3SJLD

Crystal structure of the p107s-maug/pre-methylamine dehydrogenase complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein mauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 95
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sjlD00
1A0RB 2G99A 2B5NA 3BG1A 4L3HD 3I7OA 3CFVA 5HYNB 1OMWB 1PGUA 3GREA 4IA9A 4PNKB 5CYKB 4U1EI 4JD2C 5EAPA 2YBAA 3K26A 2HKRA 2OIZA 2OVQB 4FA1D 3K27A 4JSNC 4O9DA 4QQEA 3FRXA 2UZXB 3SFZA 2BCJB 2QC5A 3ZWLB 2XYIA 3ODTA 5C9ZB 3EI2B 3OW8A 3MXXA 3F3PA 4J73A 5I5MA 4CC9A 2AGWA 4GM3A 4X61B 3PE7A 4PBZA 1B9YA 3SMRA 3VGZA 2YNNA 3PXTD 4J82A 2IUQA 2YNPA 3FM0A 1MG3A 2P9PC 1NEXB 4YVDA 2H9PA 5KDOB 4CZXA 3RMZD 3V9FA 2P9LC 3NVXA 5TF2A 2IWKA 2CE8A 2P9IC 5FA5B 1GP2B 1VYHC 3EI1B 2P9NC 4Z8LA 3PVWB 2HYEA 3N0DA 3NVQA 4ES0A 4FWWA 4CY5A 1RI6A 3FGBA 3KRXB 4E54B 4J79A 4JT5C 2I3TA 3EG6A 4Y7RA 4ZOXA 3N0EA 3C75H 2IURA 4LG9A 3SWSD 5HE3B 3SBQA 3EMHA 3ULEC 4FAVD 4ERYA 1ERJA 4ESGA 5AFU3 4LG8A 2H13A 4J86A 3C99A 1XKSA 4Y5RD 4D6VA 2H6QA 4J87A 4ZN4A 3IKOA 3UVLA 4GGCA 1N6EA 2EBSA 4O1QD 2OK6A 5HE2B 2O9KA 5GXHA 4ERZA 4L9OA 3EI4B 4JSPC 1PBYB 5GMKn 5A2Qg 4BH6A 5EAMA 2HESX 4A2MA 2GNQA 4OWRA 3BG0A 2HKMA 3IIYA 4GMBA 5FLXg 2GC4A 2H14A 4JSVC 4CY3A 3KRWB 5FKTA 5IGOA 2Z2PA 4XYHA 2AGYA 1NR0A 4CI8A 3SHFA 4O3TB 4QT8A 4MK0B 3UKRC 3V5WB 3EU7A 1GG2B 4GQ2P 4X60B 3JZGA 2AH1A 1K32A 1OLZA 4G56B 4GM9A 3AL8B 2XL3A 1QNIA 4ZOVA 2HXCA 5TEFA 4A0BB 3PVUB 2Z2NA 3U4YA 3I89A 3NVNA 2IUVA 2PM9B 3OKTA 4FB1D 5B4WA 5C2VB 4GQBB 5FKSA 2J57G 5IGQA 3AL8A 3PSLA 4A2LA 4KFMB 1N6FA 3CFSB 1JOFA 4QRJA 5TDHB 5CYKA 4UI9R 4ERQA 4JXMA 2P9KC 3UVNA 5TEEA 3I8EA 3DXMC 5H14A 5IC7A 4CZVA 5EM2B 3IJCA 2I0RA 2IAAA 4AOWA 5AMSA 3I7KA 2OK4A 3UKUC 1XHMA 3V7DB 2YNOA 1U2VC 3EI2A 2J55H 4BUJC 4EWRA 5JWZA 4J8BA 1MDAH 4LGNA 2H47A 3RN1D 3VA6A 3SCYA 5FKRA 1JMXB 1P22A 3MMYA 2MTAH 3CIKB 4E5ZB 3RFHA 3I7LA 4GGDA 4PXWA 3MZLA 2IUPA 4A09B 3AL9A 2H6NA 1YFQA 4GGAA 3F3GA 4J78A 3UVOA 3C5MA 2TRCB 5EALA 3F3FA 5C2WB 1K8KC 2GC7A 2AH0A 4XYIA 3EI1A 5FQDA 2AGXA 2CO0A 2CO0C 5IJ8E 4FAND 1XIPA 5SXMA 2AQ5A 4E54A 4A11B 3SLED 3JZNA 2H9NA 3AH8B 3OKYB 3IJ1A 4N14A 3UR4A 4CZYA 3I2NA 2CN3A 4JSXC 3EWEA 3SBPA 2HJBA 3UVMA 1GXRA 5GXIA 2YMUA 4ZOZA 3VH0A 4X3EA 3OKWA 3DSMA 4A0AB 3OTTA 2CNXA 1L0QA 5GSAA 3E0CA 1GOTB 4O3UB 3EI4A 3I8CA 3ORVD 3RLMD 3BWSA 3L4OD 4CY2A 5FKQA 3JB9L 5CXCB 3RSEC 3EI3B 2Q7QA 4J77A 4PC0A 5IJ7E 3SJLD 5EMJB 4H5JA 3SXTD 4TZ4A 4K3ID 2W18A 4J0XA 5HE1B 3UVKA 4CI1A 3MZKA 5K1CC 2CE9A 2Z2OA 3JROA 1PI6A 2HJ4A 4FA5D 3GFCA 5HQGA 2BBKH 4GM8A 2PM7B 2PBIB 3I7HA 1Q47A 2H9LA 5I5JA 4D0KA 5H1MA 3IJ0A 4A0BA 4K3JB 4BL0A 5CXBB 2PM9A 4O45A 2H68A 5EARA 3JAMg 2UZYB 2AGLA 4X63B 4CY1A 2H9MA 1FWXA 2J56H 4XEIC 3J81g 5K19A 5CXBA 4CI3A 3SN6B 1MG2A 3MKSB 5AJAA 5EM2A 1SQ9A 4CI2A 1N6DA 3IIWA 2H6KA 4JT6C 2I3SA 3HFQA 4QL1A 3DWLC 3SVWD 1JMZB 4NSXA 4J8GA 3DM0A 4PSWB 3B7FA 5FXYA 4FA9D 1TYQC 3AFCA 4H5IA 5THAA 4PSXB 4E5ZA 4A09A 3L4MD 4FHLA 3MKQA 2CN2A 2OJYA 3I7NA 4L1QD 5I5IA 2AGZA 3C9CA 3J80g 5EMKB 4AEZA 2B4EA 4I79A 1JJUB 4R7AB 5EMLB 1PEVA 2XU7A 3RRMC 3OL2B 4J84A 2YB8B 4A11A 4FA4D 2B5LA 1S4UX 4PBYA 3W15A 2P9UC 1R5MA 3OKYA 5HE0B 4GZ8A 4J81A 4U7AA 1TBGA 4A08B 4IMMA 1U4CA 4A7JA 3PXWD 4ZOYA 2OVRB 2PM6B 3PSCB 3RFGA 5EMMB 1B9XA 2H3XA 3OL2A 3RN0D 3P4FA 3JZHA 3DXKC 2G9AA 4J0WA 1SQJA 3SBRA 2XL2A 4A0AA 3JPXA 2P9SC 4L3GD 4A08A 5IT9g 2IWFA 2QXVA 3A0FA 3PXSD 3JRPA 4OZUA 4HDJA 2B5MA 5H17A 4GQ1A 2I0SA 3I7PA 2OVPB 2I0TA 1SHYB 5CXCA 3EI3A
chains in the Genus database with same CATH superfamily
1A0RB 2XZGA 2G99A 2B5NA 5M5VA 3BG1A 4DNUA 4L3HD 3I7OA 3CFVA 5HYNB 1OMWB 2QR5A 1PGUA 3GREA 4IA9A 4PNKB 5CYKB 4MMXA 4U1EI 4JD2C 3DDUA 5EAPA 2YBAA 3K26A 2HKRA 2OIZA 2OVQB 4MMYA 4FA1D 3K27A 4JSNC 1JV2A 4O9DA 2QZPA 4QQEA 3FRXA 2UZXB 3SFZA 2BCJB 2QC5A 3ZWLB 2XYIA 2HU7A 3FCUA 3ODTA 5C9ZB 3EI2B 3OW8A 3MXXA 3EQ8A 3IJEA 3F3PA 2HU8A 4J73A 3ZE1A 5I5MA 4CC9A 2AGWA 4GM3A 4X61B 3PE7A 4PBZA 1B9YA 3SMRA 2EIEA 3VGZA 4BCBA 2YNNA 3PXTD 4J82A 2WQ8A 3MVDK 3MUNA 2IUQA 2YNPA 3FM0A 1MG3A 5C92A 1UOOA 2VDPA 2P9PC 1O6FA 1NEXB 4YVDA 2H9PA 5KDOB 4CZXA 3RMZD 1BPOA 3V9FA 2P9LC 5M5TA 3IUJA 3NVXA 5TF2A 2IWKA 2CE8A 2P9IC 3ZDZA 1QFSA 5FA5B 1GP2B 1VYHC 3EI1B 2P9NC 4Z8LA 3PVWB 5FFGA 2HYEA 3N0DA 3NVQA 4ES0A 4FWWA 4CY5A 1RI6A 4DNVA 3FGBA 3KRXB 4E54B 4J79A 4JT5C 2I3TA 3EG6A 4Y7RA 4ZOXA 3N0EA 3C75H 1H2XA 2IURA 3KCIA 2VDQA 3IURA 4LG9A 3SWSD 5HE3B 5E6UA 3SBQA 3NIDA 3EMHA 3ZDXA 3ULEC 4FAVD 4ERYA 1ERJA 4ESGA 5AFU3 4IRZA 4LG8A 2H13A 4J86A 3C99A 2EICA 1XKSA 2VDOA 4Y5RD 1T2XA 4BP8A 4D6VA 2H6QA 4J87A 4ZN4A 3IKOA 3UVLA 4GGCA 1N6EA 2EBSA 3O4IA 4O1QD 2OK6A 5HE2B 1C9IA 2O9KA 4ERZA 5GXHA 4L9OA 3EI4B 4JSPC 1PBYB 5GMKn 5A2Qg 4BH6A 5EAMA 2HESX 4A2MA 3O4GA 2GNQA 3BG0A 4OWRA 2HKMA 3IIYA 4GMBA 5FLXg 2GC4A 2H14A 4JSVC 4CY3A 1L5GA 3KRWB 1VZ3A 5FKTA 5IGOA 1GOFA 1I2MB 2Z2PA 4RE6A 4XYHA 4BCCA 2AGYA 1NR0A 4CI8A 3SHFA 4O3TB 4QT8A 4MK0B 3UKRC 3V5WB 3ZDYA 3EU7A 1GG2B 4GQ2P 4X60B 1K3IA 3JZGA 2AH1A 1K32A 1OLZA 4AMYA 4G56B 4GM9A 3V4PA 3AL8B 2XL3A 1QNIA 1A12A 4ZOVA 2HXCA 5TEFA 3K71A 3EQ7A 4A0BB 3PVUB 2Z2NA 3U4YA 3I89A 3NVNA 5M5UA 2IUVA 2PM9B 3OKTA 1U8CA 4FB1D 5B4WA 2VDMA 5C2VB 4GQBB 5FKSA 2J57G 5IGQA 3AL8A 3PSLA 4A2LA 4KFMB 1N6FA 3CFSB 1JOFA 4QRJA 5TDHB 5CYKA 2VZ1A 2VDRA 4UI9R 4ERQA 4JXMA 2P9KC 3UVNA 5TEEA 3I8EA 1H2YA 3O4HA 3IUMA 3DXMC 2EIDA 5H14A 5IC7A 3V4VA 4CZVA 5EM2B 3IJCA 2I0RA 2IAAA 4AOWA 1GOGA 3I7KA 5AMSA 2OK4A 3UKUC 1XHMA 1H2WA 3V7DB 1GOHA 2YNOA 1U2VC 3EI2A 2J55H 4BUJC 4EWRA 5JWZA 3OF7A 4J8BA 1MDAH 4LGNA 2H47A 3RN1D 3VA6A 3SCYA 5FKRA 1JMXB 1P22A 1H2ZA 3MMYA 2MTAH 3T3PA 3CIKB 4G1MA 4E5ZB 3RFHA 3I7LA 3NIGA 1UOQA 4GGDA 4PXWA 3MZLA 4G55A 2IUPA 4A09B 4AMZA 3AL9A 5C86A 2H6NA 1YFQA 4GGAA 2VDKA 3F3GA 4J78A 1UTCA 3UVOA 3C5MA 2TRCB 4G1EA 5EALA 3QHYB 3F3FA 5C2WB 1K8KC 2GC7A 2AH0A 4XYIA 3EI1A 5FQDA 2AGXA 2CO0A 3K6SA 2CO0C 5IJ8E 3MUOA 1E8MA 4FAND 1XIPA 3EQ9A 5SXMA 2AQ5A 4E54A 3VI3A 4A11B 3SLED 4RE5A 3JZNA 2H9NA 3AH8B 3OKYB 4L1MA 3IJ1A 4N14A 3UR4A 4CZYA 3I2NA 2CN3A 4JSXC 3EWEA 3SBPA 2HJBA 3NIFA 3UVMA 1QFMA 1VZ2A 1GXRA 4NENA 1C9LA 4BCDA 1VE6A 5GXIA 3VI4A 2YMUA 3IULA 4ZOZA 3VH0A 4O02A 4X3EA 4QAMA 3OKWA 3DSMA 4A0AB 3OTTA 2CNXA 1L0QA 5GSAA 3E0CA 4Z7NA 2EIBA 1GOTB 4O3UB 3EI4A 3I8CA 3ORVD 3RLMD 3BWSA 3K72A 3IUQA 3L4OD 1O6GA 3ZE2A 4CY2A 5FKQA 3JB9L 3IVMA 5CXCB 3RSEC 3EI3B 2Q7QA 4J77A 4PC0A 5IJ7E 3SJLD 5EMJB 4H5JA 3SXTD 5HDBA 4TZ4A 4K3ID 2W18A 4J0XA 4AN0A 5HE1B 2BKLA 3UVKA 4WK0A 4CI1A 3MZKA 2XDWA 4BP9A 4DNWA 5K1CC 3IUNA 2CE9A 3T3MA 2Z2OA 3ZE0A 3JROA 1PI6A 2HJ4A 4FA5D 3GFCA 5HQGA 2BBKH 1M1XA 4GM8A 2PM7B 2PBIB 3GD1I 1Q47A 2H9LA 3I7HA 5I5JA 4D0KA 5H1MA 3IJ0A 3O4JA 4A0BA 2VDLA 4K3JB 4BL0A 2VZ3A 5CXBB 2PM9A 4O45A 2H68A 4WK4A 4UM9A 2VDNA 5EARA 5FFOA 5M61A 3JAMg 2UZYB 2AGLA 4X63B 4CY1A 2H9MA 1FWXA 4NC4A 2J56H 4XEIC 3J81g 5K19A 5CXBA 4CI3A 1E8NA 1MG2A 3MKSB 5AJAA 3SN6B 5EM2A 4AX4A 2JKXA 1SQ9A 4CI2A 1N6DA 3IIWA 2H6KA 4JT6C 4NAAA 4JHNA 5E6RA 2I3SA 3HFQA 4QL1A 3DWLC 3SVWD 1JMZB 4NSXA 2HU5A 4J8GA 2XE4A 3DM0A 4PSWB 3GC3B 3B7FA 5FXYA 4FA9D 1TYQC 4AN1A 3AFCA 4H5IA 5M5SA 5THAA 3QI0A 4PSXB 4E5ZA 4NBMA 4A09A 3L4MD 1JTDB 5E6SA 4FHLA 4Z7OA 3MKQA 2CN2A 2OJYA 3I7NA 2VC2A 4L1QD 5I5IA 2AGZA 3C9CA 4Z7QA 1YR2A 3J80g 5EMKB 4AEZA 1E5TA 2B4EA 4I79A 1JJUB 1TYEA 4JHPC 4R7AB 5EMLB 1PEVA 2XU7A 3RRMC 3OL2B 4J84A 2YB8B 4A11A 4FA4D 2B5LA 1S4UX 4PBYA 3W15A 2P9UC 1R5MA 3OKYA 4D9SA 5HE0B 4GZ8A 4J81A 4U7AA 1TBGA 4A08B 4IMMA 3FCSA 1U4CA 4A7JA 3PXWD 4ZOYA 2OVRB 2PM6B 3PSCB 3RFGA 5EMMB 4WK2A 1B9XA 2H3XA 3OL2A 3RN0D 3P4FA 3JZHA 3DXKC 2G9AA 4J0WA 4MMZA 1UOPA 1SQJA 3SBRA 2XL2A 4A0AA 3JPXA 2P9SC 4L3GD 5M5RA 4A08A 4WJKA 5IT9g 2IWFA 2QXVA 3A0FA 3PXSD 3JRPA 1VE7A 4OZUA 4HDJA 2B5MA 4O2WA 5H17A 4GQ1A 4UM8A 2I0SA 3I7PA 2OVPB 2I0TA 1SHYB 5CXCA 3EI3A
chains in the Genus database with same CATH topology
1A0RB 2G99A 2B5NA 3BG1A 4L3HD 3I7OA 3CFVA 5HYNB 1OMWB 1PGUA 3GREA 4IA9A 4PNKB 5CYKB 4U1EI 4JD2C 5EAPA 2YBAA 3K26A 2HKRA 2OIZA 2OVQB 4FA1D 3K27A 4JSNC 4O9DA 4QQEA 3FRXA 2UZXB 3SFZA 2BCJB 2QC5A 3ZWLB 2XYIA 3ODTA 5C9ZB 3EI2B 3OW8A 3MXXA 3F3PA 4J73A 5I5MA 4CC9A 2AGWA 4GM3A 4X61B 3PE7A 4PBZA 1B9YA 3SMRA 3VGZA 2YNNA 3PXTD 4J82A 2IUQA 2YNPA 3FM0A 1MG3A 2P9PC 1NEXB 4YVDA 2H9PA 5KDOB 4CZXA 3RMZD 3V9FA 2P9LC 3NVXA 5TF2A 2IWKA 2CE8A 2P9IC 5FA5B 1GP2B 1VYHC 3EI1B 2P9NC 4Z8LA 3PVWB 2HYEA 3N0DA 3NVQA 4ES0A 4FWWA 4CY5A 1RI6A 3FGBA 3KRXB 4E54B 4J79A 4JT5C 2I3TA 3EG6A 4Y7RA 4ZOXA 3N0EA 3C75H 2IURA 4LG9A 3SWSD 5HE3B 3SBQA 3EMHA 3ULEC 4FAVD 4ERYA 1ERJA 4ESGA 5AFU3 4LG8A 2H13A 4J86A 3C99A 1XKSA 4Y5RD 4D6VA 2H6QA 4J87A 4ZN4A 3IKOA 3UVLA 4GGCA 1N6EA 2EBSA 4O1QD 2OK6A 5HE2B 2O9KA 5GXHA 4ERZA 4L9OA 3EI4B 4JSPC 1PBYB 5GMKn 5A2Qg 4BH6A 5EAMA 2HESX 4A2MA 2GNQA 4OWRA 3BG0A 2HKMA 3IIYA 4GMBA 5FLXg 2GC4A 2H14A 4JSVC 4CY3A 3KRWB 5FKTA 5IGOA 2Z2PA 4XYHA 2AGYA 1NR0A 4CI8A 3SHFA 4O3TB 4QT8A 4MK0B 3UKRC 3V5WB 3EU7A 1GG2B 4GQ2P 4X60B 3JZGA 2AH1A 1K32A 1OLZA 4G56B 4GM9A 3AL8B 2XL3A 1QNIA 4ZOVA 2HXCA 5TEFA 4A0BB 3PVUB 2Z2NA 3U4YA 3I89A 3NVNA 2IUVA 2PM9B 3OKTA 4FB1D 5B4WA 5C2VB 4GQBB 5FKSA 2J57G 5IGQA 3AL8A 3PSLA 4A2LA 4KFMB 1N6FA 3CFSB 1JOFA 4QRJA 5TDHB 5CYKA 4UI9R 4ERQA 4JXMA 2P9KC 3UVNA 5TEEA 3I8EA 3DXMC 5H14A 5IC7A 4CZVA 5EM2B 3IJCA 2I0RA 2IAAA 4AOWA 5AMSA 3I7KA 2OK4A 3UKUC 1XHMA 3V7DB 2YNOA 1U2VC 3EI2A 2J55H 4BUJC 4EWRA 5JWZA 4J8BA 1MDAH 4LGNA 2H47A 3RN1D 3VA6A 3SCYA 5FKRA 1JMXB 1P22A 3MMYA 2MTAH 3CIKB 4E5ZB 3RFHA 3I7LA 4GGDA 4PXWA 3MZLA 2IUPA 4A09B 3AL9A 2H6NA 1YFQA 4GGAA 3F3GA 4J78A 3UVOA 3C5MA 2TRCB 5EALA 3F3FA 5C2WB 1K8KC 2GC7A 2AH0A 4XYIA 3EI1A 5FQDA 2AGXA 2CO0A 2CO0C 5IJ8E 4FAND 1XIPA 5SXMA 2AQ5A 4E54A 4A11B 3SLED 3JZNA 2H9NA 3AH8B 3OKYB 3IJ1A 4N14A 3UR4A 4CZYA 3I2NA 2CN3A 4JSXC 3EWEA 3SBPA 2HJBA 3UVMA 1GXRA 5GXIA 2YMUA 4ZOZA 3VH0A 4X3EA 3OKWA 3DSMA 4A0AB 3OTTA 2CNXA 1L0QA 5GSAA 3E0CA 1GOTB 4O3UB 3EI4A 3I8CA 3ORVD 3RLMD 3BWSA 3L4OD 4CY2A 5FKQA 3JB9L 5CXCB 3RSEC 3EI3B 2Q7QA 4J77A 4PC0A 5IJ7E 3SJLD 5EMJB 4H5JA 3SXTD 4TZ4A 4K3ID 2W18A 4J0XA 5HE1B 3UVKA 4CI1A 3MZKA 5K1CC 2CE9A 2Z2OA 3JROA 1PI6A 2HJ4A 4FA5D 3GFCA 5HQGA 2BBKH 4GM8A 2PM7B 2PBIB 3I7HA 1Q47A 2H9LA 5I5JA 4D0KA 5H1MA 3IJ0A 4A0BA 4K3JB 4BL0A 5CXBB 2PM9A 4O45A 2H68A 5EARA 3JAMg 2UZYB 2AGLA 4X63B 4CY1A 2H9MA 1FWXA 2J56H 4XEIC 3J81g 5K19A 5CXBA 4CI3A 3SN6B 1MG2A 3MKSB 5AJAA 5EM2A 1SQ9A 4CI2A 1N6DA 3IIWA 2H6KA 4JT6C 2I3SA 3HFQA 4QL1A 3DWLC 3SVWD 1JMZB 4NSXA 4J8GA 3DM0A 4PSWB 3B7FA 5FXYA 4FA9D 1TYQC 3AFCA 4H5IA 5THAA 4PSXB 4E5ZA 4A09A 3L4MD 4FHLA 3MKQA 2CN2A 2OJYA 3I7NA 4L1QD 5I5IA 2AGZA 3C9CA 3J80g 5EMKB 4AEZA 2B4EA 4I79A 1JJUB 4R7AB 5EMLB 1PEVA 2XU7A 3RRMC 3OL2B 4J84A 2YB8B 4A11A 4FA4D 2B5LA 1S4UX 4PBYA 3W15A 2P9UC 1R5MA 3OKYA 5HE0B 4GZ8A 4J81A 4U7AA 1TBGA 4A08B 4IMMA 1U4CA 4A7JA 3PXWD 4ZOYA 2OVRB 2PM6B 3PSCB 3RFGA 5EMMB 1B9XA 2H3XA 3OL2A 3RN0D 3P4FA 3JZHA 3DXKC 2G9AA 4J0WA 1SQJA 3SBRA 2XL2A 4A0AA 3JPXA 2P9SC 4L3GD 4A08A 5IT9g 2IWFA 2QXVA 3A0FA 3PXSD 3JRPA 4OZUA 4HDJA 2B5MA 5H17A 4GQ1A 2I0SA 3I7PA 2OVPB 2I0TA 1SHYB 5CXCA 3EI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0R B;  2G99 A;  2B5N A;  3BG1 A;  4L3H D;  3I7O A;  3CFV A;  5HYN B;  1OMW B;  1PGU A;  3GRE A;  4IA9 A;  4PNK B;  5CYK B;  4U1E I;  4JD2 C;  5EAP A;  2YBA A;  3K26 A;  2HKR A;  2OIZ A;  2OVQ B;  4FA1 D;  3K27 A;  4JSN C;  4O9D A;  4QQE A;  3FRX A;  2UZX B;  3SFZ A;  2BCJ B;  2QC5 A;  3ZWL B;  2XYI A;  3ODT A;  5C9Z B;  3EI2 B;  3OW8 A;  3MXX A;  3F3P A;  4J73 A;  5I5M A;  4CC9 A;  2AGW A;  4GM3 A;  4X61 B;  3PE7 A;  4PBZ A;  1B9Y A;  3SMR A;  3VGZ A;  2YNN A;  3PXT D;  4J82 A;  2IUQ A;  2YNP A;  3FM0 A;  1MG3 A;  2P9P C;  1NEX B;  4YVD A;  2H9P A;  5KDO B;  4CZX A;  3RMZ D;  3V9F A;  2P9L C;  3NVX A;  5TF2 A;  2IWK A;  2CE8 A;  2P9I C;  5FA5 B;  1GP2 B;  1VYH C;  3EI1 B;  2P9N C;  4Z8L A;  3PVW B;  2HYE A;  3N0D A;  3NVQ A;  4ES0 A;  4FWW A;  4CY5 A;  1RI6 A;  3FGB A;  3KRX B;  4E54 B;  4J79 A;  4JT5 C;  2I3T A;  3EG6 A;  4Y7R A;  4ZOX A;  3N0E A;  3C75 H;  2IUR A;  4LG9 A;  3SWS D;  5HE3 B;  3SBQ A;  3EMH A;  3ULE C;  4FAV D;  4ERY A;  1ERJ A;  4ESG A;  5AFU 3;  4LG8 A;  2H13 A;  4J86 A;  3C99 A;  1XKS A;  4Y5R D;  4D6V A;  2H6Q A;  4J87 A;  4ZN4 A;  3IKO A;  3UVL A;  4GGC A;  1N6E A;  2EBS A;  4O1Q D;  2OK6 A;  5HE2 B;  2O9K A;  5GXH A;  4ERZ A;  4L9O A;  3EI4 B;  4JSP C;  1PBY B;  5GMK n;  5A2Q g;  4BH6 A;  5EAM A;  2HES X;  4A2M A;  2GNQ A;  4OWR A;  3BG0 A;  2HKM A;  3IIY A;  4GMB A;  5FLX g;  2GC4 A;  2H14 A;  4JSV C;  4CY3 A;  3KRW B;  5FKT A;  5IGO A;  2Z2P A;  4XYH A;  2AGY A;  1NR0 A;  4CI8 A;  3SHF A;  4O3T B;  4QT8 A;  4MK0 B;  3UKR C;  3V5W B;  3EU7 A;  1GG2 B;  4GQ2 P;  4X60 B;  3JZG A;  2AH1 A;  1K32 A;  1OLZ A;  4G56 B;  4GM9 A;  3AL8 B;  2XL3 A;  1QNI A;  4ZOV A;  2HXC A;  5TEF A;  4A0B B;  3PVU B;  2Z2N A;  3U4Y A;  3I89 A;  3NVN A;  2IUV A;  2PM9 B;  3OKT A;  4FB1 D;  5B4W A;  5C2V B;  4GQB B;  5FKS A;  2J57 G;  5IGQ A;  3AL8 A;  3PSL A;  4A2L A;  4KFM B;  1N6F A;  3CFS B;  1JOF A;  4QRJ A;  5TDH B;  5CYK A;  4UI9 R;  4ERQ A;  4JXM A;  2P9K C;  3UVN A;  5TEE A;  3I8E A;  3DXM C;  5H14 A;  5IC7 A;  4CZV A;  5EM2 B;  3IJC A;  2I0R A;  2IAA A;  4AOW A;  5AMS A;  3I7K A;  2OK4 A;  3UKU C;  1XHM A;  3V7D B;  2YNO A;  1U2V C;  3EI2 A;  2J55 H;  4BUJ C;  4EWR A;  5JWZ A;  4J8B A;  1MDA H;  4LGN A;  2H47 A;  3RN1 D;  3VA6 A;  3SCY A;  5FKR A;  1JMX B;  1P22 A;  3MMY A;  2MTA H;  3CIK B;  4E5Z B;  3RFH A;  3I7L A;  4GGD A;  4PXW A;  3MZL A;  2IUP A;  4A09 B;  3AL9 A;  2H6N A;  1YFQ A;  4GGA A;  3F3G A;  4J78 A;  3UVO A;  3C5M A;  2TRC B;  5EAL A;  3F3F A;  5C2W B;  1K8K C;  2GC7 A;  2AH0 A;  4XYI A;  3EI1 A;  5FQD A;  2AGX A;  2CO0 A;  2CO0 C;  5IJ8 E;  4FAN D;  1XIP A;  5SXM A;  2AQ5 A;  4E54 A;  4A11 B;  3SLE D;  3JZN A;  2H9N A;  3AH8 B;  3OKY B;  3IJ1 A;  4N14 A;  3UR4 A;  4CZY A;  3I2N A;  2CN3 A;  4JSX C;  3EWE A;  3SBP A;  2HJB A;  3UVM A;  1GXR A;  5GXI A;  2YMU A;  4ZOZ A;  3VH0 A;  4X3E A;  3OKW A;  3DSM A;  4A0A B;  3OTT A;  2CNX A;  1L0Q A;  5GSA A;  3E0C A;  1GOT B;  4O3U B;  3EI4 A;  3I8C A;  3ORV D;  3RLM D;  3BWS A;  3L4O D;  4CY2 A;  5FKQ A;  3JB9 L;  5CXC B;  3RSE C;  3EI3 B;  2Q7Q A;  4J77 A;  4PC0 A;  5IJ7 E;  3SJL D;  5EMJ B;  4H5J A;  3SXT D;  4TZ4 A;  4K3I D;  2W18 A;  4J0X A;  5HE1 B;  3UVK A;  4CI1 A;  3MZK A;  5K1C C;  2CE9 A;  2Z2O A;  3JRO A;  1PI6 A;  2HJ4 A;  4FA5 D;  3GFC A;  5HQG A;  2BBK H;  4GM8 A;  2PM7 B;  2PBI B;  3I7H A;  1Q47 A;  2H9L A;  5I5J A;  4D0K A;  5H1M A;  3IJ0 A;  4A0B A;  4K3J B;  4BL0 A;  5CXB B;  2PM9 A;  4O45 A;  2H68 A;  5EAR A;  3JAM g;  2UZY B;  2AGL A;  4X63 B;  4CY1 A;  2H9M A;  1FWX A;  2J56 H;  4XEI C;  3J81 g;  5K19 A;  5CXB A;  4CI3 A;  3SN6 B;  1MG2 A;  3MKS B;  5AJA A;  5EM2 A;  1SQ9 A;  4CI2 A;  1N6D A;  3IIW A;  2H6K A;  4JT6 C;  2I3S A;  3HFQ A;  4QL1 A;  3DWL C;  3SVW D;  1JMZ B;  4NSX A;  4J8G A;  3DM0 A;  4PSW B;  3B7F A;  5FXY A;  4FA9 D;  1TYQ C;  3AFC A;  4H5I A;  5THA A;  4PSX B;  4E5Z A;  4A09 A;  3L4M D;  4FHL A;  3MKQ A;  2CN2 A;  2OJY A;  3I7N A;  4L1Q D;  5I5I A;  2AGZ A;  3C9C A;  3J80 g;  5EMK B;  4AEZ A;  2B4E A;  4I79 A;  1JJU B;  4R7A B;  5EML B;  1PEV A;  2XU7 A;  3RRM C;  3OL2 B;  4J84 A;  2YB8 B;  4A11 A;  4FA4 D;  2B5L A;  1S4U X;  4PBY A;  3W15 A;  2P9U C;  1R5M A;  3OKY A;  5HE0 B;  4GZ8 A;  4J81 A;  4U7A A;  1TBG A;  4A08 B;  4IMM A;  1U4C A;  4A7J A;  3PXW D;  4ZOY A;  2OVR B;  2PM6 B;  3PSC B;  3RFG A;  5EMM B;  1B9X A;  2H3X A;  3OL2 A;  3RN0 D;  3P4F A;  3JZH A;  3DXK C;  2G9A A;  4J0W A;  1SQJ A;  3SBR A;  2XL2 A;  4A0A A;  3JPX A;  2P9S C;  4L3G D;  4A08 A;  5IT9 g;  2IWF A;  2QXV A;  3A0F A;  3PXS D;  3JRP A;  4OZU A;  4HDJ A;  2B5M A;  5H17 A;  4GQ1 A;  2I0S A;  3I7P A;  2OVP B;  2I0T A;  1SHY B;  5CXC A;  3EI3 A; 
#chains in the Genus database with same CATH topology
 1A0R B;  2XZG A;  2G99 A;  2B5N A;  5M5V A;  3BG1 A;  4DNU A;  4L3H D;  3I7O A;  3CFV A;  5HYN B;  1OMW B;  2QR5 A;  1PGU A;  3GRE A;  4IA9 A;  4PNK B;  5CYK B;  4MMX A;  4U1E I;  4JD2 C;  3DDU A;  5EAP A;  2YBA A;  3K26 A;  2HKR A;  2OIZ A;  2OVQ B;  4MMY A;  4FA1 D;  3K27 A;  4JSN C;  1JV2 A;  4O9D A;  2QZP A;  4QQE A;  3FRX A;  2UZX B;  3SFZ A;  2BCJ B;  2QC5 A;  3ZWL B;  2XYI A;  2HU7 A;  3FCU A;  3ODT A;  5C9Z B;  3EI2 B;  3OW8 A;  3MXX A;  3EQ8 A;  3IJE A;  3F3P A;  2HU8 A;  4J73 A;  3ZE1 A;  5I5M A;  4CC9 A;  2AGW A;  4GM3 A;  4X61 B;  3PE7 A;  4PBZ A;  1B9Y A;  3SMR A;  2EIE A;  3VGZ A;  4BCB A;  2YNN A;  3PXT D;  4J82 A;  2WQ8 A;  3MVD K;  3MUN A;  2IUQ A;  2YNP A;  3FM0 A;  1MG3 A;  5C92 A;  1UOO A;  2VDP A;  2P9P C;  1O6F A;  1NEX B;  4YVD A;  2H9P A;  5KDO B;  4CZX A;  3RMZ D;  1BPO A;  3V9F A;  2P9L C;  5M5T A;  3IUJ A;  3NVX A;  5TF2 A;  2IWK A;  2CE8 A;  2P9I C;  3ZDZ A;  1QFS A;  5FA5 B;  1GP2 B;  1VYH C;  3EI1 B;  2P9N C;  4Z8L A;  3PVW B;  5FFG A;  2HYE A;  3N0D A;  3NVQ A;  4ES0 A;  4FWW A;  4CY5 A;  1RI6 A;  4DNV A;  3FGB A;  3KRX B;  4E54 B;  4J79 A;  4JT5 C;  2I3T A;  3EG6 A;  4Y7R A;  4ZOX A;  3N0E A;  3C75 H;  1H2X A;  2IUR A;  3KCI A;  2VDQ A;  3IUR A;  4LG9 A;  3SWS D;  5HE3 B;  5E6U A;  3SBQ A;  3NID A;  3EMH A;  3ZDX A;  3ULE C;  4FAV D;  4ERY A;  1ERJ A;  4ESG A;  5AFU 3;  4IRZ A;  4LG8 A;  2H13 A;  4J86 A;  3C99 A;  2EIC A;  1XKS A;  2VDO A;  4Y5R D;  1T2X A;  4BP8 A;  4D6V A;  2H6Q A;  4J87 A;  4ZN4 A;  3IKO A;  3UVL A;  4GGC A;  1N6E A;  2EBS A;  3O4I A;  4O1Q D;  2OK6 A;  5HE2 B;  1C9I A;  2O9K A;  4ERZ A;  5GXH A;  4L9O A;  3EI4 B;  4JSP C;  1PBY B;  5GMK n;  5A2Q g;  4BH6 A;  5EAM A;  2HES X;  4A2M A;  3O4G A;  2GNQ A;  3BG0 A;  4OWR A;  2HKM A;  3IIY A;  4GMB A;  5FLX g;  2GC4 A;  2H14 A;  4JSV C;  4CY3 A;  1L5G A;  3KRW B;  1VZ3 A;  5FKT A;  5IGO A;  1GOF A;  1I2M B;  2Z2P A;  4RE6 A;  4XYH A;  4BCC A;  2AGY A;  1NR0 A;  4CI8 A;  3SHF A;  4O3T B;  4QT8 A;  4MK0 B;  3UKR C;  3V5W B;  3ZDY A;  3EU7 A;  1GG2 B;  4GQ2 P;  4X60 B;  1K3I A;  3JZG A;  2AH1 A;  1K32 A;  1OLZ A;  4AMY A;  4G56 B;  4GM9 A;  3V4P A;  3AL8 B;  2XL3 A;  1QNI A;  1A12 A;  4ZOV A;  2HXC A;  5TEF A;  3K71 A;  3EQ7 A;  4A0B B;  3PVU B;  2Z2N A;  3U4Y A;  3I89 A;  3NVN A;  5M5U A;  2IUV A;  2PM9 B;  3OKT A;  1U8C A;  4FB1 D;  5B4W A;  2VDM A;  5C2V B;  4GQB B;  5FKS A;  2J57 G;  5IGQ A;  3AL8 A;  3PSL A;  4A2L A;  4KFM B;  1N6F A;  3CFS B;  1JOF A;  4QRJ A;  5TDH B;  5CYK A;  2VZ1 A;  2VDR A;  4UI9 R;  4ERQ A;  4JXM A;  2P9K C;  3UVN A;  5TEE A;  3I8E A;  1H2Y A;  3O4H A;  3IUM A;  3DXM C;  2EID A;  5H14 A;  5IC7 A;  3V4V A;  4CZV A;  5EM2 B;  3IJC A;  2I0R A;  2IAA A;  4AOW A;  1GOG A;  3I7K A;  5AMS A;  2OK4 A;  3UKU C;  1XHM A;  1H2W A;  3V7D B;  1GOH A;  2YNO A;  1U2V C;  3EI2 A;  2J55 H;  4BUJ C;  4EWR A;  5JWZ A;  3OF7 A;  4J8B A;  1MDA H;  4LGN A;  2H47 A;  3RN1 D;  3VA6 A;  3SCY A;  5FKR A;  1JMX B;  1P22 A;  1H2Z A;  3MMY A;  2MTA H;  3T3P A;  3CIK B;  4G1M A;  4E5Z B;  3RFH A;  3I7L A;  3NIG A;  1UOQ A;  4GGD A;  4PXW A;  3MZL A;  4G55 A;  2IUP A;  4A09 B;  4AMZ A;  3AL9 A;  5C86 A;  2H6N A;  1YFQ A;  4GGA A;  2VDK A;  3F3G A;  4J78 A;  1UTC A;  3UVO A;  3C5M A;  2TRC B;  4G1E A;  5EAL A;  3QHY B;  3F3F A;  5C2W B;  1K8K C;  2GC7 A;  2AH0 A;  4XYI A;  3EI1 A;  5FQD A;  2AGX A;  2CO0 A;  3K6S A;  2CO0 C;  5IJ8 E;  3MUO A;  1E8M A;  4FAN D;  1XIP A;  3EQ9 A;  5SXM A;  2AQ5 A;  4E54 A;  3VI3 A;  4A11 B;  3SLE D;  4RE5 A;  3JZN A;  2H9N A;  3AH8 B;  3OKY B;  4L1M A;  3IJ1 A;  4N14 A;  3UR4 A;  4CZY A;  3I2N A;  2CN3 A;  4JSX C;  3EWE A;  3SBP A;  2HJB A;  3NIF A;  3UVM A;  1QFM A;  1VZ2 A;  1GXR A;  4NEN A;  1C9L A;  4BCD A;  1VE6 A;  5GXI A;  3VI4 A;  2YMU A;  3IUL A;  4ZOZ A;  3VH0 A;  4O02 A;  4X3E A;  4QAM A;  3OKW A;  3DSM A;  4A0A B;  3OTT A;  2CNX A;  1L0Q A;  5GSA A;  3E0C A;  4Z7N A;  2EIB A;  1GOT B;  4O3U B;  3EI4 A;  3I8C A;  3ORV D;  3RLM D;  3BWS A;  3K72 A;  3IUQ A;  3L4O D;  1O6G A;  3ZE2 A;  4CY2 A;  5FKQ A;  3JB9 L;  3IVM A;  5CXC B;  3RSE C;  3EI3 B;  2Q7Q A;  4J77 A;  4PC0 A;  5IJ7 E;  3SJL D;  5EMJ B;  4H5J A;  3SXT D;  5HDB A;  4TZ4 A;  4K3I D;  2W18 A;  4J0X A;  4AN0 A;  5HE1 B;  2BKL A;  3UVK A;  4WK0 A;  4CI1 A;  3MZK A;  2XDW A;  4BP9 A;  4DNW A;  5K1C C;  3IUN A;  2CE9 A;  3T3M A;  2Z2O A;  3ZE0 A;  3JRO A;  1PI6 A;  2HJ4 A;  4FA5 D;  3GFC A;  5HQG A;  2BBK H;  1M1X A;  4GM8 A;  2PM7 B;  2PBI B;  3GD1 I;  1Q47 A;  2H9L A;  3I7H A;  5I5J A;  4D0K A;  5H1M A;  3IJ0 A;  3O4J A;  4A0B A;  2VDL A;  4K3J B;  4BL0 A;  2VZ3 A;  5CXB B;  2PM9 A;  4O45 A;  2H68 A;  4WK4 A;  4UM9 A;  2VDN A;  5EAR A;  5FFO A;  5M61 A;  3JAM g;  2UZY B;  2AGL A;  4X63 B;  4CY1 A;  2H9M A;  1FWX A;  4NC4 A;  2J56 H;  4XEI C;  3J81 g;  5K19 A;  5CXB A;  4CI3 A;  1E8N A;  1MG2 A;  3MKS B;  5AJA A;  3SN6 B;  5EM2 A;  4AX4 A;  2JKX A;  1SQ9 A;  4CI2 A;  1N6D A;  3IIW A;  2H6K A;  4JT6 C;  4NAA A;  4JHN A;  5E6R A;  2I3S A;  3HFQ A;  4QL1 A;  3DWL C;  3SVW D;  1JMZ B;  4NSX A;  2HU5 A;  4J8G A;  2XE4 A;  3DM0 A;  4PSW B;  3GC3 B;  3B7F A;  5FXY A;  4FA9 D;  1TYQ C;  4AN1 A;  3AFC A;  4H5I A;  5M5S A;  5THA A;  3QI0 A;  4PSX B;  4E5Z A;  4NBM A;  4A09 A;  3L4M D;  1JTD B;  5E6S A;  4FHL A;  4Z7O A;  3MKQ A;  2CN2 A;  2OJY A;  3I7N A;  2VC2 A;  4L1Q D;  5I5I A;  2AGZ A;  3C9C A;  4Z7Q A;  1YR2 A;  3J80 g;  5EMK B;  4AEZ A;  1E5T A;  2B4E A;  4I79 A;  1JJU B;  1TYE A;  4JHP C;  4R7A B;  5EML B;  1PEV A;  2XU7 A;  3RRM C;  3OL2 B;  4J84 A;  2YB8 B;  4A11 A;  4FA4 D;  2B5L A;  1S4U X;  4PBY A;  3W15 A;  2P9U C;  1R5M A;  3OKY A;  4D9S A;  5HE0 B;  4GZ8 A;  4J81 A;  4U7A A;  1TBG A;  4A08 B;  4IMM A;  3FCS A;  1U4C A;  4A7J A;  3PXW D;  4ZOY A;  2OVR B;  2PM6 B;  3PSC B;  3RFG A;  5EMM B;  4WK2 A;  1B9X A;  2H3X A;  3OL2 A;  3RN0 D;  3P4F A;  3JZH A;  3DXK C;  2G9A A;  4J0W A;  4MMZ A;  1UOP A;  1SQJ A;  3SBR A;  2XL2 A;  4A0A A;  3JPX A;  2P9S C;  4L3G D;  5M5R A;  4A08 A;  4WJK A;  5IT9 g;  2IWF A;  2QXV A;  3A0F A;  3PXS D;  3JRP A;  1VE7 A;  4OZU A;  4HDJ A;  2B5M A;  4O2W A;  5H17 A;  4GQ1 A;  4UM8 A;  2I0S A;  3I7P A;  2OVP B;  2I0T A;  1SHY B;  5CXC A;  3EI3 A; 
#chains in the Genus database with same CATH homology
 1A0R B;  2G99 A;  2B5N A;  3BG1 A;  4L3H D;  3I7O A;  3CFV A;  5HYN B;  1OMW B;  1PGU A;  3GRE A;  4IA9 A;  4PNK B;  5CYK B;  4U1E I;  4JD2 C;  5EAP A;  2YBA A;  3K26 A;  2HKR A;  2OIZ A;  2OVQ B;  4FA1 D;  3K27 A;  4JSN C;  4O9D A;  4QQE A;  3FRX A;  2UZX B;  3SFZ A;  2BCJ B;  2QC5 A;  3ZWL B;  2XYI A;  3ODT A;  5C9Z B;  3EI2 B;  3OW8 A;  3MXX A;  3F3P A;  4J73 A;  5I5M A;  4CC9 A;  2AGW A;  4GM3 A;  4X61 B;  3PE7 A;  4PBZ A;  1B9Y A;  3SMR A;  3VGZ A;  2YNN A;  3PXT D;  4J82 A;  2IUQ A;  2YNP A;  3FM0 A;  1MG3 A;  2P9P C;  1NEX B;  4YVD A;  2H9P A;  5KDO B;  4CZX A;  3RMZ D;  3V9F A;  2P9L C;  3NVX A;  5TF2 A;  2IWK A;  2CE8 A;  2P9I C;  5FA5 B;  1GP2 B;  1VYH C;  3EI1 B;  2P9N C;  4Z8L A;  3PVW B;  2HYE A;  3N0D A;  3NVQ A;  4ES0 A;  4FWW A;  4CY5 A;  1RI6 A;  3FGB A;  3KRX B;  4E54 B;  4J79 A;  4JT5 C;  2I3T A;  3EG6 A;  4Y7R A;  4ZOX A;  3N0E A;  3C75 H;  2IUR A;  4LG9 A;  3SWS D;  5HE3 B;  3SBQ A;  3EMH A;  3ULE C;  4FAV D;  4ERY A;  1ERJ A;  4ESG A;  5AFU 3;  4LG8 A;  2H13 A;  4J86 A;  3C99 A;  1XKS A;  4Y5R D;  4D6V A;  2H6Q A;  4J87 A;  4ZN4 A;  3IKO A;  3UVL A;  4GGC A;  1N6E A;  2EBS A;  4O1Q D;  2OK6 A;  5HE2 B;  2O9K A;  5GXH A;  4ERZ A;  4L9O A;  3EI4 B;  4JSP C;  1PBY B;  5GMK n;  5A2Q g;  4BH6 A;  5EAM A;  2HES X;  4A2M A;  2GNQ A;  4OWR A;  3BG0 A;  2HKM A;  3IIY A;  4GMB A;  5FLX g;  2GC4 A;  2H14 A;  4JSV C;  4CY3 A;  3KRW B;  5FKT A;  5IGO A;  2Z2P A;  4XYH A;  2AGY A;  1NR0 A;  4CI8 A;  3SHF A;  4O3T B;  4QT8 A;  4MK0 B;  3UKR C;  3V5W B;  3EU7 A;  1GG2 B;  4GQ2 P;  4X60 B;  3JZG A;  2AH1 A;  1K32 A;  1OLZ A;  4G56 B;  4GM9 A;  3AL8 B;  2XL3 A;  1QNI A;  4ZOV A;  2HXC A;  5TEF A;  4A0B B;  3PVU B;  2Z2N A;  3U4Y A;  3I89 A;  3NVN A;  2IUV A;  2PM9 B;  3OKT A;  4FB1 D;  5B4W A;  5C2V B;  4GQB B;  5FKS A;  2J57 G;  5IGQ A;  3AL8 A;  3PSL A;  4A2L A;  4KFM B;  1N6F A;  3CFS B;  1JOF A;  4QRJ A;  5TDH B;  5CYK A;  4UI9 R;  4ERQ A;  4JXM A;  2P9K C;  3UVN A;  5TEE A;  3I8E A;  3DXM C;  5H14 A;  5IC7 A;  4CZV A;  5EM2 B;  3IJC A;  2I0R A;  2IAA A;  4AOW A;  5AMS A;  3I7K A;  2OK4 A;  3UKU C;  1XHM A;  3V7D B;  2YNO A;  1U2V C;  3EI2 A;  2J55 H;  4BUJ C;  4EWR A;  5JWZ A;  4J8B A;  1MDA H;  4LGN A;  2H47 A;  3RN1 D;  3VA6 A;  3SCY A;  5FKR A;  1JMX B;  1P22 A;  3MMY A;  2MTA H;  3CIK B;  4E5Z B;  3RFH A;  3I7L A;  4GGD A;  4PXW A;  3MZL A;  2IUP A;  4A09 B;  3AL9 A;  2H6N A;  1YFQ A;  4GGA A;  3F3G A;  4J78 A;  3UVO A;  3C5M A;  2TRC B;  5EAL A;  3F3F A;  5C2W B;  1K8K C;  2GC7 A;  2AH0 A;  4XYI A;  3EI1 A;  5FQD A;  2AGX A;  2CO0 A;  2CO0 C;  5IJ8 E;  4FAN D;  1XIP A;  5SXM A;  2AQ5 A;  4E54 A;  4A11 B;  3SLE D;  3JZN A;  2H9N A;  3AH8 B;  3OKY B;  3IJ1 A;  4N14 A;  3UR4 A;  4CZY A;  3I2N A;  2CN3 A;  4JSX C;  3EWE A;  3SBP A;  2HJB A;  3UVM A;  1GXR A;  5GXI A;  2YMU A;  4ZOZ A;  3VH0 A;  4X3E A;  3OKW A;  3DSM A;  4A0A B;  3OTT A;  2CNX A;  1L0Q A;  5GSA A;  3E0C A;  1GOT B;  4O3U B;  3EI4 A;  3I8C A;  3ORV D;  3RLM D;  3BWS A;  3L4O D;  4CY2 A;  5FKQ A;  3JB9 L;  5CXC B;  3RSE C;  3EI3 B;  2Q7Q A;  4J77 A;  4PC0 A;  5IJ7 E;  3SJL D;  5EMJ B;  4H5J A;  3SXT D;  4TZ4 A;  4K3I D;  2W18 A;  4J0X A;  5HE1 B;  3UVK A;  4CI1 A;  3MZK A;  5K1C C;  2CE9 A;  2Z2O A;  3JRO A;  1PI6 A;  2HJ4 A;  4FA5 D;  3GFC A;  5HQG A;  2BBK H;  4GM8 A;  2PM7 B;  2PBI B;  3I7H A;  1Q47 A;  2H9L A;  5I5J A;  4D0K A;  5H1M A;  3IJ0 A;  4A0B A;  4K3J B;  4BL0 A;  5CXB B;  2PM9 A;  4O45 A;  2H68 A;  5EAR A;  3JAM g;  2UZY B;  2AGL A;  4X63 B;  4CY1 A;  2H9M A;  1FWX A;  2J56 H;  4XEI C;  3J81 g;  5K19 A;  5CXB A;  4CI3 A;  3SN6 B;  1MG2 A;  3MKS B;  5AJA A;  5EM2 A;  1SQ9 A;  4CI2 A;  1N6D A;  3IIW A;  2H6K A;  4JT6 C;  2I3S A;  3HFQ A;  4QL1 A;  3DWL C;  3SVW D;  1JMZ B;  4NSX A;  4J8G A;  3DM0 A;  4PSW B;  3B7F A;  5FXY A;  4FA9 D;  1TYQ C;  3AFC A;  4H5I A;  5THA A;  4PSX B;  4E5Z A;  4A09 A;  3L4M D;  4FHL A;  3MKQ A;  2CN2 A;  2OJY A;  3I7N A;  4L1Q D;  5I5I A;  2AGZ A;  3C9C A;  3J80 g;  5EMK B;  4AEZ A;  2B4E A;  4I79 A;  1JJU B;  4R7A B;  5EML B;  1PEV A;  2XU7 A;  3RRM C;  3OL2 B;  4J84 A;  2YB8 B;  4A11 A;  4FA4 D;  2B5L A;  1S4U X;  4PBY A;  3W15 A;  2P9U C;  1R5M A;  3OKY A;  5HE0 B;  4GZ8 A;  4J81 A;  4U7A A;  1TBG A;  4A08 B;  4IMM A;  1U4C A;  4A7J A;  3PXW D;  4ZOY A;  2OVR B;  2PM6 B;  3PSC B;  3RFG A;  5EMM B;  1B9X A;  2H3X A;  3OL2 A;  3RN0 D;  3P4F A;  3JZH A;  3DXK C;  2G9A A;  4J0W A;  1SQJ A;  3SBR A;  2XL2 A;  4A0A A;  3JPX A;  2P9S C;  4L3G D;  4A08 A;  5IT9 g;  2IWF A;  2QXV A;  3A0F A;  3PXS D;  3JRP A;  4OZU A;  4HDJ A;  2B5M A;  5H17 A;  4GQ1 A;  2I0S A;  3I7P A;  2OVP B;  2I0T A;  1SHY B;  5CXC A;  3EI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...