U B;  3PE7 A;  1VZ2 A;  3IUN A;  3VI3 A;  4BH6 A;  5M5T A;  4E5Z B;  3AH8 B;  2P9K C;  4E5Z A;  4O1Q D;  4BCB A;  5IGO A;  1NEX B;  2XYI A;  2BBK H;  3EQ9 A;  3K26 A;  4J0X A;  1B9X A;  1JMX B;  4PSX B;  4J8G A;  5M5S A;  1TYQ C;  2PM7 B;  2B4E A;  2CO0 C;  1PBY B;  4O45 A;  2VDO A;  4U1E I;  3DXK C;  1R5M A;  3CFS B;  2VDK A;  3ZWL B;  4J84 A;  1GOG A;  4ZN4 A;  5GXH A;  2CN2 A;  3IIY A;  3IUJ A;  1VE6 A;  2YNP A;  4X3E A;  4OZU A;  1QNI A;  5EMJ B;  4ERY A;  4GZ8 A;  4BUJ C;  3I7P A;  4PXW A;  5E6R A;  4CI2 A;  3BG1 A;  1MDA H;  4EWR A;  2OK6 A;  2H68 A;  4CY2 A;  4GQ1 A;  3DM0 A;  2AH0 A;  3IJ0 A;  5HE3 B;  2HU5 A;  2CNX A;  4IRZ A;  2O9K A;  3V5W B;  4JHN A;  5FKT A;  4CZX A;  3EI1 A;  1T2X A;  4R7A B;  3DDU A;  3UVM A;  4Y5R D;  3DSM A;  4ZOV A;  4H5J A;  1C9L A;  5FA5 B;  1VE7 A;  4J0W A;  3JAM g;  1A0R B;  5FKS A;  2I0S A;  2G99 A;  4PBY A;  2UZY B;  3CFV A;  1GOF A;  5GXI A;  1E5T A;  3EQ7 A;  5AMS A;  1VYH C;  3UKR C;  5C2V B;  3FCS A;  1RI6 A;  2EIC A;  5H14 A;  3UVN A;  4GM9 A;  4G1E A;  4Z7N A;  3SBP A;  2Z2O A;  3NIG A;  1L5G A;  2EIE A;  3O4G A;  3SFZ A;  5CXC A;  4A2L A;  1PGU A;  5HYN B;  2XU7 A;  2YB8 B;  2JKX A;  1PI6 A;  3AFC A;  3I7L A; 
#chains in the Genus database with same CATH homology
 4ERQ A;  4GQ2 P;  2W18 A;  4XYH A;  4HDJ A;  4FHL A;  3SN6 B;  2BCJ B;  3UVK A;  3NVQ A;  3ORV D;  1S4U X;  2H6K A;  3C9C A;  2H3X A;  3IIW A;  5CXB B;  5CXB A;  3MKS B;  4A11 A;  4CI1 A;  4OWR A;  2J56 H;  3N0D A;  4A0A A;  3E0C A;  3OKY B;  3I2N A;  3OKT A;  5I5I A;  2H47 A;  4JSX C;  2HXC A;  3KRX B;  3PSL A;  2HYE A;  5HE0 B;  1U4C A;  3RN0 D;  2P9P C;  5EM2 A;  4L1Q D;  4E54 B;  4E54 A;  3JB9 L;  5C9Z B;  5A2Q g;  2GC7 A;  1OLZ A;  1Q47 A;  5K1C C;  3A0F A;  4O9D A;  4H5I A;  2EBS A;  3EI4 A;  2PM9 A;  4JD2 C;  4JSV C;  4J8B A;  4U7A A;  4ERZ A;  3SBR A;  1MG2 A;  3I8E A;  4XEI C;  2UZX B;  4GGD A;  3I7O A;  1MG3 A;  4GQB B;  3RN1 D;  2J57 G;  4IA9 A;  5I5M A;  1SQ9 A;  3I89 A;  1P22 A;  3SVW D;  4LG9 A;  4BL0 A;  2QC5 A;  4XYI A;  1PEV A;  4LG8 A;  3JZG A;  2P9N C;  1XIP A;  2CN3 A;  4IMM A;  2YBA A;  2AQ5 A;  3L4O D;  5TEF A;  1GG2 B;  3MMY A;  2J55 H;  4A2M A;  4KFM B;  3AL8 B;  4PC0 A;  2CO0 A;  3AL8 A;  3GFC A;  1FWX A;  4A09 B;  4A09 A;  1K8K C;  4N14 A;  2OJY A;  4D6V A;  2H6Q A;  1L0Q A;  4X63 B;  3AL9 A;  3IKO A;  5HE2 B;  3ULE C;  5CYK A;  4MK0 B;  3PXT D;  3EI1 B;  3EU7 A;  3MZK A;  2HJ4 A;  3RFH A;  2H6N A;  2I3S A;  5KDO B;  3VH0 A;  4QQE A;  4J86 A;  1XHM A;  2IUV A;  4A08 B;  2AGZ A;  5EAP A;  4A08 A;  3EG6 A;  3RSE C;  3EWE A;  5C2W B;  4ESG A;  5EAL A;  2IUR A;  4I79 A;  3I8C A;  3B7F A;  4FA9 D;  5H17 A;  3IJ1 A;  4ZOZ A;  4CY1 A;  3I7N A;  4A0B A;  2B5L A;  1ERJ A;  5CXC B;  4J78 A;  4O3T B;  4FA1 D;  1YFQ A;  3EI2 A;  3DXM C;  3SXT D;  4QL1 A;  5B4W A;  2IAA A;  3SLE D;  1OMW B;  4PSW B;  3L4M D;  4Y7R A;  3C99 A;  1N6E A;  5GMK n;  1U2V C;  4QT8 A;  3IJC A;  5IJ7 E;  3JZH A;  3CIK B;  1GOT B;  4J82 A;  2Z2N A;  2YNN A;  3OW8 A;  5AJA A;  2P9I C;  2H9L A;  2CE9 A;  4A11 B;  3BG0 A;  2H9M A;  3OTT A;  1N6D A;  4FA5 D;  4A0A B;  5TF2 A;  2TRC B;  4J81 A;  4QRJ A;  3DWL C;  4K3J B;  3EI3 A;  3FGB A;  5TEE A;  3FM0 A;  4ZOX A;  1XKS A;  5EMK B;  4JXM A;  2GNQ A;  4TZ4 A;  5IJ8 E;  1K32 A;  3SMR A;  2Q7Q A;  5EM2 B;  5TDH B;  4FA4 D;  3OKW A;  3JZN A;  3I7K A;  3PSC B;  2AGW A;  2AGY A;  2P9S C;  5EAR A;  2B5M A;  5H1M A;  3PXS D;  1SQJ A;  3NVN A;  4JSN C;  2OVP B;  3EI4 B;  2PM9 B;  4Z8L A;  3SHF A;  2XL2 A;  2CE8 A;  3GRE A;  4CI3 A;  2OK4 A;  4GM3 A;  3MZL A;  4CI8 A;  3RLM D;  3SWS D;  1JJU B;  4JT5 C;  5FQD A;  1GP2 B;  3NVX A;  3JPX A;  3PXW D;  2AH1 A;  3EMH A;  4L9O A;  3P4F A;  3JRO A;  4CZV A;  3V7D B;  5THA A;  5IGQ A;  4CY3 A;  5AFU 3;  3VA6 A;  5IC7 A;  5JWZ A;  5FXY A;  2G9A A;  2IWK A;  2H9N A;  3F3G A;  4L3G D;  4X60 B;  2HES X;  5I5J A;  3F3F A;  3MKQ A;  4AOW A;  4FAV D;  2MTA H;  5CYK B;  3SJL D;  4AEZ A;  4ZOY A;  2OIZ A;  5HE1 B;  2AGL A;  2IUP A;  5GSA A;  4CY5 A;  1JOF A;  4ES0 A;  3UR4 A;  1N6F A;  2P9L C;  5FLX g;  2YNO A;  1SHY B;  1TBG A;  5EAM A;  4PBZ A;  5K19 A;  1B9Y A;  4GGC A;  4G56 B;  4GMB A;  4JT6 C;  2OVQ B;  4LGN A;  2PBI B;  2XL3 A;  2IUQ A;  2GC4 A;  3SBQ A;  4A0B B;  2Z2P A;  2B5N A;  3EI2 B;  4UI9 R;  2QXV A;  4CC9 A;  3FRX A;  3KRW B;  4A7J A;  4J79 A;  2H9P A;  2AGX A;  4PNK B;  4K3I D;  3PVW B;  1NR0 A;  4GGA A;  3W15 A;  2IWF A;  3MXX A;  3RFG A;  3U4Y A;  3HFQ A;  2YMU A;  3C5M A;  4FB1 D;  2PM6 B;  4CZY A;  3C75 H;  3PVU B;  4FAN D;  3ODT A;  4GM8 A;  5IT9 g;  4D0K A;  3UVO A;  3F3P A;  4J87 A;  3J81 g;  5FKQ A;  5HQG A;  2HJB A;  2P9U C;  2HKM A;  3K27 A;  2H14 A;  3I7H A;  3EI3 B;  2HKR A;  3N0E A;  3VGZ A;  4YVD A;  3OL2 B;  3OL2 A;  3V9F A;  4FWW A;  4L3H D;  2H13 A;  4J73 A;  4NSX A;  2I0T A;  3UKU C;  5EMM B;  3BWS A;  3OKY A;  1JMZ B;  1GXR A;  2I3T A;  3J80 g;  4X61 B;  5EML B;  3RRM C;  3UVL A;  2I0R A;  4JSP C;  3RMZ D;  3JRP A;  5FKR A;  5SXM A;  3SCY A;  4J77 A;  2OVR B;  4O3U B;  3PE7 A;  4BH6 A;  4E5Z B;  3AH8 B;  2P9K C;  4E5Z A;  4O1Q D;  5IGO A;  1NEX B;  2XYI A;  2BBK H;  3K26 A;  4J0X A;  1B9X A;  1JMX B;  4PSX B;  4J8G A;  1TYQ C;  2PM7 B;  2B4E A;  2CO0 C;  1PBY B;  4O45 A;  4U1E I;  3DXK C;  1R5M A;  3CFS B;  3ZWL B;  4J84 A;  4ZN4 A;  5GXH A;  2CN2 A;  3IIY A;  2YNP A;  4X3E A;  4OZU A;  1QNI A;  5EMJ B;  4ERY A;  4GZ8 A;  4BUJ C;  3I7P A;  4PXW A;  4CI2 A;  3BG1 A;  1MDA H;  4EWR A;  2OK6 A;  2H68 A;  4CY2 A;  4GQ1 A;  3DM0 A;  2AH0 A;  3IJ0 A;  5HE3 B;  2CNX A;  2O9K A;  3V5W B;  5FKT A;  4CZX A;  3EI1 A;  4R7A B;  3UVM A;  4Y5R D;  3DSM A;  4ZOV A;  4H5J A;  5FA5 B;  4J0W A;  3JAM g;  1A0R B;  5FKS A;  2I0S A;  2G99 A;  4PBY A;  2UZY B;  3CFV A;  5GXI A;  5AMS A;  1VYH C;  3UKR C;  5C2V B;  1RI6 A;  5H14 A;  3UVN A;  4GM9 A;  3SBP A;  2Z2O A;  3SFZ A;  5CXC A;  4A2L A;  1PGU A;  5HYN B;  2XU7 A;  2YB8 B;  1PI6 A;  3AFC A;  3I7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...