3SJLD

Crystal structure of the p107s-maug/pre-methylamine dehydrogenase complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
376
structure length
376
Chain Sequence
b'QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein mauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 95
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sjlD00
2HJ4A 3I89A 4J77A 2H3XA 4ZOYA 1JMXB 5GXHA 3EI3A 1VYHC 4J8BA 4G56B 3EI1A 3EU7A 3I7KA 2PM9A 5GSAA 5H17A 3VA6A 4U1EI 3OL2B 4U7AA 4A0BA 3OKTA 2AGXA 3AH8B 5B4WA 5HYNB 1QNIA 5K19A 5TF2A 1MDAH 4ZOXA 5HE3B 3P4FA 1JMZB 4FB1D 2GC7A 4R7AB 3PSCB 3DXKC 4E5ZA 2YMUA 4CY1A 3JROA 3MKSB 2BCJB 2J56H 4CY5A 3ORVD 5EMJB 4A0AB 4XYHA 4XYIA 3DWLC 1GP2B 4QT8A 3I7PA 2H14A 4JSNC 3SXTD 3F3GA 1R5MA 3UVMA 2H68A 4ERYA 1SQJA 5EM2A 2QXVA 5AFU3 3RLMD 2UZXB 4PNKB 2P9UC 4QRJA 4A7JA 3E0CA 5IGQA 1GOTB 2IUPA 5IT9g 4JXMA 4GQ2P 4LGNA 2XL2A 4O3UB 3MZKA 3OTTA 3K26A 3EI3B 2H6KA 2TRCB 4LG9A 4H5IA 5FKQA 3I7OA 4J84A 5FXYA 3PVWB 2I0RA 3UVNA 4KFMB 2Z2NA 5CXBA 3PXTD 3J80g 5TEEA 2OK4A 4A0BB 3KRXB 5EARA 5AJAA 5GXIA 3AL9A 2H9NA 3OW8A 4O1QD 1TYQC 4FA4D 2GC4A 3NVXA 2IURA 4GGDA 3MKQA 3DSMA 4CY3A 3C9CA 1XHMA 3IJ1A 3JZGA 5TEFA 3C5MA 2OVQB 4ERQA 4CI2A 2P9NC 3ODTA 2HKMA 3A0FA 4PSXB 4AEZA 1L0QA 4O9DA 3L4MD 1B9YA 1PI6A 2H9MA 2GNQA 4CY2A 4J73A 4CZVA 2YB8B 4X60B 3PXWD 3PE7A 1RI6A 3JZNA 5C2VB 3RRMC 3JPXA 1S4UX 4O45A 4A2MA 2I0TA 4J87A 4PC0A 1OLZA 4CI1A 2HKRA 3FM0A 3V7DB 4J0WA 3SHFA 5EM2B 4UI9R 2H47A 3RMZD 2QC5A 3BWSA 4J8GA 1SHYB 3JRPA 3K27A 5I5JA 4X3EA 4EWRA 2HJBA 4CZXA 5C2WB 3IKOA 2YBAA 2AQ5A 2YNOA 5GMKn 5JWZA 3JB9L 2I0SA 2IUVA 5HQGA 3DXMC 2CE9A 3BG1A 3SVWD 2H9PA 4I79A 4J79A 1U2VC 4YVDA 4J0XA 5EALA 4GQ1A 2G99A 1N6FA 4J81A 5CXCB 3SBQA 5H1MA 3F3FA 3IJ0A 1MG3A 3OKWA 5CXBB 3AFCA 3EI4B 5K1CC 5TDHB 2OVPB 3SWSD 4ESGA 3MMYA 3N0DA 2AGLA 5HE2B 4FAVD 4IMMA 3MXXA 4GGCA 3I7HA 4ZN4A 5A2Qg 4BL0A 3CIKB 4PBZA 3U4YA 4FHLA 3GREA 1K8KC 5IGOA 3UVLA 2CO0A 2CN3A 2AGZA 4QL1A 4PSWB 5FQDA 4ZOVA 3UKRC 4AOWA 2HYEA 4GZ8A 2H6NA 1K32A 3C75H 3J81g 2XL3A 2PBIB 3IJCA 3SMRA 3PSLA 1JOFA 3SJLD 5I5MA 2UZYB 3UVKA 4L3HD 5CXCA 4LG8A 2EBSA 2H9LA 4L9OA 2PM6B 2XYIA 4JSXC 4K3JB 1XIPA 4Z8LA 3EI4A 4L3GD 4OZUA 3VH0A 4CI8A 4JT6C 4D0KA 3I8EA 1XKSA 3OKYA 5CYKA 5SXMA 1GXRA 3AL8A 2P9IC 1NEXB 5EAMA 4QQEA 5KDOB 3VGZA 3I2NA 4PBYA 3SBPA 4JSPC 3B7FA 3NVNA 2IAAA 2Z2OA 2Q7QA 3W15A 3I8CA 3SFZA 2B5NA 2CN2A 2BBKH 4GM8A 5I5IA 4A11A 5EMMB 4NSXA 4A08A 3CFVA 1SQ9A 5IJ7E 2HXCA 4Y7RA 3IIYA 2P9SC 2B5LA 3FGBA 4OWRA 1PBYB 3BG0A 5H14A 4CZYA 3GFCA 5FLXg 2J57G 2H6QA 5IC7A 2AGWA 3I7LA 3DM0A 4Y5RD 4GGAA 4E54A 3EMHA 3SLED 1OMWB 5IJ8E 2Z2PA 3UR4A 1ERJA 1FWXA 5THAA 2AGYA 1A0RB 4GM9A 3N0EA 4H5JA 1YFQA 1N6DA 2O9KA 1NR0A 3RN1D 2AH1A 5EMLB 2IWFA 4J86A 3F3PA 2CE8A 3PVUB 3JAMg 3RSEC 2IUQA 1PEVA 4HDJA 1B9XA 3SCYA 4PXWA 2G9AA 3FRXA 4J82A 4ERZA 3RFHA 3UKUC 4BH6A 4FWWA 2MTAH 3OKYB 4K3ID 2OJYA 5CYKB 3JZHA 3AL8B 4ZOZA 3IIWA 3SN6B 4D6VA 4IA9A 2CO0C 4FAND 2P9KC 3EWEA 4GMBA 4BUJC 3EI2A 2IWKA 4JSVC 4FA9D 3PXSD 4N14A 4A11B 2J55H 4A08B 4MK0B 3NVQA 3I7NA 1GG2B 4JD2C 2I3TA 2H13A 5FKTA 3MZLA 4J78A 4A09B 3ULEC 3OL2A 4E54B 2W18A 5FKSA 1TBGA 4X61B 2YNPA 2AH0A 5EMKB 1N6EA 2I3SA 3L4OD 3V5WB 4XEIC 1P22A 4GQBB 5C9ZB 2OVRB 3EI1B 4JT5C 5FA5B 3V9FA 3HFQA 2PM9B 4FA5D 1PGUA 4FA1D 2B4EA 4O3TB 2B5MA 3C99A 2OIZA 3UVOA 4A0AA 4L1QD 4ES0A 2XU7A 3EG6A 5FKRA 2YNNA 5HE1B 4CC9A 4TZ4A 5AMSA 4X63B 5HE0B 3RFGA 2HESX 2OK6A 1Q47A 3RN0D 3SBRA 2P9LC 4CI3A 4A09A 5EAPA 3ZWLB 1MG2A 3KRWB 4E5ZB 2P9PC 2PM7B 4A2LA 1JJUB 1U4CA 2CNXA 4GM3A 3EI2B 3CFSB
chains in the Genus database with same CATH superfamily
2HJ4A 3I89A 4J77A 2H3XA 3VI3A 4ZOYA 1JMXB 5GXHA 5M5TA 3IUQA 3EI3A 1VYHC 4J8BA 3QHYB 3ZDYA 4G56B 3EI1A 3EU7A 3I7KA 4UM8A 2PM9A 2VZ3A 5GSAA 5H17A 3VA6A 4U1EI 3OL2B 4U7AA 3IJEA 4A0BA 1A12A 1H2ZA 3OKTA 3V4PA 3ZE0A 2AGXA 3AH8B 4JHPC 5B4WA 5HYNB 1QNIA 2BKLA 5K19A 5TF2A 1MDAH 4ZOXA 1BPOA 5HE3B 3P4FA 1JMZB 4FB1D 2GC7A 4R7AB 3PSCB 3DXKC 4E5ZA 2YMUA 4CY1A 3JROA 3QI0A 3MKSB 4QAMA 2BCJB 3EQ8A 2J56H 3ZDZA 4CY5A 3ORVD 5EMJB 4A0AB 5M5UA 4MMXA 4XYHA 4XYIA 3DWLC 1GP2B 4QT8A 3I7PA 2H14A 3NIGA 2VDQA 4JSNC 3SXTD 1UTCA 1QFMA 4UM9A 3F3GA 1R5MA 4Z7NA 3UVMA 2H68A 4ERYA 1SQJA 5EM2A 2VDLA 2QXVA 5AFU3 3RLMD 2UZXB 4PNKB 2P9UC 4QRJA 4A7JA 4NC4A 3E0CA 1GOGA 5IGQA 1GOTB 1YR2A 2IUPA 5IT9g 5FFGA 1M1XA 4JXMA 4GQ2P 4LGNA 2XL2A 4O3UB 3MZKA 3GD1I 3OTTA 3K26A 3EI3B 2H6KA 3K71A 2TRCB 4LG9A 4H5IA 5FKQA 3I7OA 3KCIA 4J84A 5FXYA 3PVWB 2I0RA 3UVNA 4KFMB 1O6FA 2Z2NA 3VI4A 5CXBA 5E6UA 3PXTD 3J80g 5TEEA 2OK4A 4O2WA 4A0BB 3KRXB 3IULA 5FFOA 5EARA 1H2WA 5AJAA 5GXIA 3AL9A 2H9NA 4BCDA 3OW8A 4O1QD 1TYQC 2WQ8A 2GC4A 4FA4D 3NVXA 2IURA 4GGDA 3MKQA 4G55A 3DSMA 4CY3A 3C9CA 1XHMA 3IJ1A 3JZGA 5TEFA 3C5MA 4G1MA 4RE6A 2OVQB 4ERQA 4CI2A 2P9NC 3ODTA 2HKMA 3A0FA 4PSXB 4AEZA 1L0QA 4O9DA 3L4MD 1B9YA 1PI6A 2H9MA 3K6SA 2GNQA 4CY2A 4J73A 4CZVA 2YB8B 3IUJA 4X60B 3PXWD 3PE7A 4IRZA 1RI6A 2XE4A 3JZNA 5C2VB 3RRMC 3JPXA 1S4UX 4O45A 4A2MA 2I0TA 1TYEA 4J87A 2QZPA 4AMZA 4PC0A 1OLZA 5HDBA 4CI1A 4MMYA 2HKRA 3FM0A 3V7DB 4J0WA 3SHFA 5EM2B 4UI9R 2H47A 3RMZD 2QC5A 3BWSA 4J8GA 1SHYB 3JRPA 3K27A 5I5JA 4X3EA 4EWRA 2HJBA 4CZXA 5C2WB 3FCUA 3IKOA 2YBAA 2AQ5A 1L5GA 2YNOA 5GMKn 5JWZA 3JB9L 2I0SA 2IUVA 5HQGA 3DXMC 2CE9A 3BG1A 3SVWD 2H9PA 4I79A 4J79A 3K72A 1U2VC 4YVDA 4J0XA 5EALA 4GQ1A 2G99A 1N6FA 4J81A 5CXCB 4AMYA 3SBQA 2HU8A 5H1MA 3F3FA 3IJ0A 1MG3A 3OKWA 5CXBB 3ZDXA 4FA1D 3AFCA 3ZE1A 3EI4B 5K1CC 1E5TA 2VC2A 1K3IA 2VDPA 2OVPB 5M61A 5TDHB 3SWSD 4ESGA 3MMYA 3N0DA 2AGLA 5HE2B 4FAVD 4IMMA 3MXXA 4GGCA 3I7HA 4ZN4A 5A2Qg 4BL0A 3CIKB 2HU7A 4PBZA 3MUOA 3U4YA 4FHLA 3GREA 1K8KC 5IGOA 3NIDA 3UVLA 2CO0A 2CN3A 2AGZA 4QL1A 4PSWB 5FQDA 4G1EA 4ZOVA 1H2YA 4WK0A 3UKRC 4AOWA 2HYEA 4GZ8A 4L1MA 4RE5A 2H6NA 1T2XA 1K32A 3C75H 3V4VA 1U8CA 3J81g 4DNUA 2XL3A 2PBIB 3IJCA 3SMRA 3PSLA 1JOFA 3FCSA 3SJLD 2VDOA 5I5MA 2UZYB 3UVKA 4L3HD 5CXCA 4LG8A 2EBSA 2H9LA 4L9OA 2PM6B 2XYIA 4JSXC 4WJKA 4K3JB 1XIPA 4Z8LA 3EI4A 4L3GD 4OZUA 3VH0A 4CI8A 4JT6C 4D0KA 3I8EA 1XKSA 3T3MA 3OKYA 4DNWA 5CYKA 5SXMA 1GXRA 3O4GA 3AL8A 2P9IC 1NEXB 3IURA 5EAMA 4QQEA 5KDOB 1I2MB 3I2NA 3VGZA 4PBYA 3SBPA 4JSPC 3B7FA 3NVNA 2IAAA 2Z2OA 3GC3B 2Q7QA 3W15A 3I8CA 3SFZA 4NAAA 5M5RA 2B5NA 2BBKH 2CN2A 3O4JA 1JTDB 4GM8A 5C92A 2EIBA 1QFSA 4A11A 5EMMB 4NSXA 5I5IA 4A08A 3CFVA 1SQ9A 5IJ7E 2XZGA 4BCBA 2HXCA 4Y7RA 3IIYA 3T3PA 2EIDA 2P9SC 2B5LA 3FGBA 4OWRA 1PBYB 1UOPA 3BG0A 5H14A 4CZYA 3GFCA 2XDWA 4BCCA 5FLXg 2J57G 2H6QA 5IC7A 2AGWA 3I7LA 2EICA 5M5VA 3DM0A 4Y5RD 4GGAA 4E54A 3EMHA 3SLED 1OMWB 4BP8A 5IJ8E 2Z2PA 3UR4A 1ERJA 4NENA 1FWXA 5THAA 2AGYA 1A0RB 4GM9A 3N0EA 4H5JA 1YFQA 1N6DA 2O9KA 1NR0A 3RN1D 2AH1A 4AN0A 5EMLB 1C9IA 2QR5A 2IWFA 4D9SA 4J86A 3F3PA 4MMZA 4WK4A 4JHNA 2CE8A 3PVUB 3JAMg 3RSEC 2IUQA 3MVDK 1PEVA 4HDJA 3IVMA 1B9XA 3SCYA 4PXWA 2G9AA 3FRXA 4J82A 3NIFA 4ERZA 4Z7OA 4O02A 3RFHA 4DNVA 1E8NA 4WK2A 3UKUC 4BH6A 4FWWA 2MTAH 3OKYB 4K3ID 2OJYA 5CYKB 3JZHA 3AL8B 1O6GA 3EQ7A 4Z7QA 4ZOZA 3IIWA 1E8MA 3SN6B 4D6VA 4IA9A 2CO0C 4FAND 2P9KC 3EWEA 4GMBA 4BUJC 3EI2A 2IWKA 3EQ9A 4JSVC 4FA9D 1C9LA 3PXSD 4N14A 4A11B 2J55H 2VDRA 4A08B 4MK0B 1GOHA 3NVQA 3I7NA 1GG2B 3ZE2A 4BP9A 4JD2C 4NBMA 5C86A 2I3TA 2H13A 5FKTA 3MZLA 4J78A 2EIEA 4A09B 3O4HA 3ULEC 3OL2A 4E54B 3OF7A 2W18A 5FKSA 2VDMA 1TBGA 1VZ3A 4X61B 2YNPA 2AH0A 5EMKB 5E6SA 1N6EA 2I3SA 3L4OD 1H2XA 3IUNA 3V5WB 4XEIC 1P22A 4GQBB 4AN1A 5C9ZB 2OVRB 1VE7A 3EI1B 2VDNA 4JT5C 5FA5B 3V9FA 3HFQA 2PM9B 4FA5D 1JV2A 1PGUA 2HU5A 2JKXA 2B4EA 3O4IA 4O3TB 2B5MA 3C99A 1VZ2A 2OIZA 3UVOA 4A0AA 4L1QD 4ES0A 3DDUA 2XU7A 1VE6A 3EG6A 5FKRA 2YNNA 5HE1B 5E6RA 1UOQA 4CC9A 4TZ4A 3IUMA 5AMSA 4X63B 5HE0B 3RFGA 2HESX 3MUNA 2OK6A 2VDKA 1Q47A 3RN0D 3SBRA 2P9LC 5M5SA 4CI3A 4A09A 5EAPA 3ZWLB 1MG2A 3KRWB 4E5ZB 2P9PC 2PM7B 4A2LA 1JJUB 1U4CA 2CNXA 2VZ1A 4GM3A 1GOFA 3EI2B 1UOOA 3CFSB 4AX4A
chains in the Genus database with same CATH topology
2HJ4A 3I89A 4J77A 2H3XA 4ZOYA 1JMXB 5GXHA 3EI3A 1VYHC 4J8BA 4G56B 3EI1A 3EU7A 3I7KA 2PM9A 5GSAA 5H17A 3VA6A 4U1EI 3OL2B 4U7AA 4A0BA 3OKTA 2AGXA 3AH8B 5B4WA 5HYNB 1QNIA 5K19A 5TF2A 1MDAH 4ZOXA 5HE3B 3P4FA 1JMZB 4FB1D 2GC7A 4R7AB 3PSCB 3DXKC 4E5ZA 2YMUA 4CY1A 3JROA 3MKSB 2BCJB 2J56H 4CY5A 3ORVD 5EMJB 4A0AB 4XYHA 4XYIA 3DWLC 1GP2B 4QT8A 3I7PA 2H14A 4JSNC 3SXTD 3F3GA 1R5MA 3UVMA 2H68A 4ERYA 1SQJA 5EM2A 2QXVA 5AFU3 3RLMD 2UZXB 4PNKB 2P9UC 4QRJA 4A7JA 3E0CA 5IGQA 1GOTB 2IUPA 5IT9g 4JXMA 4GQ2P 4LGNA 2XL2A 4O3UB 3MZKA 3OTTA 3K26A 3EI3B 2H6KA 2TRCB 4LG9A 4H5IA 5FKQA 3I7OA 4J84A 5FXYA 3PVWB 2I0RA 3UVNA 4KFMB 2Z2NA 5CXBA 3PXTD 3J80g 5TEEA 2OK4A 4A0BB 3KRXB 5EARA 5AJAA 5GXIA 3AL9A 2H9NA 3OW8A 4O1QD 1TYQC 4FA4D 2GC4A 3NVXA 2IURA 4GGDA 3MKQA 3DSMA 4CY3A 3C9CA 1XHMA 3IJ1A 3JZGA 5TEFA 3C5MA 2OVQB 4ERQA 4CI2A 2P9NC 3ODTA 2HKMA 3A0FA 4PSXB 4AEZA 1L0QA 4O9DA 3L4MD 1B9YA 1PI6A 2H9MA 2GNQA 4CY2A 4J73A 4CZVA 2YB8B 4X60B 3PXWD 3PE7A 1RI6A 3JZNA 5C2VB 3RRMC 3JPXA 1S4UX 4O45A 4A2MA 2I0TA 4J87A 4PC0A 1OLZA 4CI1A 2HKRA 3FM0A 3V7DB 4J0WA 3SHFA 5EM2B 4UI9R 2H47A 3RMZD 2QC5A 3BWSA 4J8GA 1SHYB 3JRPA 3K27A 5I5JA 4X3EA 4EWRA 2HJBA 4CZXA 5C2WB 3IKOA 2YBAA 2AQ5A 2YNOA 5GMKn 5JWZA 3JB9L 2I0SA 2IUVA 5HQGA 3DXMC 2CE9A 3BG1A 3SVWD 2H9PA 4I79A 4J79A 1U2VC 4YVDA 4J0XA 5EALA 4GQ1A 2G99A 1N6FA 4J81A 5CXCB 3SBQA 5H1MA 3F3FA 3IJ0A 1MG3A 3OKWA 5CXBB 3AFCA 3EI4B 5K1CC 5TDHB 2OVPB 3SWSD 4ESGA 3MMYA 3N0DA 2AGLA 5HE2B 4FAVD 4IMMA 3MXXA 4GGCA 3I7HA 4ZN4A 5A2Qg 4BL0A 3CIKB 4PBZA 3U4YA 4FHLA 3GREA 1K8KC 5IGOA 3UVLA 2CO0A 2CN3A 2AGZA 4QL1A 4PSWB 5FQDA 4ZOVA 3UKRC 4AOWA 2HYEA 4GZ8A 2H6NA 1K32A 3C75H 3J81g 2XL3A 2PBIB 3IJCA 3SMRA 3PSLA 1JOFA 3SJLD 5I5MA 2UZYB 3UVKA 4L3HD 5CXCA 4LG8A 2EBSA 2H9LA 4L9OA 2PM6B 2XYIA 4JSXC 4K3JB 1XIPA 4Z8LA 3EI4A 4L3GD 4OZUA 3VH0A 4CI8A 4JT6C 4D0KA 3I8EA 1XKSA 3OKYA 5CYKA 5SXMA 1GXRA 3AL8A 2P9IC 1NEXB 5EAMA 4QQEA 5KDOB 3VGZA 3I2NA 4PBYA 3SBPA 4JSPC 3B7FA 3NVNA 2IAAA 2Z2OA 2Q7QA 3W15A 3I8CA 3SFZA 2B5NA 2CN2A 2BBKH 4GM8A 5I5IA 4A11A 5EMMB 4NSXA 4A08A 3CFVA 1SQ9A 5IJ7E 2HXCA 4Y7RA 3IIYA 2P9SC 2B5LA 3FGBA 4OWRA 1PBYB 3BG0A 5H14A 4CZYA 3GFCA 5FLXg 2J57G 2H6QA 5IC7A 2AGWA 3I7LA 3DM0A 4Y5RD 4GGAA 4E54A 3EMHA 3SLED 1OMWB 5IJ8E 2Z2PA 3UR4A 1ERJA 1FWXA 5THAA 2AGYA 1A0RB 4GM9A 3N0EA 4H5JA 1YFQA 1N6DA 2O9KA 1NR0A 3RN1D 2AH1A 5EMLB 2IWFA 4J86A 3F3PA 2CE8A 3PVUB 3JAMg 3RSEC 2IUQA 1PEVA 4HDJA 1B9XA 3SCYA 4PXWA 2G9AA 3FRXA 4J82A 4ERZA 3RFHA 3UKUC 4BH6A 4FWWA 2MTAH 3OKYB 4K3ID 2OJYA 5CYKB 3JZHA 3AL8B 4ZOZA 3IIWA 3SN6B 4D6VA 4IA9A 2CO0C 4FAND 2P9KC 3EWEA 4GMBA 4BUJC 3EI2A 2IWKA 4JSVC 4FA9D 3PXSD 4N14A 4A11B 2J55H 4A08B 4MK0B 3NVQA 3I7NA 1GG2B 4JD2C 2I3TA 2H13A 5FKTA 3MZLA 4J78A 4A09B 3ULEC 3OL2A 4E54B 2W18A 5FKSA 1TBGA 4X61B 2YNPA 2AH0A 5EMKB 1N6EA 2I3SA 3L4OD 3V5WB 4XEIC 1P22A 4GQBB 5C9ZB 2OVRB 3EI1B 4JT5C 5FA5B 3V9FA 3HFQA 2PM9B 4FA5D 1PGUA 4FA1D 2B4EA 4O3TB 2B5MA 3C99A 2OIZA 3UVOA 4A0AA 4L1QD 4ES0A 2XU7A 3EG6A 5FKRA 2YNNA 5HE1B 4CC9A 4TZ4A 5AMSA 4X63B 5HE0B 3RFGA 2HESX 2OK6A 1Q47A 3RN0D 3SBRA 2P9LC 4CI3A 4A09A 5EAPA 3ZWLB 1MG2A 3KRWB 4E5ZB 2P9PC 2PM7B 4A2LA 1JJUB 1U4CA 2CNXA 4GM3A 3EI2B 3CFSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJ4 A;  3I89 A;  4J77 A;  2H3X A;  4ZOY A;  1JMX B;  5GXH A;  3EI3 A;  1VYH C;  4J8B A;  4G56 B;  3EI1 A;  3EU7 A;  3I7K A;  2PM9 A;  5GSA A;  5H17 A;  3VA6 A;  4U1E I;  3OL2 B;  4U7A A;  4A0B A;  3OKT A;  2AGX A;  3AH8 B;  5B4W A;  5HYN B;  1QNI A;  5K19 A;  5TF2 A;  1MDA H;  4ZOX A;  5HE3 B;  3P4F A;  1JMZ B;  4FB1 D;  2GC7 A;  4R7A B;  3PSC B;  3DXK C;  4E5Z A;  2YMU A;  4CY1 A;  3JRO A;  3MKS B;  2BCJ B;  2J56 H;  4CY5 A;  3ORV D;  5EMJ B;  4A0A B;  4XYH A;  4XYI A;  3DWL C;  1GP2 B;  4QT8 A;  3I7P A;  2H14 A;  4JSN C;  3SXT D;  3F3G A;  1R5M A;  3UVM A;  2H68 A;  4ERY A;  1SQJ A;  5EM2 A;  2QXV A;  5AFU 3;  3RLM D;  2UZX B;  4PNK B;  2P9U C;  4QRJ A;  4A7J A;  3E0C A;  5IGQ A;  1GOT B;  2IUP A;  5IT9 g;  4JXM A;  4GQ2 P;  4LGN A;  2XL2 A;  4O3U B;  3MZK A;  3OTT A;  3K26 A;  3EI3 B;  2H6K A;  2TRC B;  4LG9 A;  4H5I A;  5FKQ A;  3I7O A;  4J84 A;  5FXY A;  3PVW B;  2I0R A;  3UVN A;  4KFM B;  2Z2N A;  5CXB A;  3PXT D;  3J80 g;  5TEE A;  2OK4 A;  4A0B B;  3KRX B;  5EAR A;  5AJA A;  5GXI A;  3AL9 A;  2H9N A;  3OW8 A;  4O1Q D;  1TYQ C;  4FA4 D;  2GC4 A;  3NVX A;  2IUR A;  4GGD A;  3MKQ A;  3DSM A;  4CY3 A;  3C9C A;  1XHM A;  3IJ1 A;  3JZG A;  5TEF A;  3C5M A;  2OVQ B;  4ERQ A;  4CI2 A;  2P9N C;  3ODT A;  2HKM A;  3A0F A;  4PSX B;  4AEZ A;  1L0Q A;  4O9D A;  3L4M D;  1B9Y A;  1PI6 A;  2H9M A;  2GNQ A;  4CY2 A;  4J73 A;  4CZV A;  2YB8 B;  4X60 B;  3PXW D;  3PE7 A;  1RI6 A;  3JZN A;  5C2V B;  3RRM C;  3JPX A;  1S4U X;  4O45 A;  4A2M A;  2I0T A;  4J87 A;  4PC0 A;  1OLZ A;  4CI1 A;  2HKR A;  3FM0 A;  3V7D B;  4J0W A;  3SHF A;  5EM2 B;  4UI9 R;  2H47 A;  3RMZ D;  2QC5 A;  3BWS A;  4J8G A;  1SHY B;  3JRP A;  3K27 A;  5I5J A;  4X3E A;  4EWR A;  2HJB A;  4CZX A;  5C2W B;  3IKO A;  2YBA A;  2AQ5 A;  2YNO A;  5GMK n;  5JWZ A;  3JB9 L;  2I0S A;  2IUV A;  5HQG A;  3DXM C;  2CE9 A;  3BG1 A;  3SVW D;  2H9P A;  4I79 A;  4J79 A;  1U2V C;  4YVD A;  4J0X A;  5EAL A;  4GQ1 A;  2G99 A;  1N6F A;  4J81 A;  5CXC B;  3SBQ A;  5H1M A;  3F3F A;  3IJ0 A;  1MG3 A;  3OKW A;  5CXB B;  3AFC A;  3EI4 B;  5K1C C;  5TDH B;  2OVP B;  3SWS D;  4ESG A;  3MMY A;  3N0D A;  2AGL A;  5HE2 B;  4FAV D;  4IMM A;  3MXX A;  4GGC A;  3I7H A;  4ZN4 A;  5A2Q g;  4BL0 A;  3CIK B;  4PBZ A;  3U4Y A;  4FHL A;  3GRE A;  1K8K C;  5IGO A;  3UVL A;  2CO0 A;  2CN3 A;  2AGZ A;  4QL1 A;  4PSW B;  5FQD A;  4ZOV A;  3UKR C;  4AOW A;  2HYE A;  4GZ8 A;  2H6N A;  1K32 A;  3C75 H;  3J81 g;  2XL3 A;  2PBI B;  3IJC A;  3SMR A;  3PSL A;  1JOF A;  3SJL D;  5I5M A;  2UZY B;  3UVK A;  4L3H D;  5CXC A;  4LG8 A;  2EBS A;  2H9L A;  4L9O A;  2PM6 B;  2XYI A;  4JSX C;  4K3J B;  1XIP A;  4Z8L A;  3EI4 A;  4L3G D;  4OZU A;  3VH0 A;  4CI8 A;  4JT6 C;  4D0K A;  3I8E A;  1XKS A;  3OKY A;  5CYK A;  5SXM A;  1GXR A;  3AL8 A;  2P9I C;  1NEX B;  5EAM A;  4QQE A;  5KDO B;  3VGZ A;  3I2N A;  4PBY A;  3SBP A;  4JSP C;  3B7F A;  3NVN A;  2IAA A;  2Z2O A;  2Q7Q A;  3W15 A;  3I8C A;  3SFZ A;  2B5N A;  2CN2 A;  2BBK H;  4GM8 A;  5I5I A;  4A11 A;  5EMM B;  4NSX A;  4A08 A;  3CFV A;  1SQ9 A;  5IJ7 E;  2HXC A;  4Y7R A;  3IIY A;  2P9S C;  2B5L A;  3FGB A;  4OWR A;  1PBY B;  3BG0 A;  5H14 A;  4CZY A;  3GFC A;  5FLX g;  2J57 G;  2H6Q A;  5IC7 A;  2AGW A;  3I7L A;  3DM0 A;  4Y5R D;  4GGA A;  4E54 A;  3EMH A;  3SLE D;  1OMW B;  5IJ8 E;  2Z2P A;  3UR4 A;  1ERJ A;  1FWX A;  5THA A;  2AGY A;  1A0R B;  4GM9 A;  3N0E A;  4H5J A;  1YFQ A;  1N6D A;  2O9K A;  1NR0 A;  3RN1 D;  2AH1 A;  5EML B;  2IWF A;  4J86 A;  3F3P A;  2CE8 A;  3PVU B;  3JAM g;  3RSE C;  2IUQ A;  1PEV A;  4HDJ A;  1B9X A;  3SCY A;  4PXW A;  2G9A A;  3FRX A;  4J82 A;  4ERZ A;  3RFH A;  3UKU C;  4BH6 A;  4FWW A;  2MTA H;  3OKY B;  4K3I D;  2OJY A;  5CYK B;  3JZH A;  3AL8 B;  4ZOZ A;  3IIW A;  3SN6 B;  4D6V A;  4IA9 A;  2CO0 C;  4FAN D;  2P9K C;  3EWE A;  4GMB A;  4BUJ C;  3EI2 A;  2IWK A;  4JSV C;  4FA9 D;  3PXS D;  4N14 A;  4A11 B;  2J55 H;  4A08 B;  4MK0 B;  3NVQ A;  3I7N A;  1GG2 B;  4JD2 C;  2I3T A;  2H13 A;  5FKT A;  3MZL A;  4J78 A;  4A09 B;  3ULE C;  3OL2 A;  4E54 B;  2W18 A;  5FKS A;  1TBG A;  4X61 B;  2YNP A;  2AH0 A;  5EMK B;  1N6E A;  2I3S A;  3L4O D;  3V5W B;  4XEI C;  1P22 A;  4GQB B;  5C9Z B;  2OVR B;  3EI1 B;  4JT5 C;  5FA5 B;  3V9F A;  3HFQ A;  2PM9 B;  4FA5 D;  1PGU A;  4FA1 D;  2B4E A;  4O3T B;  2B5M A;  3C99 A;  2OIZ A;  3UVO A;  4A0A A;  4L1Q D;  4ES0 A;  2XU7 A;  3EG6 A;  5FKR A;  2YNN A;  5HE1 B;  4CC9 A;  4TZ4 A;  5AMS A;  4X63 B;  5HE0 B;  3RFG A;  2HES X;  2OK6 A;  1Q47 A;  3RN0 D;  3SBR A;  2P9L C;  4CI3 A;  4A09 A;  5EAP A;  3ZWL B;  1MG2 A;  3KRW B;  4E5Z B;  2P9P C;  2PM7 B;  4A2L A;  1JJU B;  1U4C A;  2CNX A;  4GM3 A;  3EI2 B;  3CFS B; 
#chains in the Genus database with same CATH topology
 2HJ4 A;  3I89 A;  4J77 A;  2H3X A;  3VI3 A;  4ZOY A;  1JMX B;  5GXH A;  5M5T A;  3IUQ A;  3EI3 A;  1VYH C;  4J8B A;  3QHY B;  3ZDY A;  4G56 B;  3EI1 A;  3EU7 A;  3I7K A;  4UM8 A;  2PM9 A;  2VZ3 A;  5GSA A;  5H17 A;  3VA6 A;  4U1E I;  3OL2 B;  4U7A A;  3IJE A;  4A0B A;  1A12 A;  1H2Z A;  3OKT A;  3V4P A;  3ZE0 A;  2AGX A;  3AH8 B;  4JHP C;  5B4W A;  5HYN B;  1QNI A;  2BKL A;  5K19 A;  5TF2 A;  1MDA H;  4ZOX A;  1BPO A;  5HE3 B;  3P4F A;  1JMZ B;  4FB1 D;  2GC7 A;  4R7A B;  3PSC B;  3DXK C;  4E5Z A;  2YMU A;  4CY1 A;  3JRO A;  3QI0 A;  3MKS B;  4QAM A;  2BCJ B;  3EQ8 A;  2J56 H;  3ZDZ A;  4CY5 A;  3ORV D;  5EMJ B;  4A0A B;  5M5U A;  4MMX A;  4XYH A;  4XYI A;  3DWL C;  1GP2 B;  4QT8 A;  3I7P A;  2H14 A;  3NIG A;  2VDQ A;  4JSN C;  3SXT D;  1UTC A;  1QFM A;  4UM9 A;  3F3G A;  1R5M A;  4Z7N A;  3UVM A;  2H68 A;  4ERY A;  1SQJ A;  5EM2 A;  2VDL A;  2QXV A;  5AFU 3;  3RLM D;  2UZX B;  4PNK B;  2P9U C;  4QRJ A;  4A7J A;  4NC4 A;  3E0C A;  1GOG A;  5IGQ A;  1GOT B;  1YR2 A;  2IUP A;  5IT9 g;  5FFG A;  1M1X A;  4JXM A;  4GQ2 P;  4LGN A;  2XL2 A;  4O3U B;  3MZK A;  3GD1 I;  3OTT A;  3K26 A;  3EI3 B;  2H6K A;  3K71 A;  2TRC B;  4LG9 A;  4H5I A;  5FKQ A;  3I7O A;  3KCI A;  4J84 A;  5FXY A;  3PVW B;  2I0R A;  3UVN A;  4KFM B;  1O6F A;  2Z2N A;  3VI4 A;  5CXB A;  5E6U A;  3PXT D;  3J80 g;  5TEE A;  2OK4 A;  4O2W A;  4A0B B;  3KRX B;  3IUL A;  5FFO A;  5EAR A;  1H2W A;  5AJA A;  5GXI A;  3AL9 A;  2H9N A;  4BCD A;  3OW8 A;  4O1Q D;  1TYQ C;  2WQ8 A;  2GC4 A;  4FA4 D;  3NVX A;  2IUR A;  4GGD A;  3MKQ A;  4G55 A;  3DSM A;  4CY3 A;  3C9C A;  1XHM A;  3IJ1 A;  3JZG A;  5TEF A;  3C5M A;  4G1M A;  4RE6 A;  2OVQ B;  4ERQ A;  4CI2 A;  2P9N C;  3ODT A;  2HKM A;  3A0F A;  4PSX B;  4AEZ A;  1L0Q A;  4O9D A;  3L4M D;  1B9Y A;  1PI6 A;  2H9M A;  3K6S A;  2GNQ A;  4CY2 A;  4J73 A;  4CZV A;  2YB8 B;  3IUJ A;  4X60 B;  3PXW D;  3PE7 A;  4IRZ A;  1RI6 A;  2XE4 A;  3JZN A;  5C2V B;  3RRM C;  3JPX A;  1S4U X;  4O45 A;  4A2M A;  2I0T A;  1TYE A;  4J87 A;  2QZP A;  4AMZ A;  4PC0 A;  1OLZ A;  5HDB A;  4CI1 A;  4MMY A;  2HKR A;  3FM0 A;  3V7D B;  4J0W A;  3SHF A;  5EM2 B;  4UI9 R;  2H47 A;  3RMZ D;  2QC5 A;  3BWS A;  4J8G A;  1SHY B;  3JRP A;  3K27 A;  5I5J A;  4X3E A;  4EWR A;  2HJB A;  4CZX A;  5C2W B;  3FCU A;  3IKO A;  2YBA A;  2AQ5 A;  1L5G A;  2YNO A;  5GMK n;  5JWZ A;  3JB9 L;  2I0S A;  2IUV A;  5HQG A;  3DXM C;  2CE9 A;  3BG1 A;  3SVW D;  2H9P A;  4I79 A;  4J79 A;  3K72 A;  1U2V C;  4YVD A;  4J0X A;  5EAL A;  4GQ1 A;  2G99 A;  1N6F A;  4J81 A;  5CXC B;  4AMY A;  3SBQ A;  2HU8 A;  5H1M A;  3F3F A;  3IJ0 A;  1MG3 A;  3OKW A;  5CXB B;  3ZDX A;  4FA1 D;  3AFC A;  3ZE1 A;  3EI4 B;  5K1C C;  1E5T A;  2VC2 A;  1K3I A;  2VDP A;  2OVP B;  5M61 A;  5TDH B;  3SWS D;  4ESG A;  3MMY A;  3N0D A;  2AGL A;  5HE2 B;  4FAV D;  4IMM A;  3MXX A;  4GGC A;  3I7H A;  4ZN4 A;  5A2Q g;  4BL0 A;  3CIK B;  2HU7 A;  4PBZ A;  3MUO A;  3U4Y A;  4FHL A;  3GRE A;  1K8K C;  5IGO A;  3NID A;  3UVL A;  2CO0 A;  2CN3 A;  2AGZ A;  4QL1 A;  4PSW B;  5FQD A;  4G1E A;  4ZOV A;  1H2Y A;  4WK0 A;  3UKR C;  4AOW A;  2HYE A;  4GZ8 A;  4L1M A;  4RE5 A;  2H6N A;  1T2X A;  1K32 A;  3C75 H;  3V4V A;  1U8C A;  3J81 g;  4DNU A;  2XL3 A;  2PBI B;  3IJC A;  3SMR A;  3PSL A;  1JOF A;  3FCS A;  3SJL D;  2VDO A;  5I5M A;  2UZY B;  3UVK A;  4L3H D;  5CXC A;  4LG8 A;  2EBS A;  2H9L A;  4L9O A;  2PM6 B;  2XYI A;  4JSX C;  4WJK A;  4K3J B;  1XIP A;  4Z8L A;  3EI4 A;  4L3G D;  4OZU A;  3VH0 A;  4CI8 A;  4JT6 C;  4D0K A;  3I8E A;  1XKS A;  3T3M A;  3OKY A;  4DNW A;  5CYK A;  5SXM A;  1GXR A;  3O4G A;  3AL8 A;  2P9I C;  1NEX B;  3IUR A;  5EAM A;  4QQE A;  5KDO B;  1I2M B;  3I2N A;  3VGZ A;  4PBY A;  3SBP A;  4JSP C;  3B7F A;  3NVN A;  2IAA A;  2Z2O A;  3GC3 B;  2Q7Q A;  3W15 A;  3I8C A;  3SFZ A;  4NAA A;  5M5R A;  2B5N A;  2BBK H;  2CN2 A;  3O4J A;  1JTD B;  4GM8 A;  5C92 A;  2EIB A;  1QFS A;  4A11 A;  5EMM B;  4NSX A;  5I5I A;  4A08 A;  3CFV A;  1SQ9 A;  5IJ7 E;  2XZG A;  4BCB A;  2HXC A;  4Y7R A;  3IIY A;  3T3P A;  2EID A;  2P9S C;  2B5L A;  3FGB A;  4OWR A;  1PBY B;  1UOP A;  3BG0 A;  5H14 A;  4CZY A;  3GFC A;  2XDW A;  4BCC A;  5FLX g;  2J57 G;  2H6Q A;  5IC7 A;  2AGW A;  3I7L A;  2EIC A;  5M5V A;  3DM0 A;  4Y5R D;  4GGA A;  4E54 A;  3EMH A;  3SLE D;  1OMW B;  4BP8 A;  5IJ8 E;  2Z2P A;  3UR4 A;  1ERJ A;  4NEN A;  1FWX A;  5THA A;  2AGY A;  1A0R B;  4GM9 A;  3N0E A;  4H5J A;  1YFQ A;  1N6D A;  2O9K A;  1NR0 A;  3RN1 D;  2AH1 A;  4AN0 A;  5EML B;  1C9I A;  2QR5 A;  2IWF A;  4D9S A;  4J86 A;  3F3P A;  4MMZ A;  4WK4 A;  4JHN A;  2CE8 A;  3PVU B;  3JAM g;  3RSE C;  2IUQ A;  3MVD K;  1PEV A;  4HDJ A;  3IVM A;  1B9X A;  3SCY A;  4PXW A;  2G9A A;  3FRX A;  4J82 A;  3NIF A;  4ERZ A;  4Z7O A;  4O02 A;  3RFH A;  4DNV A;  1E8N A;  4WK2 A;  3UKU C;  4BH6 A;  4FWW A;  2MTA H;  3OKY B;  4K3I D;  2OJY A;  5CYK B;  3JZH A;  3AL8 B;  1O6G A;  3EQ7 A;  4Z7Q A;  4ZOZ A;  3IIW A;  1E8M A;  3SN6 B;  4D6V A;  4IA9 A;  2CO0 C;  4FAN D;  2P9K C;  3EWE A;  4GMB A;  4BUJ C;  3EI2 A;  2IWK A;  3EQ9 A;  4JSV C;  4FA9 D;  1C9L A;  3PXS D;  4N14 A;  4A11 B;  2J55 H;  2VDR A;  4A08 B;  4MK0 B;  1GOH A;  3NVQ A;  3I7N A;  1GG2 B;  3ZE2 A;  4BP9 A;  4JD2 C;  4NBM A;  5C86 A;  2I3T A;  2H13 A;  5FKT A;  3MZL A;  4J78 A;  2EIE A;  4A09 B;  3O4H A;  3ULE C;  3OL2 A;  4E54 B;  3OF7 A;  2W18 A;  5FKS A;  2VDM A;  1TBG A;  1VZ3 A;  4X61 B;  2YNP A;  2AH0 A;  5EMK B;  5E6S A;  1N6E A;  2I3S A;  3L4O D;  1H2X A;  3IUN A;  3V5W B;  4XEI C;  1P22 A;  4GQB B;  4AN1 A;  5C9Z B;  2OVR B;  1VE7 A;  3EI1 B;  2VDN A;  4JT5 C;  5FA5 B;  3V9F A;  3HFQ A;  2PM9 B;  4FA5 D;  1JV2 A;  1PGU A;  2HU5 A;  2JKX A;  2B4E A;  3O4I A;  4O3T B;  2B5M A;  3C99 A;  1VZ2 A;  2OIZ A;  3UVO A;  4A0A A;  4L1Q D;  4ES0 A;  3DDU A;  2XU7 A;  1VE6 A;  3EG6 A;  5FKR A;  2YNN A;  5HE1 B;  5E6R A;  1UOQ A;  4CC9 A;  4TZ4 A;  3IUM A;  5AMS A;  4X63 B;  5HE0 B;  3RFG A;  2HES X;  3MUN A;  2OK6 A;  2VDK A;  1Q47 A;  3RN0 D;  3SBR A;  2P9L C;  5M5S A;  4CI3 A;  4A09 A;  5EAP A;  3ZWL B;  1MG2 A;  3KRW B;  4E5Z B;  2P9P C;  2PM7 B;  4A2L A;  1JJU B;  1U4C A;  2CNX A;  2VZ1 A;  4GM3 A;  1GOF A;  3EI2 B;  1UOO A;  3CFS B;  4AX4 A; 
#chains in the Genus database with same CATH homology
 2HJ4 A;  3I89 A;  4J77 A;  2H3X A;  4ZOY A;  1JMX B;  5GXH A;  3EI3 A;  1VYH C;  4J8B A;  4G56 B;  3EI1 A;  3EU7 A;  3I7K A;  2PM9 A;  5GSA A;  5H17 A;  3VA6 A;  4U1E I;  3OL2 B;  4U7A A;  4A0B A;  3OKT A;  2AGX A;  3AH8 B;  5B4W A;  5HYN B;  1QNI A;  5K19 A;  5TF2 A;  1MDA H;  4ZOX A;  5HE3 B;  3P4F A;  1JMZ B;  4FB1 D;  2GC7 A;  4R7A B;  3PSC B;  3DXK C;  4E5Z A;  2YMU A;  4CY1 A;  3JRO A;  3MKS B;  2BCJ B;  2J56 H;  4CY5 A;  3ORV D;  5EMJ B;  4A0A B;  4XYH A;  4XYI A;  3DWL C;  1GP2 B;  4QT8 A;  3I7P A;  2H14 A;  4JSN C;  3SXT D;  3F3G A;  1R5M A;  3UVM A;  2H68 A;  4ERY A;  1SQJ A;  5EM2 A;  2QXV A;  5AFU 3;  3RLM D;  2UZX B;  4PNK B;  2P9U C;  4QRJ A;  4A7J A;  3E0C A;  5IGQ A;  1GOT B;  2IUP A;  5IT9 g;  4JXM A;  4GQ2 P;  4LGN A;  2XL2 A;  4O3U B;  3MZK A;  3OTT A;  3K26 A;  3EI3 B;  2H6K A;  2TRC B;  4LG9 A;  4H5I A;  5FKQ A;  3I7O A;  4J84 A;  5FXY A;  3PVW B;  2I0R A;  3UVN A;  4KFM B;  2Z2N A;  5CXB A;  3PXT D;  3J80 g;  5TEE A;  2OK4 A;  4A0B B;  3KRX B;  5EAR A;  5AJA A;  5GXI A;  3AL9 A;  2H9N A;  3OW8 A;  4O1Q D;  1TYQ C;  4FA4 D;  2GC4 A;  3NVX A;  2IUR A;  4GGD A;  3MKQ A;  3DSM A;  4CY3 A;  3C9C A;  1XHM A;  3IJ1 A;  3JZG A;  5TEF A;  3C5M A;  2OVQ B;  4ERQ A;  4CI2 A;  2P9N C;  3ODT A;  2HKM A;  3A0F A;  4PSX B;  4AEZ A;  1L0Q A;  4O9D A;  3L4M D;  1B9Y A;  1PI6 A;  2H9M A;  2GNQ A;  4CY2 A;  4J73 A;  4CZV A;  2YB8 B;  4X60 B;  3PXW D;  3PE7 A;  1RI6 A;  3JZN A;  5C2V B;  3RRM C;  3JPX A;  1S4U X;  4O45 A;  4A2M A;  2I0T A;  4J87 A;  4PC0 A;  1OLZ A;  4CI1 A;  2HKR A;  3FM0 A;  3V7D B;  4J0W A;  3SHF A;  5EM2 B;  4UI9 R;  2H47 A;  3RMZ D;  2QC5 A;  3BWS A;  4J8G A;  1SHY B;  3JRP A;  3K27 A;  5I5J A;  4X3E A;  4EWR A;  2HJB A;  4CZX A;  5C2W B;  3IKO A;  2YBA A;  2AQ5 A;  2YNO A;  5GMK n;  5JWZ A;  3JB9 L;  2I0S A;  2IUV A;  5HQG A;  3DXM C;  2CE9 A;  3BG1 A;  3SVW D;  2H9P A;  4I79 A;  4J79 A;  1U2V C;  4YVD A;  4J0X A;  5EAL A;  4GQ1 A;  2G99 A;  1N6F A;  4J81 A;  5CXC B;  3SBQ A;  5H1M A;  3F3F A;  3IJ0 A;  1MG3 A;  3OKW A;  5CXB B;  3AFC A;  3EI4 B;  5K1C C;  5TDH B;  2OVP B;  3SWS D;  4ESG A;  3MMY A;  3N0D A;  2AGL A;  5HE2 B;  4FAV D;  4IMM A;  3MXX A;  4GGC A;  3I7H A;  4ZN4 A;  5A2Q g;  4BL0 A;  3CIK B;  4PBZ A;  3U4Y A;  4FHL A;  3GRE A;  1K8K C;  5IGO A;  3UVL A;  2CO0 A;  2CN3 A;  2AGZ A;  4QL1 A;  4PSW B;  5FQD A;  4ZOV A;  3UKR C;  4AOW A;  2HYE A;  4GZ8 A;  2H6N A;  1K32 A;  3C75 H;  3J81 g;  2XL3 A;  2PBI B;  3IJC A;  3SMR A;  3PSL A;  1JOF A;  3SJL D;  5I5M A;  2UZY B;  3UVK A;  4L3H D;  5CXC A;  4LG8 A;  2EBS A;  2H9L A;  4L9O A;  2PM6 B;  2XYI A;  4JSX C;  4K3J B;  1XIP A;  4Z8L A;  3EI4 A;  4L3G D;  4OZU A;  3VH0 A;  4CI8 A;  4JT6 C;  4D0K A;  3I8E A;  1XKS A;  3OKY A;  5CYK A;  5SXM A;  1GXR A;  3AL8 A;  2P9I C;  1NEX B;  5EAM A;  4QQE A;  5KDO B;  3VGZ A;  3I2N A;  4PBY A;  3SBP A;  4JSP C;  3B7F A;  3NVN A;  2IAA A;  2Z2O A;  2Q7Q A;  3W15 A;  3I8C A;  3SFZ A;  2B5N A;  2CN2 A;  2BBK H;  4GM8 A;  5I5I A;  4A11 A;  5EMM B;  4NSX A;  4A08 A;  3CFV A;  1SQ9 A;  5IJ7 E;  2HXC A;  4Y7R A;  3IIY A;  2P9S C;  2B5L A;  3FGB A;  4OWR A;  1PBY B;  3BG0 A;  5H14 A;  4CZY A;  3GFC A;  5FLX g;  2J57 G;  2H6Q A;  5IC7 A;  2AGW A;  3I7L A;  3DM0 A;  4Y5R D;  4GGA A;  4E54 A;  3EMH A;  3SLE D;  1OMW B;  5IJ8 E;  2Z2P A;  3UR4 A;  1ERJ A;  1FWX A;  5THA A;  2AGY A;  1A0R B;  4GM9 A;  3N0E A;  4H5J A;  1YFQ A;  1N6D A;  2O9K A;  1NR0 A;  3RN1 D;  2AH1 A;  5EML B;  2IWF A;  4J86 A;  3F3P A;  2CE8 A;  3PVU B;  3JAM g;  3RSE C;  2IUQ A;  1PEV A;  4HDJ A;  1B9X A;  3SCY A;  4PXW A;  2G9A A;  3FRX A;  4J82 A;  4ERZ A;  3RFH A;  3UKU C;  4BH6 A;  4FWW A;  2MTA H;  3OKY B;  4K3I D;  2OJY A;  5CYK B;  3JZH A;  3AL8 B;  4ZOZ A;  3IIW A;  3SN6 B;  4D6V A;  4IA9 A;  2CO0 C;  4FAN D;  2P9K C;  3EWE A;  4GMB A;  4BUJ C;  3EI2 A;  2IWK A;  4JSV C;  4FA9 D;  3PXS D;  4N14 A;  4A11 B;  2J55 H;  4A08 B;  4MK0 B;  3NVQ A;  3I7N A;  1GG2 B;  4JD2 C;  2I3T A;  2H13 A;  5FKT A;  3MZL A;  4J78 A;  4A09 B;  3ULE C;  3OL2 A;  4E54 B;  2W18 A;  5FKS A;  1TBG A;  4X61 B;  2YNP A;  2AH0 A;  5EMK B;  1N6E A;  2I3S A;  3L4O D;  3V5W B;  4XEI C;  1P22 A;  4GQB B;  5C9Z B;  2OVR B;  3EI1 B;  4JT5 C;  5FA5 B;  3V9F A;  3HFQ A;  2PM9 B;  4FA5 D;  1PGU A;  4FA1 D;  2B4E A;  4O3T B;  2B5M A;  3C99 A;  2OIZ A;  3UVO A;  4A0A A;  4L1Q D;  4ES0 A;  2XU7 A;  3EG6 A;  5FKR A;  2YNN A;  5HE1 B;  4CC9 A;  4TZ4 A;  5AMS A;  4X63 B;  5HE0 B;  3RFG A;  2HES X;  2OK6 A;  1Q47 A;  3RN0 D;  3SBR A;  2P9L C;  4CI3 A;  4A09 A;  5EAP A;  3ZWL B;  1MG2 A;  3KRW B;  4E5Z B;  2P9P C;  2PM7 B;  4A2L A;  1JJU B;  1U4C A;  2CNX A;  4GM3 A;  3EI2 B;  3CFS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...