2IUQA

Crystal structure of dithionite-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis in complex with tryptamine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
total genus 98
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2iuqA01
4ES0A 4O3TB 3IJ0A 4A0AB 2CE8A 3ODTA 4GQBB 3SCYA 4LG8A 4FB1D 4GM3A 4E5ZB 4QT8A 2B5NA 4A0BA 4PNKB 3BG1A 1JMZB 1YFQA 2HXCA 3JPXA 4J8GA 2AH0A 2J57G 3RN0D 3PSCB 2YNPA 4J77A 2IURA 4JT5C 5TF2A 2P9SC 3MKQA 2GC4A 2I3SA 2BCJB 2CN2A 3DXMC 3OL2A 4JSXC 4E54B 3AL8B 3RFGA 4JSNC 4U1EI 2AQ5A 3EI3A 4ZOZA 1PGUA 2H6QA 5FKRA 5TEFA 3L4MD 3JZGA 3SBPA 4GGDA 4E54A 5EMJB 2O9KA 3NVQA 5IGQA 4E5ZA 3I7NA 4QRJA 3IIYA 2YNOA 3UVLA 2CO0A 3OTTA 4O9DA 3EI3B 2GNQA 4PBYA 3I7KA 1XHMA 5CXCA 2I0TA 4A09A 4L9OA 4X60B 3OKYB 1JOFA 2J56H 5EMMB 3N0DA 5AMSA 5H1MA 4ZOYA 2H3XA 2MTAH 2P9PC 4G56B 2OVRB 3MKSB 4PSXB 4L3GD 3SWSD 3SJLD 4A11B 4UI9R 4IMMA 3SVWD 2B4EA 3I2NA 4J0XA 4FHLA 1U4CA 4Z8LA 2B5LA 3EI4A 3JROA 2AGLA 2IWKA 2PM9B 4PBZA 4BL0A 1MG3A 2CO0C 4U7AA 3J80g 4J73A 4OZUA 3A0FA 3OKWA 3SLED 2YBAA 3GFCA 4D6VA 5HE3B 3F3FA 2TRCB 2H13A 3OKYA 3PSLA 3B7FA 3DXKC 1K8KC 3CIKB 5EAMA 4J78A 3AH8B 4L3HD 2OVQB 4D0KA 4XEIC 4FA1D 3CFVA 5TEEA 5FA5B 3JRPA 3C5MA 4PSWB 3P4FA 4CY5A 5SXMA 5HE1B 4PXWA 4ZOXA 5EALA 3UKRC 5K1CC 2H9MA 2I0SA 4CI2A 3VH0A 4A08B 2XL2A 3SXTD 5HE2B 2OK4A 1R5MA 3AL9A 4J86A 5JWZA 3KRXB 2W18A 3PXWD 2HKRA 3U4YA 4ZOVA 3UVKA 5FLXg 2B5MA 3BG0A 4O1QD 3GREA 4A08A 3I8EA 4GQ2P 1ERJA 1Q47A 2P9KC 5EAPA 3RLMD 5GSAA 3AFCA 1TBGA 4A2MA 3I89A 2P9NC 1OLZA 3NVXA 3I7OA 4MK0B 5I5IA 3EI4B 3EG6A 3C99A 5HE0B 3RSEC 4CZVA 3CFSB 4CY3A 5THAA 3ZWLB 5C2WB 3I8CA 4I79A 2H6NA 4FA9D 2H14A 4JD2C 4ZN4A 2IAAA 5EM2A 2XU7A 1NR0A 4X3EA 2CNXA 4A2LA 5IT9g 2HJ4A 5FKQA 3UVOA 2H6KA 2I3TA 2YB8B 5HQGA 1RI6A 3DM0A 3V7DB 3DSMA 4CI8A 2OIZA 3SBRA 5IJ8E 3N0EA 3OKTA 4FA4D 1SQJA 3MMYA 5IGOA 4A09B 5FKTA 4X61B 4O3UB 4ERYA 5FQDA 2UZXB 4JXMA 4CY2A 4J0WA 4YVDA 3UKUC 4FAND 4XYIA 1MG2A 2P9IC 4LG9A 4BH6A 1B9YA 3I7LA 2PBIB 1A0RB 3PVUB 3FM0A 5H17A 2CE9A 3SFZA 5FKSA 2PM6B 4OWRA 3L4OD 1FWXA 3UR4A 5GXHA 3AL8A 3EMHA 4CI3A 5CYKB 5C2VB 2G99A 4TZ4A 5KDOB 2EBSA 2IUQA 2YMUA 2OK6A 1PBYB 3IJ1A 4J81A 4H5JA 4LGNA 3IJCA 3PXTD 1SQ9A 3DWLC 1VYHC 4ERQA 2IWFA 2UZYB 2BBKH 1SHYB 4J87A 2OJYA 2PM9A 3J81g 1N6FA 3ULEC 3UVMA 1B9XA 4FWWA 2H47A 4PC0A 3IIWA 4ERZA 5I5JA 2GC7A 2P9UC 4GZ8A 5CXBA 4R7AB 4CZYA 4FA5D 2PM7B 3EU7A 3RFHA 4AEZA 5A2Qg 5CXBB 5CYKA 2AGZA 4GQ1A 3ORVD 4Y7RA 3OW8A 5FXYA 4A0BB 4GMBA 3KRWB 3MXXA 3MZKA 5EARA 3SN6B 2H9LA 1S4UX 3K26A 3PVWB 2HKMA 2Z2PA 3RMZD 5K19A 5CXCB 2IUVA 5HYNB 2AGXA 4JSVC 4KFMB 2OVPB 5GXIA 1L0QA 3VGZA 3FRXA 4BUJC 3C9CA 4JT6C 3W15A 4HDJA 2XL3A 3JZNA 1K32A 3JB9L 2Z2NA 3RN1D 4J82A 1NEXB 5B4WA 4N14A 4NSXA 5H14A 4QL1A 3JZHA 1N6DA 2IUPA 4J8BA 4FAVD 1XIPA 4CC9A 3I7PA 2H9NA 3RRMC 5EM2B 3EI1A 2AH1A 2XYIA 2H68A 3JAMg 2J55H 4ESGA 3K27A 3EI2B 3EI1B 2QXVA 4L1QD 3PXSD 5IJ7E 2HESX 3BWSA 1XKSA 2AGYA 3F3GA 4GM9A 4A0AA 5AFU3 4A11A 3FGBA 4K3JB 1JMXB 4X63B 4GGAA 4IA9A 2Q7QA 2I0RA 3MZLA 3SHFA 3EWEA 4CI1A 3VA6A 4O45A 4AOWA 4CY1A 3IKOA 3SMRA 1U2VC 3PE7A 5IC7A 3EI2A 4EWRA 4CZXA 2CN3A 1P22A 3E0CA 1PI6A 1GP2B 2P9LC 3OL2B 5EMKB 1GXRA 2HJBA 2G9AA 1MDAH 3HFQA 5EMLB 3SBQA 5GMKn 2HYEA 4GGCA 4XYHA 3F3PA 4J79A 2QC5A 5TDHB 1N6EA 2Z2OA 1OMWB 1TYQC 4A7JA 4QQEA 1JJUB 5AJAA 1QNIA 4GM8A 4H5IA 4J84A 1GG2B 5I5MA 4Y5RD 3UVNA 5C9ZB 1GOTB 2H9PA 2AGWA 3I7HA 3C75H 3V9FA 2YNNA 1PEVA 3NVNA 4JSPC 4K3ID 3V5WB
chains in the Genus database with same CATH superfamily
3O4IA 4ES0A 4O3TB 3IJ0A 4A0AB 5HDBA 2CE8A 3ODTA 4GQBB 3SCYA 4LG8A 4FB1D 5C86A 4GM3A 4E5ZB 4QT8A 2B5NA 4A0BA 3IJEA 3IUMA 4PNKB 3BG1A 4BCDA 1JMZB 1YFQA 2HXCA 3JPXA 4J8GA 2AH0A 2J57G 3RN0D 5M5TA 3PSCB 2YNPA 4J77A 2IURA 4JT5C 1O6GA 5TF2A 3MKQA 2P9SC 2QZPA 2GC4A 2I3SA 1UOQA 2BCJB 2CN2A 1UOOA 2VDMA 3OL2A 3DXMC 4JSXC 4E54B 3AL8B 3RFGA 4JSNC 4U1EI 2AQ5A 3EI3A 4ZOZA 1PGUA 2H6QA 2XE4A 5E6RA 4UM8A 5FKRA 2VDPA 3L4MD 5TEFA 3JZGA 3SBPA 4NC4A 4GGDA 4E54A 5EMJB 2O9KA 2VDLA 3NVQA 1L5GA 5IGQA 3OF7A 4E5ZA 3I7NA 5M5SA 4QRJA 3IIYA 2YNOA 3UVLA 2CO0A 3OTTA 4G1EA 4O9DA 3EI3B 2GNQA 4PBYA 3I7KA 2EICA 1XHMA 4G55A 5CXCA 2I0TA 4A09A 4L9OA 4X60B 3OKYB 1JOFA 2J56H 3V4PA 5EMMB 3N0DA 5AMSA 1E8NA 5H1MA 4ZOYA 2H3XA 4WJKA 2VDOA 2MTAH 2P9PC 4G56B 2OVRB 4NBMA 1QFSA 3NIFA 3MKSB 4PSXB 4L3GD 1K3IA 3SWSD 4RE5A 3SJLD 4A11B 4UI9R 4L1MA 4IMMA 3SVWD 2B4EA 3I2NA 4J0XA 4FHLA 1U4CA 4Z8LA 2B5LA 3EI4A 3JROA 2AGLA 2IWKA 2PM9B 5M5UA 2VDRA 4DNWA 4PBZA 5FFOA 4BL0A 1MG3A 2CO0C 4U7AA 3J80g 4J73A 4OZUA 3A0FA 3OKWA 4NAAA 3SLED 2YBAA 3MVDK 3GFCA 4D6VA 5HE3B 3F3FA 2TRCB 2H13A 3OKYA 3PSLA 3B7FA 3DXKC 1K8KC 1UTCA 3CIKB 5EAMA 4J78A 3AH8B 4L3HD 4BCBA 2OVQB 4G1MA 4D0KA 4XEIC 4FA1D 3CFVA 5TEEA 5FA5B 3JRPA 3C5MA 3KCIA 4PSWB 3P4FA 4CY5A 4JHNA 5SXMA 5HE1B 4PXWA 4ZOXA 5EALA 2XDWA 3VI3A 1T2XA 3UKRC 5K1CC 2H9MA 1JV2A 5C92A 2I0SA 4CI2A 3VH0A 4A08B 2XL2A 3SXTD 5HE2B 2OK4A 1R5MA 3AL9A 4J86A 5JWZA 1H2ZA 3KRXB 2W18A 3DDUA 4BP9A 3PXWD 2HKRA 3U4YA 4JHPC 4ZOVA 2VZ1A 3NIGA 3UVKA 5FLXg 3MUOA 2B5MA 3BG0A 4O1QD 3GREA 4A08A 1C9IA 3I8EA 4GQ2P 1ERJA 1Q47A 2P9KC 5EAPA 3RLMD 5GSAA 3AFCA 1TBGA 4A2MA 3I89A 2P9NC 1OLZA 3NVXA 3I7OA 4MK0B 4AX4A 2WQ8A 5I5IA 3EI4B 3EG6A 3C99A 1I2MB 5HE0B 3RSEC 4CZVA 4AMZA 3CFSB 3O4GA 5THAA 3ZWLB 4CY3A 3I8CA 5C2WB 3IUQA 4I79A 2H6NA 1C9LA 4FA9D 3ZE2A 2H14A 4JD2C 4ZN4A 2IAAA 5EM2A 1VE6A 2XU7A 1NR0A 4X3EA 5E6UA 4BP8A 2CNXA 4A2LA 5IT9g 2HJ4A 5FKQA 3UVOA 2H6KA 3K71A 2I3TA 4AMYA 1UOPA 2VZ3A 2YB8B 5HQGA 4Z7NA 1RI6A 3MUNA 3EQ9A 4RE6A 3DM0A 3V7DB 3DSMA 4CI8A 2OIZA 3SBRA 5IJ8E 4WK2A 3N0EA 3OKTA 3IULA 4QAMA 4FA4D 3EQ7A 1SQJA 3MMYA 5IGOA 4A09B 5FKTA 4X61B 4O3UB 4ERYA 5FQDA 2UZXB 1U8CA 4JXMA 4CY2A 3FCSA 4J0WA 4YVDA 3UKUC 4FAND 4XYIA 3IUJA 1MG2A 2P9IC 3O4JA 4LG9A 4BH6A 1B9YA 3I7LA 4O02A 2PBIB 1A0RB 3PVUB 3GD1I 3FM0A 5H17A 1QFMA 2CE9A 3SFZA 5FKSA 2PM6B 4OWRA 3L4OD 1FWXA 3UR4A 4DNVA 1O6FA 5GXHA 3AL8A 3EMHA 3GC3B 4CI3A 5CYKB 5C2VB 3IUNA 2G99A 4WK4A 4TZ4A 5KDOB 2EBSA 2IUQA 1H2XA 3V4VA 2YMUA 2OK6A 3K72A 1PBYB 1VE7A 3IJ1A 4J81A 4H5JA 4LGNA 3IJCA 1H2WA 3PXTD 1SQ9A 3DWLC 1VYHC 4ERQA 2IWFA 2UZYB 2BBKH 3IVMA 3ZDXA 1SHYB 4Z7QA 4J87A 2OJYA 2PM9A 3J81g 1N6FA 3ULEC 3UVMA 1B9XA 4FWWA 2H47A 4PC0A 3IIWA 4ERZA 1BPOA 5I5JA 2GC7A 2P9UC 4GZ8A 2QR5A 3FCUA 2VC2A 5CXBA 3IURA 4R7AB 4CZYA 4FA5D 2PM7B 1H2YA 2VDKA 2BKLA 3EU7A 3RFHA 4AEZA 5A2Qg 5CXBB 4D9SA 5CYKA 2AGZA 4GQ1A 3ORVD 4Y7RA 3OW8A 5FXYA 4A0BB 4GMBA 1A12A 3KRWB 3ZDZA 3MXXA 3MZKA 5EARA 1TYEA 3SN6B 2H9LA 1S4UX 2HU8A 3K26A 1VZ2A 3PVWB 2HKMA 5M61A 2Z2PA 3RMZD 5K19A 2XZGA 5CXCB 2IUVA 1E5TA 4MMZA 5HYNB 2AGXA 4JSVC 4KFMB 2OVPB 5GXIA 1L0QA 2EIDA 3VGZA 3FRXA 3T3MA 3C9CA 4BUJC 2JKXA 4JT6C 3W15A 1E8MA 4NENA 4HDJA 2XL3A 3JZNA 1K32A 3JB9L 2Z2NA 3RN1D 4J82A 1NEXB 5B4WA 4N14A 4NSXA 5H14A 4QL1A 3JZHA 1YR2A 1GOFA 1N6DA 2IUPA 4J8BA 4FAVD 1XIPA 4CC9A 4MMYA 3I7PA 2H9NA 3RRMC 4Z7OA 4MMXA 5EM2B 3EI1A 2AH1A 2XYIA 5E6SA 2H68A 3JAMg 2J55H 2HU5A 4ESGA 3K27A 3EI2B 3T3PA 2QXVA 3EI1B 4L1QD 3PXSD 4UM9A 4WK0A 5IJ7E 2HESX 2HU7A 3BWSA 3EQ8A 3NIDA 1XKSA 3QHYB 2AGYA 3F3GA 1M1XA 4GM9A 4BCCA 4A0AA 5AFU3 4A11A 3FGBA 4IA9A 1JMXB 4K3JB 4GGAA 4X63B 3ZE0A 2Q7QA 3VI4A 2I0RA 3MZLA 1VZ3A 4AN0A 3SHFA 4AN1A 3EWEA 4CI1A 3VA6A 4O45A 4AOWA 4CY1A 3IKOA 3SMRA 1U2VC 3PE7A 5M5VA 5IC7A 3EI2A 4EWRA 3ZDYA 4CZXA 2CN3A 1P22A 3E0CA 1PI6A 1JTDB 1GP2B 2P9LC 3OL2B 5EMKB 1GXRA 2HJBA 2G9AA 1MDAH 3HFQA 2VDQA 5EMLB 3SBQA 5GMKn 2HYEA 4GGCA 4XYHA 3F3PA 4J79A 2QC5A 3O4HA 5TDHB 4O2WA 1N6EA 2Z2OA 5M5RA 1OMWB 1TYQC 3ZE1A 4A7JA 5FFGA 4QQEA 1JJUB 5AJAA 1QNIA 4GM8A 4H5IA 4J84A 1GG2B 5I5MA 1GOHA 2EIEA 4Y5RD 4IRZA 3UVNA 5C9ZB 1GOTB 4DNUA 3K6SA 2H9PA 2AGWA 2EIBA 3I7HA 3C75H 2VDNA 3QI0A 2YNNA 3V9FA 1PEVA 3NVNA 4JSPC 4K3ID 3V5WB 1GOGA
chains in the Genus database with same CATH topology
4ES0A 4O3TB 3IJ0A 4A0AB 2CE8A 3ODTA 4GQBB 3SCYA 4LG8A 4FB1D 4GM3A 4E5ZB 4QT8A 2B5NA 4A0BA 4PNKB 3BG1A 1JMZB 1YFQA 2HXCA 3JPXA 4J8GA 2AH0A 2J57G 3RN0D 3PSCB 2YNPA 4J77A 2IURA 4JT5C 5TF2A 2P9SC 3MKQA 2GC4A 2I3SA 2BCJB 2CN2A 3DXMC 3OL2A 4JSXC 4E54B 3AL8B 3RFGA 4JSNC 4U1EI 2AQ5A 3EI3A 4ZOZA 1PGUA 2H6QA 5FKRA 5TEFA 3L4MD 3JZGA 3SBPA 4GGDA 4E54A 5EMJB 2O9KA 3NVQA 5IGQA 4E5ZA 3I7NA 4QRJA 3IIYA 2YNOA 3UVLA 2CO0A 3OTTA 4O9DA 3EI3B 2GNQA 4PBYA 3I7KA 1XHMA 5CXCA 2I0TA 4A09A 4L9OA 4X60B 3OKYB 1JOFA 2J56H 5EMMB 3N0DA 5AMSA 5H1MA 4ZOYA 2H3XA 2MTAH 2P9PC 4G56B 2OVRB 3MKSB 4PSXB 4L3GD 3SWSD 3SJLD 4A11B 4UI9R 4IMMA 3SVWD 2B4EA 3I2NA 4J0XA 4FHLA 1U4CA 4Z8LA 2B5LA 3EI4A 3JROA 2AGLA 2IWKA 2PM9B 4PBZA 4BL0A 1MG3A 2CO0C 4U7AA 3J80g 4J73A 4OZUA 3A0FA 3OKWA 3SLED 2YBAA 3GFCA 4D6VA 5HE3B 3F3FA 2TRCB 2H13A 3OKYA 3PSLA 3B7FA 3DXKC 1K8KC 3CIKB 5EAMA 4J78A 3AH8B 4L3HD 2OVQB 4D0KA 4XEIC 4FA1D 3CFVA 5TEEA 5FA5B 3JRPA 3C5MA 4PSWB 3P4FA 4CY5A 5SXMA 5HE1B 4PXWA 4ZOXA 5EALA 3UKRC 5K1CC 2H9MA 2I0SA 4CI2A 3VH0A 4A08B 2XL2A 3SXTD 5HE2B 2OK4A 1R5MA 3AL9A 4J86A 5JWZA 3KRXB 2W18A 3PXWD 2HKRA 3U4YA 4ZOVA 3UVKA 5FLXg 2B5MA 3BG0A 4O1QD 3GREA 4A08A 3I8EA 4GQ2P 1ERJA 1Q47A 2P9KC 5EAPA 3RLMD 5GSAA 3AFCA 1TBGA 4A2MA 3I89A 2P9NC 1OLZA 3NVXA 3I7OA 4MK0B 5I5IA 3EI4B 3EG6A 3C99A 5HE0B 3RSEC 4CZVA 3CFSB 4CY3A 5THAA 3ZWLB 5C2WB 3I8CA 4I79A 2H6NA 4FA9D 2H14A 4JD2C 4ZN4A 2IAAA 5EM2A 2XU7A 1NR0A 4X3EA 2CNXA 4A2LA 5IT9g 2HJ4A 5FKQA 3UVOA 2H6KA 2I3TA 2YB8B 5HQGA 1RI6A 3DM0A 3V7DB 3DSMA 4CI8A 2OIZA 3SBRA 5IJ8E 3N0EA 3OKTA 4FA4D 1SQJA 3MMYA 5IGOA 4A09B 5FKTA 4X61B 4O3UB 4ERYA 5FQDA 2UZXB 4JXMA 4CY2A 4J0WA 4YVDA 3UKUC 4FAND 4XYIA 1MG2A 2P9IC 4LG9A 4BH6A 1B9YA 3I7LA 2PBIB 1A0RB 3PVUB 3FM0A 5H17A 2CE9A 3SFZA 5FKSA 2PM6B 4OWRA 3L4OD 1FWXA 3UR4A 5GXHA 3AL8A 3EMHA 4CI3A 5CYKB 5C2VB 2G99A 4TZ4A 5KDOB 2EBSA 2IUQA 2YMUA 2OK6A 1PBYB 3IJ1A 4J81A 4H5JA 4LGNA 3IJCA 3PXTD 1SQ9A 3DWLC 1VYHC 4ERQA 2IWFA 2UZYB 2BBKH 1SHYB 4J87A 2OJYA 2PM9A 3J81g 1N6FA 3ULEC 3UVMA 1B9XA 4FWWA 2H47A 4PC0A 3IIWA 4ERZA 5I5JA 2GC7A 2P9UC 4GZ8A 5CXBA 4R7AB 4CZYA 4FA5D 2PM7B 3EU7A 3RFHA 4AEZA 5A2Qg 5CXBB 5CYKA 2AGZA 4GQ1A 3ORVD 4Y7RA 3OW8A 5FXYA 4A0BB 4GMBA 3KRWB 3MXXA 3MZKA 5EARA 3SN6B 2H9LA 1S4UX 3K26A 3PVWB 2HKMA 2Z2PA 3RMZD 5K19A 5CXCB 2IUVA 5HYNB 2AGXA 4JSVC 4KFMB 2OVPB 5GXIA 1L0QA 3VGZA 3FRXA 4BUJC 3C9CA 4JT6C 3W15A 4HDJA 2XL3A 3JZNA 1K32A 3JB9L 2Z2NA 3RN1D 4J82A 1NEXB 5B4WA 4N14A 4NSXA 5H14A 4QL1A 3JZHA 1N6DA 2IUPA 4J8BA 4FAVD 1XIPA 4CC9A 3I7PA 2H9NA 3RRMC 5EM2B 3EI1A 2AH1A 2XYIA 2H68A 3JAMg 2J55H 4ESGA 3K27A 3EI2B 3EI1B 2QXVA 4L1QD 3PXSD 5IJ7E 2HESX 3BWSA 1XKSA 2AGYA 3F3GA 4GM9A 4A0AA 5AFU3 4A11A 3FGBA 4K3JB 1JMXB 4X63B 4GGAA 4IA9A 2Q7QA 2I0RA 3MZLA 3SHFA 3EWEA 4CI1A 3VA6A 4O45A 4AOWA 4CY1A 3IKOA 3SMRA 1U2VC 3PE7A 5IC7A 3EI2A 4EWRA 4CZXA 2CN3A 1P22A 3E0CA 1PI6A 1GP2B 2P9LC 3OL2B 5EMKB 1GXRA 2HJBA 2G9AA 1MDAH 3HFQA 5EMLB 3SBQA 5GMKn 2HYEA 4GGCA 4XYHA 3F3PA 4J79A 2QC5A 5TDHB 1N6EA 2Z2OA 1OMWB 1TYQC 4A7JA 4QQEA 1JJUB 5AJAA 1QNIA 4GM8A 4H5IA 4J84A 1GG2B 5I5MA 4Y5RD 3UVNA 5C9ZB 1GOTB 2H9PA 2AGWA 3I7HA 3C75H 3V9FA 2YNNA 1PEVA 3NVNA 4JSPC 4K3ID 3V5WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ES0 A;  4O3T B;  3IJ0 A;  4A0A B;  2CE8 A;  3ODT A;  4GQB B;  3SCY A;  4LG8 A;  4FB1 D;  4GM3 A;  4E5Z B;  4QT8 A;  2B5N A;  4A0B A;  4PNK B;  3BG1 A;  1JMZ B;  1YFQ A;  2HXC A;  3JPX A;  4J8G A;  2AH0 A;  2J57 G;  3RN0 D;  3PSC B;  2YNP A;  4J77 A;  2IUR A;  4JT5 C;  5TF2 A;  2P9S C;  3MKQ A;  2GC4 A;  2I3S A;  2BCJ B;  2CN2 A;  3DXM C;  3OL2 A;  4JSX C;  4E54 B;  3AL8 B;  3RFG A;  4JSN C;  4U1E I;  2AQ5 A;  3EI3 A;  4ZOZ A;  1PGU A;  2H6Q A;  5FKR A;  5TEF A;  3L4M D;  3JZG A;  3SBP A;  4GGD A;  4E54 A;  5EMJ B;  2O9K A;  3NVQ A;  5IGQ A;  4E5Z A;  3I7N A;  4QRJ A;  3IIY A;  2YNO A;  3UVL A;  2CO0 A;  3OTT A;  4O9D A;  3EI3 B;  2GNQ A;  4PBY A;  3I7K A;  1XHM A;  5CXC A;  2I0T A;  4A09 A;  4L9O A;  4X60 B;  3OKY B;  1JOF A;  2J56 H;  5EMM B;  3N0D A;  5AMS A;  5H1M A;  4ZOY A;  2H3X A;  2MTA H;  2P9P C;  4G56 B;  2OVR B;  3MKS B;  4PSX B;  4L3G D;  3SWS D;  3SJL D;  4A11 B;  4UI9 R;  4IMM A;  3SVW D;  2B4E A;  3I2N A;  4J0X A;  4FHL A;  1U4C A;  4Z8L A;  2B5L A;  3EI4 A;  3JRO A;  2AGL A;  2IWK A;  2PM9 B;  4PBZ A;  4BL0 A;  1MG3 A;  2CO0 C;  4U7A A;  3J80 g;  4J73 A;  4OZU A;  3A0F A;  3OKW A;  3SLE D;  2YBA A;  3GFC A;  4D6V A;  5HE3 B;  3F3F A;  2TRC B;  2H13 A;  3OKY A;  3PSL A;  3B7F A;  3DXK C;  1K8K C;  3CIK B;  5EAM A;  4J78 A;  3AH8 B;  4L3H D;  2OVQ B;  4D0K A;  4XEI C;  4FA1 D;  3CFV A;  5TEE A;  5FA5 B;  3JRP A;  3C5M A;  4PSW B;  3P4F A;  4CY5 A;  5SXM A;  5HE1 B;  4PXW A;  4ZOX A;  5EAL A;  3UKR C;  5K1C C;  2H9M A;  2I0S A;  4CI2 A;  3VH0 A;  4A08 B;  2XL2 A;  3SXT D;  5HE2 B;  2OK4 A;  1R5M A;  3AL9 A;  4J86 A;  5JWZ A;  3KRX B;  2W18 A;  3PXW D;  2HKR A;  3U4Y A;  4ZOV A;  3UVK A;  5FLX g;  2B5M A;  3BG0 A;  4O1Q D;  3GRE A;  4A08 A;  3I8E A;  4GQ2 P;  1ERJ A;  1Q47 A;  2P9K C;  5EAP A;  3RLM D;  5GSA A;  3AFC A;  1TBG A;  4A2M A;  3I89 A;  2P9N C;  1OLZ A;  3NVX A;  3I7O A;  4MK0 B;  5I5I A;  3EI4 B;  3EG6 A;  3C99 A;  5HE0 B;  3RSE C;  4CZV A;  3CFS B;  4CY3 A;  5THA A;  3ZWL B;  5C2W B;  3I8C A;  4I79 A;  2H6N A;  4FA9 D;  2H14 A;  4JD2 C;  4ZN4 A;  2IAA A;  5EM2 A;  2XU7 A;  1NR0 A;  4X3E A;  2CNX A;  4A2L A;  5IT9 g;  2HJ4 A;  5FKQ A;  3UVO A;  2H6K A;  2I3T A;  2YB8 B;  5HQG A;  1RI6 A;  3DM0 A;  3V7D B;  3DSM A;  4CI8 A;  2OIZ A;  3SBR A;  5IJ8 E;  3N0E A;  3OKT A;  4FA4 D;  1SQJ A;  3MMY A;  5IGO A;  4A09 B;  5FKT A;  4X61 B;  4O3U B;  4ERY A;  5FQD A;  2UZX B;  4JXM A;  4CY2 A;  4J0W A;  4YVD A;  3UKU C;  4FAN D;  4XYI A;  1MG2 A;  2P9I C;  4LG9 A;  4BH6 A;  1B9Y A;  3I7L A;  2PBI B;  1A0R B;  3PVU B;  3FM0 A;  5H17 A;  2CE9 A;  3SFZ A;  5FKS A;  2PM6 B;  4OWR A;  3L4O D;  1FWX A;  3UR4 A;  5GXH A;  3AL8 A;  3EMH A;  4CI3 A;  5CYK B;  5C2V B;  2G99 A;  4TZ4 A;  5KDO B;  2EBS A;  2IUQ A;  2YMU A;  2OK6 A;  1PBY B;  3IJ1 A;  4J81 A;  4H5J A;  4LGN A;  3IJC A;  3PXT D;  1SQ9 A;  3DWL C;  1VYH C;  4ERQ A;  2IWF A;  2UZY B;  2BBK H;  1SHY B;  4J87 A;  2OJY A;  2PM9 A;  3J81 g;  1N6F A;  3ULE C;  3UVM A;  1B9X A;  4FWW A;  2H47 A;  4PC0 A;  3IIW A;  4ERZ A;  5I5J A;  2GC7 A;  2P9U C;  4GZ8 A;  5CXB A;  4R7A B;  4CZY A;  4FA5 D;  2PM7 B;  3EU7 A;  3RFH A;  4AEZ A;  5A2Q g;  5CXB B;  5CYK A;  2AGZ A;  4GQ1 A;  3ORV D;  4Y7R A;  3OW8 A;  5FXY A;  4A0B B;  4GMB A;  3KRW B;  3MXX A;  3MZK A;  5EAR A;  3SN6 B;  2H9L A;  1S4U X;  3K26 A;  3PVW B;  2HKM A;  2Z2P A;  3RMZ D;  5K19 A;  5CXC B;  2IUV A;  5HYN B;  2AGX A;  4JSV C;  4KFM B;  2OVP B;  5GXI A;  1L0Q A;  3VGZ A;  3FRX A;  4BUJ C;  3C9C A;  4JT6 C;  3W15 A;  4HDJ A;  2XL3 A;  3JZN A;  1K32 A;  3JB9 L;  2Z2N A;  3RN1 D;  4J82 A;  1NEX B;  5B4W A;  4N14 A;  4NSX A;  5H14 A;  4QL1 A;  3JZH A;  1N6D A;  2IUP A;  4J8B A;  4FAV D;  1XIP A;  4CC9 A;  3I7P A;  2H9N A;  3RRM C;  5EM2 B;  3EI1 A;  2AH1 A;  2XYI A;  2H68 A;  3JAM g;  2J55 H;  4ESG A;  3K27 A;  3EI2 B;  3EI1 B;  2QXV A;  4L1Q D;  3PXS D;  5IJ7 E;  2HES X;  3BWS A;  1XKS A;  2AGY A;  3F3G A;  4GM9 A;  4A0A A;  5AFU 3;  4A11 A;  3FGB A;  4K3J B;  1JMX B;  4X63 B;  4GGA A;  4IA9 A;  2Q7Q A;  2I0R A;  3MZL A;  3SHF A;  3EWE A;  4CI1 A;  3VA6 A;  4O45 A;  4AOW A;  4CY1 A;  3IKO A;  3SMR A;  1U2V C;  3PE7 A;  5IC7 A;  3EI2 A;  4EWR A;  4CZX A;  2CN3 A;  1P22 A;  3E0C A;  1PI6 A;  1GP2 B;  2P9L C;  3OL2 B;  5EMK B;  1GXR A;  2HJB A;  2G9A A;  1MDA H;  3HFQ A;  5EML B;  3SBQ A;  5GMK n;  2HYE A;  4GGC A;  4XYH A;  3F3P A;  4J79 A;  2QC5 A;  5TDH B;  1N6E A;  2Z2O A;  1OMW B;  1TYQ C;  4A7J A;  4QQE A;  1JJU B;  5AJA A;  1QNI A;  4GM8 A;  4H5I A;  4J84 A;  1GG2 B;  5I5M A;  4Y5R D;  3UVN A;  5C9Z B;  1GOT B;  2H9P A;  2AGW A;  3I7H A;  3C75 H;  3V9F A;  2YNN A;  1PEV A;  3NVN A;  4JSP C;  4K3I D;  3V5W B; 
#chains in the Genus database with same CATH topology
 3O4I A;  4ES0 A;  4O3T B;  3IJ0 A;  4A0A B;  5HDB A;  2CE8 A;  3ODT A;  4GQB B;  3SCY A;  4LG8 A;  4FB1 D;  5C86 A;  4GM3 A;  4E5Z B;  4QT8 A;  2B5N A;  4A0B A;  3IJE A;  3IUM A;  4PNK B;  3BG1 A;  4BCD A;  1JMZ B;  1YFQ A;  2HXC A;  3JPX A;  4J8G A;  2AH0 A;  2J57 G;  3RN0 D;  5M5T A;  3PSC B;  2YNP A;  4J77 A;  2IUR A;  4JT5 C;  1O6G A;  5TF2 A;  3MKQ A;  2P9S C;  2QZP A;  2GC4 A;  2I3S A;  1UOQ A;  2BCJ B;  2CN2 A;  1UOO A;  2VDM A;  3OL2 A;  3DXM C;  4JSX C;  4E54 B;  3AL8 B;  3RFG A;  4JSN C;  4U1E I;  2AQ5 A;  3EI3 A;  4ZOZ A;  1PGU A;  2H6Q A;  2XE4 A;  5E6R A;  4UM8 A;  5FKR A;  2VDP A;  3L4M D;  5TEF A;  3JZG A;  3SBP A;  4NC4 A;  4GGD A;  4E54 A;  5EMJ B;  2O9K A;  2VDL A;  3NVQ A;  1L5G A;  5IGQ A;  3OF7 A;  4E5Z A;  3I7N A;  5M5S A;  4QRJ A;  3IIY A;  2YNO A;  3UVL A;  2CO0 A;  3OTT A;  4G1E A;  4O9D A;  3EI3 B;  2GNQ A;  4PBY A;  3I7K A;  2EIC A;  1XHM A;  4G55 A;  5CXC A;  2I0T A;  4A09 A;  4L9O A;  4X60 B;  3OKY B;  1JOF A;  2J56 H;  3V4P A;  5EMM B;  3N0D A;  5AMS A;  1E8N A;  5H1M A;  4ZOY A;  2H3X A;  4WJK A;  2VDO A;  2MTA H;  2P9P C;  4G56 B;  2OVR B;  4NBM A;  1QFS A;  3NIF A;  3MKS B;  4PSX B;  4L3G D;  1K3I A;  3SWS D;  4RE5 A;  3SJL D;  4A11 B;  4UI9 R;  4L1M A;  4IMM A;  3SVW D;  2B4E A;  3I2N A;  4J0X A;  4FHL A;  1U4C A;  4Z8L A;  2B5L A;  3EI4 A;  3JRO A;  2AGL A;  2IWK A;  2PM9 B;  5M5U A;  2VDR A;  4DNW A;  4PBZ A;  5FFO A;  4BL0 A;  1MG3 A;  2CO0 C;  4U7A A;  3J80 g;  4J73 A;  4OZU A;  3A0F A;  3OKW A;  4NAA A;  3SLE D;  2YBA A;  3MVD K;  3GFC A;  4D6V A;  5HE3 B;  3F3F A;  2TRC B;  2H13 A;  3OKY A;  3PSL A;  3B7F A;  3DXK C;  1K8K C;  1UTC A;  3CIK B;  5EAM A;  4J78 A;  3AH8 B;  4L3H D;  4BCB A;  2OVQ B;  4G1M A;  4D0K A;  4XEI C;  4FA1 D;  3CFV A;  5TEE A;  5FA5 B;  3JRP A;  3C5M A;  3KCI A;  4PSW B;  3P4F A;  4CY5 A;  4JHN A;  5SXM A;  5HE1 B;  4PXW A;  4ZOX A;  5EAL A;  2XDW A;  3VI3 A;  1T2X A;  3UKR C;  5K1C C;  2H9M A;  1JV2 A;  5C92 A;  2I0S A;  4CI2 A;  3VH0 A;  4A08 B;  2XL2 A;  3SXT D;  5HE2 B;  2OK4 A;  1R5M A;  3AL9 A;  4J86 A;  5JWZ A;  1H2Z A;  3KRX B;  2W18 A;  3DDU A;  4BP9 A;  3PXW D;  2HKR A;  3U4Y A;  4JHP C;  4ZOV A;  2VZ1 A;  3NIG A;  3UVK A;  5FLX g;  3MUO A;  2B5M A;  3BG0 A;  4O1Q D;  3GRE A;  4A08 A;  1C9I A;  3I8E A;  4GQ2 P;  1ERJ A;  1Q47 A;  2P9K C;  5EAP A;  3RLM D;  5GSA A;  3AFC A;  1TBG A;  4A2M A;  3I89 A;  2P9N C;  1OLZ A;  3NVX A;  3I7O A;  4MK0 B;  4AX4 A;  2WQ8 A;  5I5I A;  3EI4 B;  3EG6 A;  3C99 A;  1I2M B;  5HE0 B;  3RSE C;  4CZV A;  4AMZ A;  3CFS B;  3O4G A;  5THA A;  3ZWL B;  4CY3 A;  3I8C A;  5C2W B;  3IUQ A;  4I79 A;  2H6N A;  1C9L A;  4FA9 D;  3ZE2 A;  2H14 A;  4JD2 C;  4ZN4 A;  2IAA A;  5EM2 A;  1VE6 A;  2XU7 A;  1NR0 A;  4X3E A;  5E6U A;  4BP8 A;  2CNX A;  4A2L A;  5IT9 g;  2HJ4 A;  5FKQ A;  3UVO A;  2H6K A;  3K71 A;  2I3T A;  4AMY A;  1UOP A;  2VZ3 A;  2YB8 B;  5HQG A;  4Z7N A;  1RI6 A;  3MUN A;  3EQ9 A;  4RE6 A;  3DM0 A;  3V7D B;  3DSM A;  4CI8 A;  2OIZ A;  3SBR A;  5IJ8 E;  4WK2 A;  3N0E A;  3OKT A;  3IUL A;  4QAM A;  4FA4 D;  3EQ7 A;  1SQJ A;  3MMY A;  5IGO A;  4A09 B;  5FKT A;  4X61 B;  4O3U B;  4ERY A;  5FQD A;  2UZX B;  1U8C A;  4JXM A;  4CY2 A;  3FCS A;  4J0W A;  4YVD A;  3UKU C;  4FAN D;  4XYI A;  3IUJ A;  1MG2 A;  2P9I C;  3O4J A;  4LG9 A;  4BH6 A;  1B9Y A;  3I7L A;  4O02 A;  2PBI B;  1A0R B;  3PVU B;  3GD1 I;  3FM0 A;  5H17 A;  1QFM A;  2CE9 A;  3SFZ A;  5FKS A;  2PM6 B;  4OWR A;  3L4O D;  1FWX A;  3UR4 A;  4DNV A;  1O6F A;  5GXH A;  3AL8 A;  3EMH A;  3GC3 B;  4CI3 A;  5CYK B;  5C2V B;  3IUN A;  2G99 A;  4WK4 A;  4TZ4 A;  5KDO B;  2EBS A;  2IUQ A;  1H2X A;  3V4V A;  2YMU A;  2OK6 A;  3K72 A;  1PBY B;  1VE7 A;  3IJ1 A;  4J81 A;  4H5J A;  4LGN A;  3IJC A;  1H2W A;  3PXT D;  1SQ9 A;  3DWL C;  1VYH C;  4ERQ A;  2IWF A;  2UZY B;  2BBK H;  3IVM A;  3ZDX A;  1SHY B;  4Z7Q A;  4J87 A;  2OJY A;  2PM9 A;  3J81 g;  1N6F A;  3ULE C;  3UVM A;  1B9X A;  4FWW A;  2H47 A;  4PC0 A;  3IIW A;  4ERZ A;  1BPO A;  5I5J A;  2GC7 A;  2P9U C;  4GZ8 A;  2QR5 A;  3FCU A;  2VC2 A;  5CXB A;  3IUR A;  4R7A B;  4CZY A;  4FA5 D;  2PM7 B;  1H2Y A;  2VDK A;  2BKL A;  3EU7 A;  3RFH A;  4AEZ A;  5A2Q g;  5CXB B;  4D9S A;  5CYK A;  2AGZ A;  4GQ1 A;  3ORV D;  4Y7R A;  3OW8 A;  5FXY A;  4A0B B;  4GMB A;  1A12 A;  3KRW B;  3ZDZ A;  3MXX A;  3MZK A;  5EAR A;  1TYE A;  3SN6 B;  2H9L A;  1S4U X;  2HU8 A;  3K26 A;  1VZ2 A;  3PVW B;  2HKM A;  5M61 A;  2Z2P A;  3RMZ D;  5K19 A;  2XZG A;  5CXC B;  2IUV A;  1E5T A;  4MMZ A;  5HYN B;  2AGX A;  4JSV C;  4KFM B;  2OVP B;  5GXI A;  1L0Q A;  2EID A;  3VGZ A;  3FRX A;  3T3M A;  3C9C A;  4BUJ C;  2JKX A;  4JT6 C;  3W15 A;  1E8M A;  4NEN A;  4HDJ A;  2XL3 A;  3JZN A;  1K32 A;  3JB9 L;  2Z2N A;  3RN1 D;  4J82 A;  1NEX B;  5B4W A;  4N14 A;  4NSX A;  5H14 A;  4QL1 A;  3JZH A;  1YR2 A;  1GOF A;  1N6D A;  2IUP A;  4J8B A;  4FAV D;  1XIP A;  4CC9 A;  4MMY A;  3I7P A;  2H9N A;  3RRM C;  4Z7O A;  4MMX A;  5EM2 B;  3EI1 A;  2AH1 A;  2XYI A;  5E6S A;  2H68 A;  3JAM g;  2J55 H;  2HU5 A;  4ESG A;  3K27 A;  3EI2 B;  3T3P A;  2QXV A;  3EI1 B;  4L1Q D;  3PXS D;  4UM9 A;  4WK0 A;  5IJ7 E;  2HES X;  2HU7 A;  3BWS A;  3EQ8 A;  3NID A;  1XKS A;  3QHY B;  2AGY A;  3F3G A;  1M1X A;  4GM9 A;  4BCC A;  4A0A A;  5AFU 3;  4A11 A;  3FGB A;  4IA9 A;  1JMX B;  4K3J B;  4GGA A;  4X63 B;  3ZE0 A;  2Q7Q A;  3VI4 A;  2I0R A;  3MZL A;  1VZ3 A;  4AN0 A;  3SHF A;  4AN1 A;  3EWE A;  4CI1 A;  3VA6 A;  4O45 A;  4AOW A;  4CY1 A;  3IKO A;  3SMR A;  1U2V C;  3PE7 A;  5M5V A;  5IC7 A;  3EI2 A;  4EWR A;  3ZDY A;  4CZX A;  2CN3 A;  1P22 A;  3E0C A;  1PI6 A;  1JTD B;  1GP2 B;  2P9L C;  3OL2 B;  5EMK B;  1GXR A;  2HJB A;  2G9A A;  1MDA H;  3HFQ A;  2VDQ A;  5EML B;  3SBQ A;  5GMK n;  2HYE A;  4GGC A;  4XYH A;  3F3P A;  4J79 A;  2QC5 A;  3O4H A;  5TDH B;  4O2W A;  1N6E A;  2Z2O A;  5M5R A;  1OMW B;  1TYQ C;  3ZE1 A;  4A7J A;  5FFG A;  4QQE A;  1JJU B;  5AJA A;  1QNI A;  4GM8 A;  4H5I A;  4J84 A;  1GG2 B;  5I5M A;  1GOH A;  2EIE A;  4Y5R D;  4IRZ A;  3UVN A;  5C9Z B;  1GOT B;  4DNU A;  3K6S A;  2H9P A;  2AGW A;  2EIB A;  3I7H A;  3C75 H;  2VDN A;  3QI0 A;  2YNN A;  3V9F A;  1PEV A;  3NVN A;  4JSP C;  4K3I D;  3V5W B;  1GOG A; 
#chains in the Genus database with same CATH homology
 4ES0 A;  4O3T B;  3IJ0 A;  4A0A B;  2CE8 A;  3ODT A;  4GQB B;  3SCY A;  4LG8 A;  4FB1 D;  4GM3 A;  4E5Z B;  4QT8 A;  2B5N A;  4A0B A;  4PNK B;  3BG1 A;  1JMZ B;  1YFQ A;  2HXC A;  3JPX A;  4J8G A;  2AH0 A;  2J57 G;  3RN0 D;  3PSC B;  2YNP A;  4J77 A;  2IUR A;  4JT5 C;  5TF2 A;  2P9S C;  3MKQ A;  2GC4 A;  2I3S A;  2BCJ B;  2CN2 A;  3DXM C;  3OL2 A;  4JSX C;  4E54 B;  3AL8 B;  3RFG A;  4JSN C;  4U1E I;  2AQ5 A;  3EI3 A;  4ZOZ A;  1PGU A;  2H6Q A;  5FKR A;  5TEF A;  3L4M D;  3JZG A;  3SBP A;  4GGD A;  4E54 A;  5EMJ B;  2O9K A;  3NVQ A;  5IGQ A;  4E5Z A;  3I7N A;  4QRJ A;  3IIY A;  2YNO A;  3UVL A;  2CO0 A;  3OTT A;  4O9D A;  3EI3 B;  2GNQ A;  4PBY A;  3I7K A;  1XHM A;  5CXC A;  2I0T A;  4A09 A;  4L9O A;  4X60 B;  3OKY B;  1JOF A;  2J56 H;  5EMM B;  3N0D A;  5AMS A;  5H1M A;  4ZOY A;  2H3X A;  2MTA H;  2P9P C;  4G56 B;  2OVR B;  3MKS B;  4PSX B;  4L3G D;  3SWS D;  3SJL D;  4A11 B;  4UI9 R;  4IMM A;  3SVW D;  2B4E A;  3I2N A;  4J0X A;  4FHL A;  1U4C A;  4Z8L A;  2B5L A;  3EI4 A;  3JRO A;  2AGL A;  2IWK A;  2PM9 B;  4PBZ A;  4BL0 A;  1MG3 A;  2CO0 C;  4U7A A;  3J80 g;  4J73 A;  4OZU A;  3A0F A;  3OKW A;  3SLE D;  2YBA A;  3GFC A;  4D6V A;  5HE3 B;  3F3F A;  2TRC B;  2H13 A;  3OKY A;  3PSL A;  3B7F A;  3DXK C;  1K8K C;  3CIK B;  5EAM A;  4J78 A;  3AH8 B;  4L3H D;  2OVQ B;  4D0K A;  4XEI C;  4FA1 D;  3CFV A;  5TEE A;  5FA5 B;  3JRP A;  3C5M A;  4PSW B;  3P4F A;  4CY5 A;  5SXM A;  5HE1 B;  4PXW A;  4ZOX A;  5EAL A;  3UKR C;  5K1C C;  2H9M A;  2I0S A;  4CI2 A;  3VH0 A;  4A08 B;  2XL2 A;  3SXT D;  5HE2 B;  2OK4 A;  1R5M A;  3AL9 A;  4J86 A;  5JWZ A;  3KRX B;  2W18 A;  3PXW D;  2HKR A;  3U4Y A;  4ZOV A;  3UVK A;  5FLX g;  2B5M A;  3BG0 A;  4O1Q D;  3GRE A;  4A08 A;  3I8E A;  4GQ2 P;  1ERJ A;  1Q47 A;  2P9K C;  5EAP A;  3RLM D;  5GSA A;  3AFC A;  1TBG A;  4A2M A;  3I89 A;  2P9N C;  1OLZ A;  3NVX A;  3I7O A;  4MK0 B;  5I5I A;  3EI4 B;  3EG6 A;  3C99 A;  5HE0 B;  3RSE C;  4CZV A;  3CFS B;  4CY3 A;  5THA A;  3ZWL B;  5C2W B;  3I8C A;  4I79 A;  2H6N A;  4FA9 D;  2H14 A;  4JD2 C;  4ZN4 A;  2IAA A;  5EM2 A;  2XU7 A;  1NR0 A;  4X3E A;  2CNX A;  4A2L A;  5IT9 g;  2HJ4 A;  5FKQ A;  3UVO A;  2H6K A;  2I3T A;  2YB8 B;  5HQG A;  1RI6 A;  3DM0 A;  3V7D B;  3DSM A;  4CI8 A;  2OIZ A;  3SBR A;  5IJ8 E;  3N0E A;  3OKT A;  4FA4 D;  1SQJ A;  3MMY A;  5IGO A;  4A09 B;  5FKT A;  4X61 B;  4O3U B;  4ERY A;  5FQD A;  2UZX B;  4JXM A;  4CY2 A;  4J0W A;  4YVD A;  3UKU C;  4FAN D;  4XYI A;  1MG2 A;  2P9I C;  4LG9 A;  4BH6 A;  1B9Y A;  3I7L A;  2PBI B;  1A0R B;  3PVU B;  3FM0 A;  5H17 A;  2CE9 A;  3SFZ A;  5FKS A;  2PM6 B;  4OWR A;  3L4O D;  1FWX A;  3UR4 A;  5GXH A;  3AL8 A;  3EMH A;  4CI3 A;  5CYK B;  5C2V B;  2G99 A;  4TZ4 A;  5KDO B;  2EBS A;  2IUQ A;  2YMU A;  2OK6 A;  1PBY B;  3IJ1 A;  4J81 A;  4H5J A;  4LGN A;  3IJC A;  3PXT D;  1SQ9 A;  3DWL C;  1VYH C;  4ERQ A;  2IWF A;  2UZY B;  2BBK H;  1SHY B;  4J87 A;  2OJY A;  2PM9 A;  3J81 g;  1N6F A;  3ULE C;  3UVM A;  1B9X A;  4FWW A;  2H47 A;  4PC0 A;  3IIW A;  4ERZ A;  5I5J A;  2GC7 A;  2P9U C;  4GZ8 A;  5CXB A;  4R7A B;  4CZY A;  4FA5 D;  2PM7 B;  3EU7 A;  3RFH A;  4AEZ A;  5A2Q g;  5CXB B;  5CYK A;  2AGZ A;  4GQ1 A;  3ORV D;  4Y7R A;  3OW8 A;  5FXY A;  4A0B B;  4GMB A;  3KRW B;  3MXX A;  3MZK A;  5EAR A;  3SN6 B;  2H9L A;  1S4U X;  3K26 A;  3PVW B;  2HKM A;  2Z2P A;  3RMZ D;  5K19 A;  5CXC B;  2IUV A;  5HYN B;  2AGX A;  4JSV C;  4KFM B;  2OVP B;  5GXI A;  1L0Q A;  3VGZ A;  3FRX A;  4BUJ C;  3C9C A;  4JT6 C;  3W15 A;  4HDJ A;  2XL3 A;  3JZN A;  1K32 A;  3JB9 L;  2Z2N A;  3RN1 D;  4J82 A;  1NEX B;  5B4W A;  4N14 A;  4NSX A;  5H14 A;  4QL1 A;  3JZH A;  1N6D A;  2IUP A;  4J8B A;  4FAV D;  1XIP A;  4CC9 A;  3I7P A;  2H9N A;  3RRM C;  5EM2 B;  3EI1 A;  2AH1 A;  2XYI A;  2H68 A;  3JAM g;  2J55 H;  4ESG A;  3K27 A;  3EI2 B;  3EI1 B;  2QXV A;  4L1Q D;  3PXS D;  5IJ7 E;  2HES X;  3BWS A;  1XKS A;  2AGY A;  3F3G A;  4GM9 A;  4A0A A;  5AFU 3;  4A11 A;  3FGB A;  4K3J B;  1JMX B;  4X63 B;  4GGA A;  4IA9 A;  2Q7Q A;  2I0R A;  3MZL A;  3SHF A;  3EWE A;  4CI1 A;  3VA6 A;  4O45 A;  4AOW A;  4CY1 A;  3IKO A;  3SMR A;  1U2V C;  3PE7 A;  5IC7 A;  3EI2 A;  4EWR A;  4CZX A;  2CN3 A;  1P22 A;  3E0C A;  1PI6 A;  1GP2 B;  2P9L C;  3OL2 B;  5EMK B;  1GXR A;  2HJB A;  2G9A A;  1MDA H;  3HFQ A;  5EML B;  3SBQ A;  5GMK n;  2HYE A;  4GGC A;  4XYH A;  3F3P A;  4J79 A;  2QC5 A;  5TDH B;  1N6E A;  2Z2O A;  1OMW B;  1TYQ C;  4A7J A;  4QQE A;  1JJU B;  5AJA A;  1QNI A;  4GM8 A;  4H5I A;  4J84 A;  1GG2 B;  5I5M A;  4Y5R D;  3UVN A;  5C9Z B;  1GOT B;  2H9P A;  2AGW A;  3I7H A;  3C75 H;  3V9F A;  2YNN A;  1PEV A;  3NVN A;  4JSP C;  4K3I D;  3V5W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...