3SJLD

Crystal structure of the p107s-maug/pre-methylamine dehydrogenase complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein mauG
total genus 95
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sjlD00
2XU7A 3AL8A 4J8GA 4JSPC 3J80g 5HE1B 2YNNA 4MK0B 3ORVD 1GOTB 1NEXB 3EWEA 4I79A 4K3JB 1B9YA 4ZOVA 5CXBB 2BBKH 3KRWB 3SWSD 5EARA 2H14A 1JJUB 5FXYA 1SQJA 3JROA 2H9NA 3MKSB 3UR4A 3F3FA 3NVXA 4O3TB 3N0DA 2J57G 4A11B 1GXRA 2YB8B 2AGXA 3C99A 3I8EA 5HYNB 4FB1D 5AMSA 3OKWA 5IGOA 4E5ZA 2H9PA 3I7KA 1RI6A 4J86A 5EAPA 2B5MA 3CIKB 3JPXA 5C2VB 2AH0A 3W15A 3JAMg 4D0KA 2Z2OA 2B4EA 1GG2B 3PXWD 1XHMA 4D6VA 3EI2A 4J73A 3SBRA 2AGLA 3L4MD 5EMMB 3UVMA 4ZOZA 1PEVA 4XEIC 2IURA 3I7OA 1SQ9A 2MTAH 3C9CA 4J79A 5GXHA 2PM9B 2J55H 3EI4B 2H6NA 3MXXA 3UVKA 4L1QD 4CY1A 3JZNA 3OKTA 3RSEC 2CO0A 1N6DA 4ZOXA 5HQGA 4FA4D 4JT6C 2HXCA 3DWLC 2H9MA 5IT9g 4CZYA 4FWWA 3KRXB 4FA9D 4YVDA 4J0WA 4U7AA 3B7FA 5JWZA 5TDHB 3NVNA 3K26A 3SJLD 3IIYA 2OIZA 5CXCA 4L3GD 4O3UB 5EAMA 3JRPA 4LG9A 4QRJA 4N14A 3MZLA 3PXTD 3PSCB 4JXMA 3VH0A 3UKUC 5C2WB 4H5IA 3PVWB 1SHYB 4PNKB 3ODTA 4L9OA 3BG0A 3I2NA 4CY5A 4A2LA 3EI3A 4J8BA 4GGCA 3RRMC 2OVPB 5EMLB 5IJ8E 4A0BA 4ERYA 5I5IA 3AH8B 2I0RA 1NR0A 2Q7QA 4A09B 2J56H 2IUQA 2I0SA 3V5WB 4ZOYA 4J81A 3RFGA 4GM9A 2B5LA 2P9UC 3PSLA 1QNIA 2UZXB 5H14A 2XL3A 4PBZA 2OK4A 2XL2A 3E0CA 4CZXA 1FWXA 3NVQA 4O45A 3BWSA 1PGUA 3EMHA 4L3HD 3ZWLB 5TF2A 4X61B 2XYIA 4E54B 3IJCA 4Y7RA 1MDAH 3RFHA 3EI1B 5GXIA 2PM6B 5H1MA 1TYQC 5IC7A 2B5NA 4BH6A 3OKYB 1OLZA 2HYEA 4A0AB 3OKYA 5K1CC 2W18A 3C75H 3MZKA 5IGQA 5TEFA 4CC9A 3SFZA 3HFQA 3RN1D 4A11A 1MG2A 3P4FA 3JZHA 4GM3A 3V9FA 2P9SC 3EG6A 1ERJA 1JOFA 3VGZA 4E5ZB 4Z8LA 1K32A 2AQ5A 2HESX 2YBAA 4A09A 2G99A 4Y5RD 5EM2B 3FRXA 3ULEC 1YFQA 3I7PA 4G56B 4GQ2P 5FKRA 3IJ0A 1U2VC 3IJ1A 4QQEA 3MKQA 4O9DA 2Z2NA 4LG8A 5GMKn 2CNXA 2I3SA 3JZGA 3PXSD 2IAAA 1PI6A 3DXMC 4J77A 3GFCA 4K3ID 4J84A 4X60B 3SXTD 4TZ4A 3SCYA 5I5MA 2HKRA 2PM7B 2P9KC 3UVNA 4ESGA 1P22A 3DM0A 2OJYA 5CXBA 2AGWA 4A2MA 4CZVA 4ZN4A 4QT8A 3UVOA 2TRCB 4X63B 4A7JA 4HDJA 3EI4A 2PM9A 4GM8A 5FLXg 5FA5B 2H3XA 3AL9A 3RMZD 2IWKA 3EI1A 1VYHC 4CI3A 2CN3A 5SXMA 2AGYA 2HJBA 2HJ4A 4PSXB 2P9IC 4CY2A 4BL0A 3V7DB 1N6EA 4J0XA 5EM2A 4FAND 1XKSA 5AFU3 4GGAA 3PVUB 5IJ7E 3K27A 3I8CA 4KFMB 3SHFA 4GGDA 5K19A 2YNOA 3FM0A 3N0EA 4FAVD 2I0TA 3U4YA 4XYIA 3IKOA 4CI8A 4ERQA 5C9ZB 4X3EA 3VA6A 3J81g 3C5MA 2GC7A 4A0BB 1K8KC 1MG3A 4O1QD 3OL2B 2P9LC 3L4OD 2H6KA 5THAA 2H47A 4JT5C 2QC5A 2O9KA 2HKMA 3F3GA 3I7HA 4XYHA 5H17A 3CFSB 3MMYA 3RN0D 2QXVA 3BG1A 4PXWA 5GSAA 4J78A 4LGNA 2YNPA 1OMWB 3CFVA 3AL8B 3FGBA 1Q47A 5EMKB 3A0FA 3SN6B 2AGZA 4CI2A 2Z2PA 2P9NC 1U4CA 1N6FA 4AOWA 3DXKC 4JSXC 3UVLA 3EI3B 3RLMD 3OL2A 2EBSA 4IMMA 1XIPA 4GQBB 1A0RB 5KDOB 3SVWD 2CE8A 2H13A 4A08A 4ERZA 3GREA 2CN2A 2OK6A 4GQ1A 2H68A 4JD2C 4J82A 1L0QA 3F3PA 4GZ8A 3SBQA 4NSXA 4QL1A 3OW8A 1JMXB 1GP2B 5HE2B 5EALA 3UKRC 5FKTA 4A0AA 5HE3B 5CXCB 2OVRB 3PE7A 3I89A 2UZYB 4CY3A 1PBYB 4E54A 5FKQA 5I5JA 1S4UX 3JB9L 5CYKB 3OTTA 2BCJB 1R5MA 1B9XA 5FKSA 2CE9A 3EU7A 2AH1A 2H6QA 3SMRA 3AFCA 3SLED 2CO0C 2G9AA 3SBPA 4PBYA 1TBGA 2OVQB 3IIWA 4JSNC 4OWRA 2GNQA 2IUPA 4J87A 4U1EI 5A2Qg 5B4WA 4A08B 3DSMA 4H5JA 3I7NA 4UI9R 4FHLA 4OZUA 2P9PC 4IA9A 4ES0A 4JSVC 4PC0A 5FQDA 2I3TA 4GMBA 4AEZA 4FA1D 2IWFA 1JMZB 4R7AB 4BUJC 4CI1A 4PSWB 3EI2B 2H9LA 2IUVA 3I7LA 4EWRA 2GC4A 5AJAA 5HE0B 5CYKA 2PBIB 5EMJB 4FA5D 2YMUA 5TEEA
chains in the Genus database with same CATH superfamily
2XU7A 3AL8A 4J8GA 4JSPC 3J80g 4Z7OA 5HE1B 2YNNA 3KCIA 4DNUA 1JV2A 4MK0B 3IJEA 2EIBA 3ORVD 1GOTB 1NEXB 3EWEA 4I79A 4K3JB 1B9YA 4ZOVA 4WK0A 5CXBB 2BBKH 5M5SA 4RE5A 3KRWB 1E5TA 3SWSD 5EARA 2H14A 1JJUB 3MUOA 5FXYA 1SQJA 3EQ7A 3JROA 2H9NA 1H2ZA 3MKSB 3UR4A 3F3FA 3NVXA 4O3TB 3T3MA 3N0DA 2J57G 4A11B 1GXRA 2YB8B 2AGXA 3C99A 3I8EA 2QZPA 5HYNB 4FB1D 5AMSA 3OKWA 5IGOA 2VDRA 4RE6A 4E5ZA 4O02A 1UOPA 2H9PA 3I7KA 1RI6A 3IUQA 4J86A 5EAPA 2B5MA 3CIKB 2XDWA 4O2WA 3JPXA 5C2VB 2AH0A 3W15A 5M61A 3JAMg 4D0KA 3NIGA 2Z2OA 2B4EA 1GG2B 3PXWD 1XHMA 4D6VA 3EI2A 4J73A 3SBRA 2AGLA 3L4MD 5EMMB 3UVMA 4ZOZA 3NIDA 1PEVA 4XEIC 2IURA 3I7OA 3IULA 1SQ9A 2MTAH 3C9CA 4J79A 5GXHA 2PM9B 2J55H 3EI4B 2H6NA 3FCUA 3MXXA 3UVKA 4L1QD 2JKXA 4CY1A 3JZNA 3OKTA 3RSEC 1UTCA 1N6DA 2CO0A 4ZOXA 5HQGA 4FA4D 4JT6C 3IURA 2HXCA 3DWLC 2H9MA 5IT9g 4CZYA 5M5VA 4FWWA 1C9IA 1VZ2A 3KRXB 4FA9D 4YVDA 1H2WA 4J0WA 4U7AA 5HDBA 4BP8A 3B7FA 5JWZA 2HU5A 5TDHB 3NVNA 3K26A 3SJLD 4WK4A 3IIYA 2OIZA 3V4PA 5CXCA 1M1XA 4L3GD 2BKLA 3O4HA 4O3UB 3ZDYA 5EAMA 3JRPA 4LG9A 4QRJA 4N14A 1UOOA 3MZLA 3VI3A 3NIFA 1A12A 4MMZA 2XE4A 3PXTD 3PSCB 4JXMA 3VH0A 3UKUC 5C2WB 5C86A 4AMZA 4H5IA 3PVWB 1SHYB 1GOGA 4PNKB 1U8CA 3ODTA 4L9OA 3BG0A 3I2NA 4CY5A 2VC2A 4A2LA 3EI3A 4J8BA 4IRZA 5E6UA 4GGCA 3RRMC 2OVPB 5EMLB 5IJ8E 1E8NA 4AN1A 4D9SA 4A0BA 4ERYA 5I5IA 3AH8B 2I0RA 1NR0A 2Q7QA 4A09B 2J56H 2IUQA 3K71A 2I0SA 3IVMA 4UM8A 3V5WB 4ZOYA 4J81A 3RFGA 4GM9A 1QFSA 2B5LA 2P9UC 3PSLA 4NC4A 1QNIA 2UZXB 5H14A 2XL3A 1UOQA 4PBZA 2OK4A 2XL2A 3E0CA 4CZXA 1FWXA 3NVQA 4O45A 3GD1I 3BWSA 1PGUA 3EMHA 4L3HD 3ZWLB 5TF2A 4X61B 2XYIA 4E54B 3DDUA 3IJCA 4Y7RA 1MDAH 3RFHA 3EI1B 5GXIA 2PM6B 5H1MA 4Z7QA 4BCBA 1TYQC 5IC7A 2B5NA 4BH6A 3OKYB 1OLZA 3EQ9A 2HYEA 4A0AB 3OKYA 5K1CC 2W18A 3C75H 2VDOA 3MZKA 5IGQA 5TEFA 4CC9A 2EICA 3SFZA 3HFQA 1VE6A 3RN1D 4A11A 1MG2A 4L1MA 3P4FA 3JZHA 3IUNA 3K72A 4GM3A 3V9FA 4BP9A 2P9SC 3EG6A 1I2MB 1ERJA 4G1MA 1JOFA 2HU8A 3VGZA 4E5ZB 4Z8LA 1K32A 2AQ5A 2HESX 1GOHA 2YBAA 4A09A 1O6FA 2G99A 4Y5RD 4NAAA 3V4VA 3ZE0A 3ZDXA 1E8MA 3FRXA 3ULEC 5EM2B 1YFQA 5M5TA 3GC3B 3I7PA 4G56B 2VDMA 4GQ2P 5FKRA 1TYEA 3IJ0A 1U2VC 3IJ1A 4QQEA 3MKQA 4O9DA 2Z2NA 4LG8A 5GMKn 2CNXA 2I3SA 4AMYA 3JZGA 3PXSD 2IAAA 1PI6A 3DXMC 4J77A 3O4IA 3GFCA 4NBMA 4K3ID 4J84A 4X60B 1GOFA 3SXTD 4TZ4A 3SCYA 5I5MA 2HKRA 2PM7B 2P9KC 2QR5A 3UVNA 4ESGA 1P22A 3DM0A 2OJYA 5CXBA 2AGWA 4A2MA 1T2XA 4CZVA 4ZN4A 4QT8A 3UVOA 2TRCB 4X63B 1O6GA 2HU7A 4A7JA 4HDJA 3EI4A 2PM9A 4GM8A 5FLXg 3ZE2A 5FA5B 2H3XA 3AL9A 3RMZD 3QI0A 5FFOA 2EIDA 2IWKA 3EI1A 1VYHC 4CI3A 4WK2A 2CN3A 5SXMA 2AGYA 2HJBA 4AN0A 1C9LA 2HJ4A 4PSXB 2P9IC 4CY2A 4BL0A 3V7DB 1N6EA 4J0XA 5EM2A 4FAND 1XKSA 5AFU3 4GGAA 3PVUB 5IJ7E 3K27A 3I8CA 4KFMB 3SHFA 4GGDA 5K19A 2YNOA 3FM0A 4NENA 3N0EA 4FAVD 2I0TA 1JTDB 4XYIA 1BPOA 3MUNA 3IKOA 3U4YA 4CI8A 4ERQA 5C9ZB 4X3EA 3VA6A 3J81g 3C5MA 5FFGA 4DNWA 2GC7A 4A0BB 1K8KC 1MG3A 4O1QD 3OL2B 3MVDK 3ZE1A 2P9LC 3L4OD 2H6KA 5THAA 1H2YA 1QFMA 2H47A 4JT5C 3IUMA 2QC5A 2O9KA 2HKMA 3F3GA 3I7HA 4XYHA 2VDKA 5H17A 3CFSB 3MMYA 3OF7A 4G1EA 3RN0D 2QXVA 3BG1A 5C92A 4PXWA 3IUJA 5GSAA 4J78A 4LGNA 3O4JA 2YNPA 1OMWB 2XZGA 3CFVA 3AL8B 3FGBA 1Q47A 5E6RA 5E6SA 5EMKB 3A0FA 2EIEA 3SN6B 2AGZA 4CI2A 2Z2PA 3T3PA 3EQ8A 1H2XA 2P9NC 1U4CA 1N6FA 4AOWA 2VDLA 3DXKC 4JSXC 3UVLA 3EI3B 4Z7NA 3RLMD 2VZ1A 3OL2A 2EBSA 4IMMA 1XIPA 4GQBB 1A0RB 1VZ3A 5KDOB 3SVWD 2CE8A 2H13A 4A08A 4ERZA 3GREA 2CN2A 2OK6A 4GQ1A 2H68A 4JD2C 4J82A 1L0QA 3QHYB 3F3PA 4GZ8A 3SBQA 4NSXA 4QL1A 3ZDZA 3OW8A 1JMXB 1GP2B 3O4GA 5HE2B 5EALA 3UKRC 5FKTA 4A0AA 5HE3B 5CXCB 2OVRB 3PE7A 2VDQA 3I89A 2UZYB 2VDNA 4CY3A 1PBYB 4E54A 5FKQA 4QAMA 5I5JA 1S4UX 3JB9L 4WJKA 5CYKB 3OTTA 4DNVA 4UM9A 2BCJB 1R5MA 4G55A 1B9XA 5FKSA 2CE9A 3EU7A 2AH1A 2H6QA 3SMRA 3AFCA 3SLED 4MMXA 1YR2A 2CO0C 2VDPA 4AX4A 2G9AA 3SBPA 4BCCA 4PBYA 1TBGA 2VZ3A 2OVQB 3IIWA 4JSNC 4OWRA 4JHNA 2GNQA 2IUPA 4J87A 4U1EI 5A2Qg 5M5UA 5B4WA 3K6SA 4A08B 1K3IA 3DSMA 4H5JA 3I7NA 4UI9R 4FHLA 5M5RA 4JHPC 4OZUA 2P9PC 4IA9A 4ES0A 4JSVC 4PC0A 5FQDA 3FCSA 2I3TA 4GMBA 4AEZA 4FA1D 1L5GA 2WQ8A 2IWFA 1JMZB 4R7AB 4BUJC 4CI1A 4PSWB 3EI2B 2H9LA 1VE7A 2IUVA 3I7LA 3VI4A 2GC4A 4EWRA 5AJAA 5HE0B 5CYKA 2PBIB 5EMJB 4FA5D 4BCDA 4MMYA 2YMUA 5TEEA
chains in the Genus database with same CATH topology
2XU7A 3AL8A 4J8GA 4JSPC 3J80g 5HE1B 2YNNA 4MK0B 3ORVD 1GOTB 1NEXB 3EWEA 4I79A 4K3JB 1B9YA 4ZOVA 5CXBB 2BBKH 3KRWB 3SWSD 5EARA 2H14A 1JJUB 5FXYA 1SQJA 3JROA 2H9NA 3MKSB 3UR4A 3F3FA 3NVXA 4O3TB 3N0DA 2J57G 4A11B 1GXRA 2YB8B 2AGXA 3C99A 3I8EA 5HYNB 4FB1D 5AMSA 3OKWA 5IGOA 4E5ZA 2H9PA 3I7KA 1RI6A 4J86A 5EAPA 2B5MA 3CIKB 3JPXA 5C2VB 2AH0A 3W15A 3JAMg 4D0KA 2Z2OA 2B4EA 1GG2B 3PXWD 1XHMA 4D6VA 3EI2A 4J73A 3SBRA 2AGLA 3L4MD 5EMMB 3UVMA 4ZOZA 1PEVA 4XEIC 2IURA 3I7OA 1SQ9A 2MTAH 3C9CA 4J79A 5GXHA 2PM9B 2J55H 3EI4B 2H6NA 3MXXA 3UVKA 4L1QD 4CY1A 3JZNA 3OKTA 3RSEC 2CO0A 1N6DA 4ZOXA 5HQGA 4FA4D 4JT6C 2HXCA 3DWLC 2H9MA 5IT9g 4CZYA 4FWWA 3KRXB 4FA9D 4YVDA 4J0WA 4U7AA 3B7FA 5JWZA 5TDHB 3NVNA 3K26A 3SJLD 3IIYA 2OIZA 5CXCA 4L3GD 4O3UB 5EAMA 3JRPA 4LG9A 4QRJA 4N14A 3MZLA 3PXTD 3PSCB 4JXMA 3VH0A 3UKUC 5C2WB 4H5IA 3PVWB 1SHYB 4PNKB 3ODTA 4L9OA 3BG0A 3I2NA 4CY5A 4A2LA 3EI3A 4J8BA 4GGCA 3RRMC 2OVPB 5EMLB 5IJ8E 4A0BA 4ERYA 5I5IA 3AH8B 2I0RA 1NR0A 2Q7QA 4A09B 2J56H 2IUQA 2I0SA 3V5WB 4ZOYA 4J81A 3RFGA 4GM9A 2B5LA 2P9UC 3PSLA 1QNIA 2UZXB 5H14A 2XL3A 4PBZA 2OK4A 2XL2A 3E0CA 4CZXA 1FWXA 3NVQA 4O45A 3BWSA 1PGUA 3EMHA 4L3HD 3ZWLB 5TF2A 4X61B 2XYIA 4E54B 3IJCA 4Y7RA 1MDAH 3RFHA 3EI1B 5GXIA 2PM6B 5H1MA 1TYQC 5IC7A 2B5NA 4BH6A 3OKYB 1OLZA 2HYEA 4A0AB 3OKYA 5K1CC 2W18A 3C75H 3MZKA 5IGQA 5TEFA 4CC9A 3SFZA 3HFQA 3RN1D 4A11A 1MG2A 3P4FA 3JZHA 4GM3A 3V9FA 2P9SC 3EG6A 1ERJA 1JOFA 3VGZA 4E5ZB 4Z8LA 1K32A 2AQ5A 2HESX 2YBAA 4A09A 2G99A 4Y5RD 5EM2B 3FRXA 3ULEC 1YFQA 3I7PA 4G56B 4GQ2P 5FKRA 3IJ0A 1U2VC 3IJ1A 4QQEA 3MKQA 4O9DA 2Z2NA 4LG8A 5GMKn 2CNXA 2I3SA 3JZGA 3PXSD 2IAAA 1PI6A 3DXMC 4J77A 3GFCA 4K3ID 4J84A 4X60B 3SXTD 4TZ4A 3SCYA 5I5MA 2HKRA 2PM7B 2P9KC 3UVNA 4ESGA 1P22A 3DM0A 2OJYA 5CXBA 2AGWA 4A2MA 4CZVA 4ZN4A 4QT8A 3UVOA 2TRCB 4X63B 4A7JA 4HDJA 3EI4A 2PM9A 4GM8A 5FLXg 5FA5B 2H3XA 3AL9A 3RMZD 2IWKA 3EI1A 1VYHC 4CI3A 2CN3A 5SXMA 2AGYA 2HJBA 2HJ4A 4PSXB 2P9IC 4CY2A 4BL0A 3V7DB 1N6EA 4J0XA 5EM2A 4FAND 1XKSA 5AFU3 4GGAA 3PVUB 5IJ7E 3K27A 3I8CA 4KFMB 3SHFA 4GGDA 5K19A 2YNOA 3FM0A 3N0EA 4FAVD 2I0TA 3U4YA 4XYIA 3IKOA 4CI8A 4ERQA 5C9ZB 4X3EA 3VA6A 3J81g 3C5MA 2GC7A 4A0BB 1K8KC 1MG3A 4O1QD 3OL2B 2P9LC 3L4OD 2H6KA 5THAA 2H47A 4JT5C 2QC5A 2O9KA 2HKMA 3F3GA 3I7HA 4XYHA 5H17A 3CFSB 3MMYA 3RN0D 2QXVA 3BG1A 4PXWA 5GSAA 4J78A 4LGNA 2YNPA 1OMWB 3CFVA 3AL8B 3FGBA 1Q47A 5EMKB 3A0FA 3SN6B 2AGZA 4CI2A 2Z2PA 2P9NC 1U4CA 1N6FA 4AOWA 3DXKC 4JSXC 3UVLA 3EI3B 3RLMD 3OL2A 2EBSA 4IMMA 1XIPA 4GQBB 1A0RB 5KDOB 3SVWD 2CE8A 2H13A 4A08A 4ERZA 3GREA 2CN2A 2OK6A 4GQ1A 2H68A 4JD2C 4J82A 1L0QA 3F3PA 4GZ8A 3SBQA 4NSXA 4QL1A 3OW8A 1JMXB 1GP2B 5HE2B 5EALA 3UKRC 5FKTA 4A0AA 5HE3B 5CXCB 2OVRB 3PE7A 3I89A 2UZYB 4CY3A 1PBYB 4E54A 5FKQA 5I5JA 1S4UX 3JB9L 5CYKB 3OTTA 2BCJB 1R5MA 1B9XA 5FKSA 2CE9A 3EU7A 2AH1A 2H6QA 3SMRA 3AFCA 3SLED 2CO0C 2G9AA 3SBPA 4PBYA 1TBGA 2OVQB 3IIWA 4JSNC 4OWRA 2GNQA 2IUPA 4J87A 4U1EI 5A2Qg 5B4WA 4A08B 3DSMA 4H5JA 3I7NA 4UI9R 4FHLA 4OZUA 2P9PC 4IA9A 4ES0A 4JSVC 4PC0A 5FQDA 2I3TA 4GMBA 4AEZA 4FA1D 2IWFA 1JMZB 4R7AB 4BUJC 4CI1A 4PSWB 3EI2B 2H9LA 2IUVA 3I7LA 4EWRA 2GC4A 5AJAA 5HE0B 5CYKA 2PBIB 5EMJB 4FA5D 2YMUA 5TEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU7 A;  3AL8 A;  4J8G A;  4JSP C;  3J80 g;  5HE1 B;  2YNN A;  4MK0 B;  3ORV D;  1GOT B;  1NEX B;  3EWE A;  4I79 A;  4K3J B;  1B9Y A;  4ZOV A;  5CXB B;  2BBK H;  3KRW B;  3SWS D;  5EAR A;  2H14 A;  1JJU B;  5FXY A;  1SQJ A;  3JRO A;  2H9N A;  3MKS B;  3UR4 A;  3F3F A;  3NVX A;  4O3T B;  3N0D A;  2J57 G;  4A11 B;  1GXR A;  2YB8 B;  2AGX A;  3C99 A;  3I8E A;  5HYN B;  4FB1 D;  5AMS A;  3OKW A;  5IGO A;  4E5Z A;  2H9P A;  3I7K A;  1RI6 A;  4J86 A;  5EAP A;  2B5M A;  3CIK B;  3JPX A;  5C2V B;  2AH0 A;  3W15 A;  3JAM g;  4D0K A;  2Z2O A;  2B4E A;  1GG2 B;  3PXW D;  1XHM A;  4D6V A;  3EI2 A;  4J73 A;  3SBR A;  2AGL A;  3L4M D;  5EMM B;  3UVM A;  4ZOZ A;  1PEV A;  4XEI C;  2IUR A;  3I7O A;  1SQ9 A;  2MTA H;  3C9C A;  4J79 A;  5GXH A;  2PM9 B;  2J55 H;  3EI4 B;  2H6N A;  3MXX A;  3UVK A;  4L1Q D;  4CY1 A;  3JZN A;  3OKT A;  3RSE C;  2CO0 A;  1N6D A;  4ZOX A;  5HQG A;  4FA4 D;  4JT6 C;  2HXC A;  3DWL C;  2H9M A;  5IT9 g;  4CZY A;  4FWW A;  3KRX B;  4FA9 D;  4YVD A;  4J0W A;  4U7A A;  3B7F A;  5JWZ A;  5TDH B;  3NVN A;  3K26 A;  3SJL D;  3IIY A;  2OIZ A;  5CXC A;  4L3G D;  4O3U B;  5EAM A;  3JRP A;  4LG9 A;  4QRJ A;  4N14 A;  3MZL A;  3PXT D;  3PSC B;  4JXM A;  3VH0 A;  3UKU C;  5C2W B;  4H5I A;  3PVW B;  1SHY B;  4PNK B;  3ODT A;  4L9O A;  3BG0 A;  3I2N A;  4CY5 A;  4A2L A;  3EI3 A;  4J8B A;  4GGC A;  3RRM C;  2OVP B;  5EML B;  5IJ8 E;  4A0B A;  4ERY A;  5I5I A;  3AH8 B;  2I0R A;  1NR0 A;  2Q7Q A;  4A09 B;  2J56 H;  2IUQ A;  2I0S A;  3V5W B;  4ZOY A;  4J81 A;  3RFG A;  4GM9 A;  2B5L A;  2P9U C;  3PSL A;  1QNI A;  2UZX B;  5H14 A;  2XL3 A;  4PBZ A;  2OK4 A;  2XL2 A;  3E0C A;  4CZX A;  1FWX A;  3NVQ A;  4O45 A;  3BWS A;  1PGU A;  3EMH A;  4L3H D;  3ZWL B;  5TF2 A;  4X61 B;  2XYI A;  4E54 B;  3IJC A;  4Y7R A;  1MDA H;  3RFH A;  3EI1 B;  5GXI A;  2PM6 B;  5H1M A;  1TYQ C;  5IC7 A;  2B5N A;  4BH6 A;  3OKY B;  1OLZ A;  2HYE A;  4A0A B;  3OKY A;  5K1C C;  2W18 A;  3C75 H;  3MZK A;  5IGQ A;  5TEF A;  4CC9 A;  3SFZ A;  3HFQ A;  3RN1 D;  4A11 A;  1MG2 A;  3P4F A;  3JZH A;  4GM3 A;  3V9F A;  2P9S C;  3EG6 A;  1ERJ A;  1JOF A;  3VGZ A;  4E5Z B;  4Z8L A;  1K32 A;  2AQ5 A;  2HES X;  2YBA A;  4A09 A;  2G99 A;  4Y5R D;  5EM2 B;  3FRX A;  3ULE C;  1YFQ A;  3I7P A;  4G56 B;  4GQ2 P;  5FKR A;  3IJ0 A;  1U2V C;  3IJ1 A;  4QQE A;  3MKQ A;  4O9D A;  2Z2N A;  4LG8 A;  5GMK n;  2CNX A;  2I3S A;  3JZG A;  3PXS D;  2IAA A;  1PI6 A;  3DXM C;  4J77 A;  3GFC A;  4K3I D;  4J84 A;  4X60 B;  3SXT D;  4TZ4 A;  3SCY A;  5I5M A;  2HKR A;  2PM7 B;  2P9K C;  3UVN A;  4ESG A;  1P22 A;  3DM0 A;  2OJY A;  5CXB A;  2AGW A;  4A2M A;  4CZV A;  4ZN4 A;  4QT8 A;  3UVO A;  2TRC B;  4X63 B;  4A7J A;  4HDJ A;  3EI4 A;  2PM9 A;  4GM8 A;  5FLX g;  5FA5 B;  2H3X A;  3AL9 A;  3RMZ D;  2IWK A;  3EI1 A;  1VYH C;  4CI3 A;  2CN3 A;  5SXM A;  2AGY A;  2HJB A;  2HJ4 A;  4PSX B;  2P9I C;  4CY2 A;  4BL0 A;  3V7D B;  1N6E A;  4J0X A;  5EM2 A;  4FAN D;  1XKS A;  5AFU 3;  4GGA A;  3PVU B;  5IJ7 E;  3K27 A;  3I8C A;  4KFM B;  3SHF A;  4GGD A;  5K19 A;  2YNO A;  3FM0 A;  3N0E A;  4FAV D;  2I0T A;  3U4Y A;  4XYI A;  3IKO A;  4CI8 A;  4ERQ A;  5C9Z B;  4X3E A;  3VA6 A;  3J81 g;  3C5M A;  2GC7 A;  4A0B B;  1K8K C;  1MG3 A;  4O1Q D;  3OL2 B;  2P9L C;  3L4O D;  2H6K A;  5THA A;  2H47 A;  4JT5 C;  2QC5 A;  2O9K A;  2HKM A;  3F3G A;  3I7H A;  4XYH A;  5H17 A;  3CFS B;  3MMY A;  3RN0 D;  2QXV A;  3BG1 A;  4PXW A;  5GSA A;  4J78 A;  4LGN A;  2YNP A;  1OMW B;  3CFV A;  3AL8 B;  3FGB A;  1Q47 A;  5EMK B;  3A0F A;  3SN6 B;  2AGZ A;  4CI2 A;  2Z2P A;  2P9N C;  1U4C A;  1N6F A;  4AOW A;  3DXK C;  4JSX C;  3UVL A;  3EI3 B;  3RLM D;  3OL2 A;  2EBS A;  4IMM A;  1XIP A;  4GQB B;  1A0R B;  5KDO B;  3SVW D;  2CE8 A;  2H13 A;  4A08 A;  4ERZ A;  3GRE A;  2CN2 A;  2OK6 A;  4GQ1 A;  2H68 A;  4JD2 C;  4J82 A;  1L0Q A;  3F3P A;  4GZ8 A;  3SBQ A;  4NSX A;  4QL1 A;  3OW8 A;  1JMX B;  1GP2 B;  5HE2 B;  5EAL A;  3UKR C;  5FKT A;  4A0A A;  5HE3 B;  5CXC B;  2OVR B;  3PE7 A;  3I89 A;  2UZY B;  4CY3 A;  1PBY B;  4E54 A;  5FKQ A;  5I5J A;  1S4U X;  3JB9 L;  5CYK B;  3OTT A;  2BCJ B;  1R5M A;  1B9X A;  5FKS A;  2CE9 A;  3EU7 A;  2AH1 A;  2H6Q A;  3SMR A;  3AFC A;  3SLE D;  2CO0 C;  2G9A A;  3SBP A;  4PBY A;  1TBG A;  2OVQ B;  3IIW A;  4JSN C;  4OWR A;  2GNQ A;  2IUP A;  4J87 A;  4U1E I;  5A2Q g;  5B4W A;  4A08 B;  3DSM A;  4H5J A;  3I7N A;  4UI9 R;  4FHL A;  4OZU A;  2P9P C;  4IA9 A;  4ES0 A;  4JSV C;  4PC0 A;  5FQD A;  2I3T A;  4GMB A;  4AEZ A;  4FA1 D;  2IWF A;  1JMZ B;  4R7A B;  4BUJ C;  4CI1 A;  4PSW B;  3EI2 B;  2H9L A;  2IUV A;  3I7L A;  4EWR A;  2GC4 A;  5AJA A;  5HE0 B;  5CYK A;  2PBI B;  5EMJ B;  4FA5 D;  2YMU A;  5TEE A; 
#chains in the Genus database with same CATH topology
 2XU7 A;  3AL8 A;  4J8G A;  4JSP C;  3J80 g;  4Z7O A;  5HE1 B;  2YNN A;  3KCI A;  4DNU A;  1JV2 A;  4MK0 B;  3IJE A;  2EIB A;  3ORV D;  1GOT B;  1NEX B;  3EWE A;  4I79 A;  4K3J B;  1B9Y A;  4ZOV A;  4WK0 A;  5CXB B;  2BBK H;  5M5S A;  4RE5 A;  3KRW B;  1E5T A;  3SWS D;  5EAR A;  2H14 A;  1JJU B;  3MUO A;  5FXY A;  1SQJ A;  3EQ7 A;  3JRO A;  2H9N A;  1H2Z A;  3MKS B;  3UR4 A;  3F3F A;  3NVX A;  4O3T B;  3T3M A;  3N0D A;  2J57 G;  4A11 B;  1GXR A;  2YB8 B;  2AGX A;  3C99 A;  3I8E A;  2QZP A;  5HYN B;  4FB1 D;  5AMS A;  3OKW A;  5IGO A;  2VDR A;  4RE6 A;  4E5Z A;  4O02 A;  1UOP A;  2H9P A;  3I7K A;  1RI6 A;  3IUQ A;  4J86 A;  5EAP A;  2B5M A;  3CIK B;  2XDW A;  4O2W A;  3JPX A;  5C2V B;  2AH0 A;  3W15 A;  5M61 A;  3JAM g;  4D0K A;  3NIG A;  2Z2O A;  2B4E A;  1GG2 B;  3PXW D;  1XHM A;  4D6V A;  3EI2 A;  4J73 A;  3SBR A;  2AGL A;  3L4M D;  5EMM B;  3UVM A;  4ZOZ A;  3NID A;  1PEV A;  4XEI C;  2IUR A;  3I7O A;  3IUL A;  1SQ9 A;  2MTA H;  3C9C A;  4J79 A;  5GXH A;  2PM9 B;  2J55 H;  3EI4 B;  2H6N A;  3FCU A;  3MXX A;  3UVK A;  4L1Q D;  2JKX A;  4CY1 A;  3JZN A;  3OKT A;  3RSE C;  1UTC A;  1N6D A;  2CO0 A;  4ZOX A;  5HQG A;  4FA4 D;  4JT6 C;  3IUR A;  2HXC A;  3DWL C;  2H9M A;  5IT9 g;  4CZY A;  5M5V A;  4FWW A;  1C9I A;  1VZ2 A;  3KRX B;  4FA9 D;  4YVD A;  1H2W A;  4J0W A;  4U7A A;  5HDB A;  4BP8 A;  3B7F A;  5JWZ A;  2HU5 A;  5TDH B;  3NVN A;  3K26 A;  3SJL D;  4WK4 A;  3IIY A;  2OIZ A;  3V4P A;  5CXC A;  1M1X A;  4L3G D;  2BKL A;  3O4H A;  4O3U B;  3ZDY A;  5EAM A;  3JRP A;  4LG9 A;  4QRJ A;  4N14 A;  1UOO A;  3MZL A;  3VI3 A;  3NIF A;  1A12 A;  4MMZ A;  2XE4 A;  3PXT D;  3PSC B;  4JXM A;  3VH0 A;  3UKU C;  5C2W B;  5C86 A;  4AMZ A;  4H5I A;  3PVW B;  1SHY B;  1GOG A;  4PNK B;  1U8C A;  3ODT A;  4L9O A;  3BG0 A;  3I2N A;  4CY5 A;  2VC2 A;  4A2L A;  3EI3 A;  4J8B A;  4IRZ A;  5E6U A;  4GGC A;  3RRM C;  2OVP B;  5EML B;  5IJ8 E;  1E8N A;  4AN1 A;  4D9S A;  4A0B A;  4ERY A;  5I5I A;  3AH8 B;  2I0R A;  1NR0 A;  2Q7Q A;  4A09 B;  2J56 H;  2IUQ A;  3K71 A;  2I0S A;  3IVM A;  4UM8 A;  3V5W B;  4ZOY A;  4J81 A;  3RFG A;  4GM9 A;  1QFS A;  2B5L A;  2P9U C;  3PSL A;  4NC4 A;  1QNI A;  2UZX B;  5H14 A;  2XL3 A;  1UOQ A;  4PBZ A;  2OK4 A;  2XL2 A;  3E0C A;  4CZX A;  1FWX A;  3NVQ A;  4O45 A;  3GD1 I;  3BWS A;  1PGU A;  3EMH A;  4L3H D;  3ZWL B;  5TF2 A;  4X61 B;  2XYI A;  4E54 B;  3DDU A;  3IJC A;  4Y7R A;  1MDA H;  3RFH A;  3EI1 B;  5GXI A;  2PM6 B;  5H1M A;  4Z7Q A;  4BCB A;  1TYQ C;  5IC7 A;  2B5N A;  4BH6 A;  3OKY B;  1OLZ A;  3EQ9 A;  2HYE A;  4A0A B;  3OKY A;  5K1C C;  2W18 A;  3C75 H;  2VDO A;  3MZK A;  5IGQ A;  5TEF A;  4CC9 A;  2EIC A;  3SFZ A;  3HFQ A;  1VE6 A;  3RN1 D;  4A11 A;  1MG2 A;  4L1M A;  3P4F A;  3JZH A;  3IUN A;  3K72 A;  4GM3 A;  3V9F A;  4BP9 A;  2P9S C;  3EG6 A;  1I2M B;  1ERJ A;  4G1M A;  1JOF A;  2HU8 A;  3VGZ A;  4E5Z B;  4Z8L A;  1K32 A;  2AQ5 A;  2HES X;  1GOH A;  2YBA A;  4A09 A;  1O6F A;  2G99 A;  4Y5R D;  4NAA A;  3V4V A;  3ZE0 A;  3ZDX A;  1E8M A;  3FRX A;  3ULE C;  5EM2 B;  1YFQ A;  5M5T A;  3GC3 B;  3I7P A;  4G56 B;  2VDM A;  4GQ2 P;  5FKR A;  1TYE A;  3IJ0 A;  1U2V C;  3IJ1 A;  4QQE A;  3MKQ A;  4O9D A;  2Z2N A;  4LG8 A;  5GMK n;  2CNX A;  2I3S A;  4AMY A;  3JZG A;  3PXS D;  2IAA A;  1PI6 A;  3DXM C;  4J77 A;  3O4I A;  3GFC A;  4NBM A;  4K3I D;  4J84 A;  4X60 B;  1GOF A;  3SXT D;  4TZ4 A;  3SCY A;  5I5M A;  2HKR A;  2PM7 B;  2P9K C;  2QR5 A;  3UVN A;  4ESG A;  1P22 A;  3DM0 A;  2OJY A;  5CXB A;  2AGW A;  4A2M A;  1T2X A;  4CZV A;  4ZN4 A;  4QT8 A;  3UVO A;  2TRC B;  4X63 B;  1O6G A;  2HU7 A;  4A7J A;  4HDJ A;  3EI4 A;  2PM9 A;  4GM8 A;  5FLX g;  3ZE2 A;  5FA5 B;  2H3X A;  3AL9 A;  3RMZ D;  3QI0 A;  5FFO A;  2EID A;  2IWK A;  3EI1 A;  1VYH C;  4CI3 A;  4WK2 A;  2CN3 A;  5SXM A;  2AGY A;  2HJB A;  4AN0 A;  1C9L A;  2HJ4 A;  4PSX B;  2P9I C;  4CY2 A;  4BL0 A;  3V7D B;  1N6E A;  4J0X A;  5EM2 A;  4FAN D;  1XKS A;  5AFU 3;  4GGA A;  3PVU B;  5IJ7 E;  3K27 A;  3I8C A;  4KFM B;  3SHF A;  4GGD A;  5K19 A;  2YNO A;  3FM0 A;  4NEN A;  3N0E A;  4FAV D;  2I0T A;  1JTD B;  4XYI A;  1BPO A;  3MUN A;  3IKO A;  3U4Y A;  4CI8 A;  4ERQ A;  5C9Z B;  4X3E A;  3VA6 A;  3J81 g;  3C5M A;  5FFG A;  4DNW A;  2GC7 A;  4A0B B;  1K8K C;  1MG3 A;  4O1Q D;  3OL2 B;  3MVD K;  3ZE1 A;  2P9L C;  3L4O D;  2H6K A;  5THA A;  1H2Y A;  1QFM A;  2H47 A;  4JT5 C;  3IUM A;  2QC5 A;  2O9K A;  2HKM A;  3F3G A;  3I7H A;  4XYH A;  2VDK A;  5H17 A;  3CFS B;  3MMY A;  3OF7 A;  4G1E A;  3RN0 D;  2QXV A;  3BG1 A;  5C92 A;  4PXW A;  3IUJ A;  5GSA A;  4J78 A;  4LGN A;  3O4J A;  2YNP A;  1OMW B;  2XZG A;  3CFV A;  3AL8 B;  3FGB A;  1Q47 A;  5E6R A;  5E6S A;  5EMK B;  3A0F A;  2EIE A;  3SN6 B;  2AGZ A;  4CI2 A;  2Z2P A;  3T3P A;  3EQ8 A;  1H2X A;  2P9N C;  1U4C A;  1N6F A;  4AOW A;  2VDL A;  3DXK C;  4JSX C;  3UVL A;  3EI3 B;  4Z7N A;  3RLM D;  2VZ1 A;  3OL2 A;  2EBS A;  4IMM A;  1XIP A;  4GQB B;  1A0R B;  1VZ3 A;  5KDO B;  3SVW D;  2CE8 A;  2H13 A;  4A08 A;  4ERZ A;  3GRE A;  2CN2 A;  2OK6 A;  4GQ1 A;  2H68 A;  4JD2 C;  4J82 A;  1L0Q A;  3QHY B;  3F3P A;  4GZ8 A;  3SBQ A;  4NSX A;  4QL1 A;  3ZDZ A;  3OW8 A;  1JMX B;  1GP2 B;  3O4G A;  5HE2 B;  5EAL A;  3UKR C;  5FKT A;  4A0A A;  5HE3 B;  5CXC B;  2OVR B;  3PE7 A;  2VDQ A;  3I89 A;  2UZY B;  2VDN A;  4CY3 A;  1PBY B;  4E54 A;  5FKQ A;  4QAM A;  5I5J A;  1S4U X;  3JB9 L;  4WJK A;  5CYK B;  3OTT A;  4DNV A;  4UM9 A;  2BCJ B;  1R5M A;  4G55 A;  1B9X A;  5FKS A;  2CE9 A;  3EU7 A;  2AH1 A;  2H6Q A;  3SMR A;  3AFC A;  3SLE D;  4MMX A;  1YR2 A;  2CO0 C;  2VDP A;  4AX4 A;  2G9A A;  3SBP A;  4BCC A;  4PBY A;  1TBG A;  2VZ3 A;  2OVQ B;  3IIW A;  4JSN C;  4OWR A;  4JHN A;  2GNQ A;  2IUP A;  4J87 A;  4U1E I;  5A2Q g;  5M5U A;  5B4W A;  3K6S A;  4A08 B;  1K3I A;  3DSM A;  4H5J A;  3I7N A;  4UI9 R;  4FHL A;  5M5R A;  4JHP C;  4OZU A;  2P9P C;  4IA9 A;  4ES0 A;  4JSV C;  4PC0 A;  5FQD A;  3FCS A;  2I3T A;  4GMB A;  4AEZ A;  4FA1 D;  1L5G A;  2WQ8 A;  2IWF A;  1JMZ B;  4R7A B;  4BUJ C;  4CI1 A;  4PSW B;  3EI2 B;  2H9L A;  1VE7 A;  2IUV A;  3I7L A;  3VI4 A;  2GC4 A;  4EWR A;  5AJA A;  5HE0 B;  5CYK A;  2PBI B;  5EMJ B;  4FA5 D;  4BCD A;  4MMY A;  2YMU A;  5TEE A; 
#chains in the Genus database with same CATH homology
 2XU7 A;  3AL8 A;  4J8G A;  4JSP C;  3J80 g;  5HE1 B;  2YNN A;  4MK0 B;  3ORV D;  1GOT B;  1NEX B;  3EWE A;  4I79 A;  4K3J B;  1B9Y A;  4ZOV A;  5CXB B;  2BBK H;  3KRW B;  3SWS D;  5EAR A;  2H14 A;  1JJU B;  5FXY A;  1SQJ A;  3JRO A;  2H9N A;  3MKS B;  3UR4 A;  3F3F A;  3NVX A;  4O3T B;  3N0D A;  2J57 G;  4A11 B;  1GXR A;  2YB8 B;  2AGX A;  3C99 A;  3I8E A;  5HYN B;  4FB1 D;  5AMS A;  3OKW A;  5IGO A;  4E5Z A;  2H9P A;  3I7K A;  1RI6 A;  4J86 A;  5EAP A;  2B5M A;  3CIK B;  3JPX A;  5C2V B;  2AH0 A;  3W15 A;  3JAM g;  4D0K A;  2Z2O A;  2B4E A;  1GG2 B;  3PXW D;  1XHM A;  4D6V A;  3EI2 A;  4J73 A;  3SBR A;  2AGL A;  3L4M D;  5EMM B;  3UVM A;  4ZOZ A;  1PEV A;  4XEI C;  2IUR A;  3I7O A;  1SQ9 A;  2MTA H;  3C9C A;  4J79 A;  5GXH A;  2PM9 B;  2J55 H;  3EI4 B;  2H6N A;  3MXX A;  3UVK A;  4L1Q D;  4CY1 A;  3JZN A;  3OKT A;  3RSE C;  2CO0 A;  1N6D A;  4ZOX A;  5HQG A;  4FA4 D;  4JT6 C;  2HXC A;  3DWL C;  2H9M A;  5IT9 g;  4CZY A;  4FWW A;  3KRX B;  4FA9 D;  4YVD A;  4J0W A;  4U7A A;  3B7F A;  5JWZ A;  5TDH B;  3NVN A;  3K26 A;  3SJL D;  3IIY A;  2OIZ A;  5CXC A;  4L3G D;  4O3U B;  5EAM A;  3JRP A;  4LG9 A;  4QRJ A;  4N14 A;  3MZL A;  3PXT D;  3PSC B;  4JXM A;  3VH0 A;  3UKU C;  5C2W B;  4H5I A;  3PVW B;  1SHY B;  4PNK B;  3ODT A;  4L9O A;  3BG0 A;  3I2N A;  4CY5 A;  4A2L A;  3EI3 A;  4J8B A;  4GGC A;  3RRM C;  2OVP B;  5EML B;  5IJ8 E;  4A0B A;  4ERY A;  5I5I A;  3AH8 B;  2I0R A;  1NR0 A;  2Q7Q A;  4A09 B;  2J56 H;  2IUQ A;  2I0S A;  3V5W B;  4ZOY A;  4J81 A;  3RFG A;  4GM9 A;  2B5L A;  2P9U C;  3PSL A;  1QNI A;  2UZX B;  5H14 A;  2XL3 A;  4PBZ A;  2OK4 A;  2XL2 A;  3E0C A;  4CZX A;  1FWX A;  3NVQ A;  4O45 A;  3BWS A;  1PGU A;  3EMH A;  4L3H D;  3ZWL B;  5TF2 A;  4X61 B;  2XYI A;  4E54 B;  3IJC A;  4Y7R A;  1MDA H;  3RFH A;  3EI1 B;  5GXI A;  2PM6 B;  5H1M A;  1TYQ C;  5IC7 A;  2B5N A;  4BH6 A;  3OKY B;  1OLZ A;  2HYE A;  4A0A B;  3OKY A;  5K1C C;  2W18 A;  3C75 H;  3MZK A;  5IGQ A;  5TEF A;  4CC9 A;  3SFZ A;  3HFQ A;  3RN1 D;  4A11 A;  1MG2 A;  3P4F A;  3JZH A;  4GM3 A;  3V9F A;  2P9S C;  3EG6 A;  1ERJ A;  1JOF A;  3VGZ A;  4E5Z B;  4Z8L A;  1K32 A;  2AQ5 A;  2HES X;  2YBA A;  4A09 A;  2G99 A;  4Y5R D;  5EM2 B;  3FRX A;  3ULE C;  1YFQ A;  3I7P A;  4G56 B;  4GQ2 P;  5FKR A;  3IJ0 A;  1U2V C;  3IJ1 A;  4QQE A;  3MKQ A;  4O9D A;  2Z2N A;  4LG8 A;  5GMK n;  2CNX A;  2I3S A;  3JZG A;  3PXS D;  2IAA A;  1PI6 A;  3DXM C;  4J77 A;  3GFC A;  4K3I D;  4J84 A;  4X60 B;  3SXT D;  4TZ4 A;  3SCY A;  5I5M A;  2HKR A;  2PM7 B;  2P9K C;  3UVN A;  4ESG A;  1P22 A;  3DM0 A;  2OJY A;  5CXB A;  2AGW A;  4A2M A;  4CZV A;  4ZN4 A;  4QT8 A;  3UVO A;  2TRC B;  4X63 B;  4A7J A;  4HDJ A;  3EI4 A;  2PM9 A;  4GM8 A;  5FLX g;  5FA5 B;  2H3X A;  3AL9 A;  3RMZ D;  2IWK A;  3EI1 A;  1VYH C;  4CI3 A;  2CN3 A;  5SXM A;  2AGY A;  2HJB A;  2HJ4 A;  4PSX B;  2P9I C;  4CY2 A;  4BL0 A;  3V7D B;  1N6E A;  4J0X A;  5EM2 A;  4FAN D;  1XKS A;  5AFU 3;  4GGA A;  3PVU B;  5IJ7 E;  3K27 A;  3I8C A;  4KFM B;  3SHF A;  4GGD A;  5K19 A;  2YNO A;  3FM0 A;  3N0E A;  4FAV D;  2I0T A;  3U4Y A;  4XYI A;  3IKO A;  4CI8 A;  4ERQ A;  5C9Z B;  4X3E A;  3VA6 A;  3J81 g;  3C5M A;  2GC7 A;  4A0B B;  1K8K C;  1MG3 A;  4O1Q D;  3OL2 B;  2P9L C;  3L4O D;  2H6K A;  5THA A;  2H47 A;  4JT5 C;  2QC5 A;  2O9K A;  2HKM A;  3F3G A;  3I7H A;  4XYH A;  5H17 A;  3CFS B;  3MMY A;  3RN0 D;  2QXV A;  3BG1 A;  4PXW A;  5GSA A;  4J78 A;  4LGN A;  2YNP A;  1OMW B;  3CFV A;  3AL8 B;  3FGB A;  1Q47 A;  5EMK B;  3A0F A;  3SN6 B;  2AGZ A;  4CI2 A;  2Z2P A;  2P9N C;  1U4C A;  1N6F A;  4AOW A;  3DXK C;  4JSX C;  3UVL A;  3EI3 B;  3RLM D;  3OL2 A;  2EBS A;  4IMM A;  1XIP A;  4GQB B;  1A0R B;  5KDO B;  3SVW D;  2CE8 A;  2H13 A;  4A08 A;  4ERZ A;  3GRE A;  2CN2 A;  2OK6 A;  4GQ1 A;  2H68 A;  4JD2 C;  4J82 A;  1L0Q A;  3F3P A;  4GZ8 A;  3SBQ A;  4NSX A;  4QL1 A;  3OW8 A;  1JMX B;  1GP2 B;  5HE2 B;  5EAL A;  3UKR C;  5FKT A;  4A0A A;  5HE3 B;  5CXC B;  2OVR B;  3PE7 A;  3I89 A;  2UZY B;  4CY3 A;  1PBY B;  4E54 A;  5FKQ A;  5I5J A;  1S4U X;  3JB9 L;  5CYK B;  3OTT A;  2BCJ B;  1R5M A;  1B9X A;  5FKS A;  2CE9 A;  3EU7 A;  2AH1 A;  2H6Q A;  3SMR A;  3AFC A;  3SLE D;  2CO0 C;  2G9A A;  3SBP A;  4PBY A;  1TBG A;  2OVQ B;  3IIW A;  4JSN C;  4OWR A;  2GNQ A;  2IUP A;  4J87 A;  4U1E I;  5A2Q g;  5B4W A;  4A08 B;  3DSM A;  4H5J A;  3I7N A;  4UI9 R;  4FHL A;  4OZU A;  2P9P C;  4IA9 A;  4ES0 A;  4JSV C;  4PC0 A;  5FQD A;  2I3T A;  4GMB A;  4AEZ A;  4FA1 D;  2IWF A;  1JMZ B;  4R7A B;  4BUJ C;  4CI1 A;  4PSW B;  3EI2 B;  2H9L A;  2IUV A;  3I7L A;  4EWR A;  2GC4 A;  5AJA A;  5HE0 B;  5CYK A;  2PBI B;  5EMJ B;  4FA5 D;  2YMU A;  5TEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...