3SJLD

Crystal structure of the p107s-maug/pre-methylamine dehydrogenase complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein mauG
total genus 95
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sjlD00
3OKWA 1OLZA 2AH0A 3IJCA 2H6QA 2O9KA 4U7AA 3UR4A 4E54B 5CXCB 3AH8B 4HDJA 2AGYA 4J8GA 4A0AB 4JT5C 2P9LC 3SWSD 5HYNB 4JD2C 3FGBA 4J77A 2CO0A 4FA9D 1K8KC 5CXCA 5EAMA 3UVKA 2P9IC 5IC7A 4QT8A 4A0BA 4GZ8A 3SFZA 3RN0D 2PM9A 2EBSA 2IURA 4A0AA 1P22A 1B9XA 5I5MA 4ZOYA 5AFU3 4FWWA 4J84A 3GFCA 2P9UC 2BBKH 4ZOXA 2Q7QA 1XKSA 2J55H 3MKQA 3SBQA 5JWZA 5FKRA 2OVQB 4J0XA 2IUQA 3PXSD 3PXWD 3JZNA 5FLXg 3I7PA 4CZYA 1S4UX 3AFCA 5AJAA 3I2NA 4CI1A 1XHMA 2CO0C 4JXMA 3KRXB 2HKMA 5CYKB 5EMMB 4XEIC 5FXYA 3UVLA 3EMHA 3ULEC 3F3GA 3EI3B 2GC7A 1SQJA 3I8CA 2TRCB 3W15A 3IIYA 4A7JA 4LG9A 5KDOB 4KFMB 2AGZA 3OKTA 4N14A 1MG3A 4BL0A 4PC0A 4A08B 3OKYA 3EI1A 5HE2B 1FWXA 4PNKB 3UVOA 3CFVA 4JSPC 3JZHA 4XYHA 5IGQA 5K19A 5FKQA 3I8EA 4QL1A 2J56H 1JOFA 3AL8B 4D6VA 4J79A 1JMZB 4LGNA 4ZOZA 5EARA 3IJ1A 5FKSA 3NVXA 5GXIA 2XYIA 2HJ4A 3CFSB 4FA4D 3L4MD 4O9DA 3NVQA 3A0FA 1GXRA 1N6DA 3PVWB 4IA9A 5H14A 2OK4A 2PM9B 3J81g 4H5JA 4A0BB 4U1EI 5H1MA 4AOWA 3NVNA 2IAAA 2Z2PA 3OW8A 2YBAA 2UZYB 3EI1B 5TDHB 4PBYA 2YNOA 1PBYB 4A11A 3BG1A 2H3XA 4O3UB 5GSAA 3J80g 4J87A 2QC5A 2AQ5A 3I7HA 2I3SA 3K26A 2IUPA 2QXVA 5EM2B 1NR0A 2Z2OA 5FQDA 4A09B 3ZWLB 3PE7A 3MXXA 2P9NC 5C2VB 3N0EA 3UKRC 4E5ZB 3JRPA 4JSVC 1SQ9A 2H68A 3SBRA 2HXCA 4UI9R 3OKYB 4CY2A 4GM8A 1MG2A 2H14A 1U2VC 4YVDA 5CXBB 5IJ8E 4JSXC 3EI2A 2GC4A 3SN6B 1U4CA 5TF2A 2H6KA 3MZLA 4FA1D 2H9PA 4CI2A 3PSLA 4X60B 3JAMg 2IWFA 3I7NA 3P4FA 5C2WB 4TZ4A 4R7AB 4J81A 4K3ID 3SJLD 2PM6B 4D0KA 2G9AA 2IWKA 2CE9A 4L1QD 2H9MA 4G56B 5EMKB 3IKOA 4X61B 2H9NA 2IUVA 4J0WA 1ERJA 5C9ZB 3MZKA 3ORVD 1PEVA 4GM3A 5HE0B 3I7OA 3F3FA 2H47A 3SXTD 2PBIB 3JB9L 4A2LA 4Y7RA 3RLMD 2H6NA 4CZVA 2OVRB 3SLED 3HFQA 2XL2A 3C5MA 3RFGA 2AGWA 1B9YA 1OMWB 5B4WA 3C99A 3EWEA 4PBZA 3JPXA 2H13A 4GM9A 4NSXA 3V7DB 3AL9A 5EAPA 2P9PC 2B4EA 4K3JB 5K1CC 2UZXB 5EMLB 3I89A 5FKTA 4X63B 1N6EA 1Q47A 4I79A 5HE3B 3N0DA 3IJ0A 2I0TA 2MTAH 4PSWB 1MDAH 3VH0A 3SBPA 3MMYA 2OIZA 5GXHA 4A11B 4ERYA 5EALA 2I0SA 4J73A 4EWRA 3RSEC 5IJ7E 4CI8A 5FA5B 2P9KC 2YNPA 4CC9A 1L0QA 1JJUB 5AMSA 3SMRA 1VYHC 2CN2A 1N6FA 4FAVD 4PSXB 4ESGA 3OTTA 3UVMA 2H9LA 3V9FA 3GREA 4X3EA 3SVWD 5EM2A 1XIPA 2HJBA 4GQ2P 1A0RB 5HQGA 3JROA 4FAND 4O1QD 1JMXB 3KRWB 1GP2B 2OJYA 4JSNC 4Z8LA 2W18A 4GGDA 3UKUC 4ZN4A 5HE1B 2CNXA 4L3HD 3EU7A 3E0CA 2XL3A 4Y5RD 4CY3A 5CYKA 5EMJB 5I5IA 3CIKB 4FA5D 3U4YA 3C9CA 3MKSB 5SXMA 3SCYA 4J82A 4MK0B 4GQ1A 3DXKC 3EI3A 3RN1D 4CZXA 3OL2A 3DM0A 3PSCB 4OZUA 2YNNA 4OWRA 1PGUA 4PXWA 5H17A 3VGZA 2HESX 4ERZA 2YMUA 1R5MA 3EI4B 2PM7B 4J86A 2AGLA 2BCJB 2G99A 5THAA 4O45A 3DXMC 4O3TB 2HKRA 4FB1D 4AEZA 3BWSA 2OVPB 4CY1A 1TBGA 3OL2B 4E5ZA 3AL8A 1RI6A 4GGCA 3JZGA 1PI6A 3IIWA 4ZOVA 4L3GD 3L4OD 1YFQA 4J8BA 2J57G 3F3PA 4A2MA 2I3TA 1K32A 3RRMC 3VA6A 4LG8A 4CY5A 3C75H 3FM0A 3BG0A 1NEXB 2B5NA 3I7KA 4BH6A 2Z2NA 4H5IA 4A09A 2B5LA 4A08A 4GQBB 3EG6A 3PXTD 4BUJC 3RFHA 5GMKn 3UVNA 5I5JA 3FRXA 3V5WB 5IGOA 4E54A 2I0RA 4ES0A 3RMZD 3B7FA 2AH1A 4JT6C 2GNQA 4FHLA 2CN3A 4IMMA 2CE8A 2XU7A 1GG2B 4J78A 3DSMA 1SHYB 3ODTA 3SHFA 5TEFA 1QNIA 2AGXA 4XYIA 1TYQC 5A2Qg 3I7LA 3DWLC 4GMBA 1GOTB 4L9OA 4GGAA 5IT9g 4ERQA 4QQEA 2HYEA 4QRJA 2B5MA 3EI2B 2P9SC 5CXBA 3PVUB 3EI4A 2OK6A 5TEEA 4CI3A 3K27A 2YB8B
chains in the Genus database with same CATH superfamily
3OKWA 1OLZA 2AH0A 1UOPA 3IJCA 4O02A 2H6QA 2O9KA 4U7AA 3UR4A 4E54B 5CXCB 3AH8B 4HDJA 2AGYA 4J8GA 4Z7QA 2EICA 2VDLA 4A0AB 4JT5C 2P9LC 1GOHA 5HDBA 1O6FA 1H2YA 4BCCA 3SWSD 5HYNB 4JD2C 2EIDA 3FGBA 4J77A 2BKLA 2CO0A 3V4VA 4FA9D 1K8KC 5CXCA 5EAMA 3MVDK 3UVKA 2P9IC 5IC7A 1YR2A 3ZE1A 4DNUA 5C92A 4QT8A 4A0BA 4GZ8A 3SFZA 3RN0D 2PM9A 2EBSA 2IURA 4A0AA 1I2MB 1P22A 1B9XA 4MMXA 5I5MA 3K71A 3ZE2A 4ZOYA 1H2ZA 3GD1I 5AFU3 4FWWA 4J84A 4WK4A 1T2XA 3GFCA 2P9UC 5M5TA 2XDWA 2BBKH 4ZOXA 4JHNA 4RE6A 2Q7QA 1XKSA 2J55H 3FCSA 3MKQA 1GOGA 3SBQA 3IUJA 3VI4A 5JWZA 5FKRA 2OVQB 4J0XA 3O4HA 1A12A 2IUQA 3PXSD 3PXWD 3JZNA 5FLXg 3I7PA 4BP8A 4CZYA 5M5VA 1S4UX 3AFCA 4JHPC 5AJAA 3I2NA 4CI1A 1XHMA 2CO0C 2VDKA 4JXMA 4G55A 3KRXB 2HKMA 5CYKB 1VE6A 5EMMB 4XEIC 5FXYA 3UVLA 3EMHA 3ULEC 3F3GA 3EI3B 2GC7A 1SQJA 3I8CA 2TRCB 2EIBA 3W15A 3IIYA 4A7JA 3DDUA 1TYEA 4LG9A 5KDOB 2QR5A 4KFMB 2AGZA 3OKTA 4N14A 5M61A 1MG3A 4BL0A 4NENA 4PC0A 4A08B 3OKYA 3EI1A 5HE2B 1FWXA 4PNKB 3UVOA 3CFVA 3NIFA 4JSPC 1VZ3A 3JZHA 2VDQA 4XYHA 5IGQA 5K19A 5FKQA 1E5TA 3I8EA 4QL1A 2J56H 1JOFA 3EQ7A 3AL8B 4D6VA 1BPOA 5M5UA 4J79A 3KCIA 1JMZB 4LGNA 4ZOZA 5EARA 3IJ1A 5FKSA 3NVXA 5GXIA 2XYIA 1H2XA 2HJ4A 3CFSB 4FA4D 2EIEA 3L4MD 4O9DA 3NVQA 3A0FA 1GXRA 1N6DA 3PVWB 1QFMA 4IA9A 5H14A 4MMZA 5C86A 2OK4A 2PM9B 3J81g 4H5JA 4DNVA 4A0BB 4U1EI 5H1MA 4AOWA 3NVNA 2IAAA 2Z2PA 3OW8A 2YBAA 2UZYB 3EI1B 5TDHB 4PBYA 5E6RA 2YNOA 1PBYB 1GOFA 4A11A 3BG1A 4NC4A 2H3XA 1C9IA 3IULA 1UOQA 4O2WA 3T3PA 4O3UB 5GSAA 3J80g 4J87A 2QC5A 2AQ5A 3K6SA 3I7HA 4G1EA 2I3SA 4NBMA 3K26A 2IUPA 2QXVA 4WK2A 5EM2B 1NR0A 1U8CA 2Z2OA 5FQDA 4A09B 3ZWLB 3QI0A 2VDMA 3PE7A 3MXXA 2P9NC 5C2VB 3FCUA 3N0EA 3UKRC 4E5ZB 3JRPA 1O6GA 4JSVC 1SQ9A 2H68A 3SBRA 2HXCA 4UI9R 3OKYB 4CY2A 3IUMA 4GM8A 1MG2A 2H14A 1U2VC 4YVDA 4AMYA 5CXBB 5IJ8E 4JSXC 3EI2A 2GC4A 3SN6B 1U4CA 5TF2A 4BP9A 2H6KA 3MZLA 4FA1D 2H9PA 4WJKA 4CI2A 3PSLA 4X60B 4D9SA 3JAMg 2IWFA 3I7NA 3P4FA 5C2WB 4TZ4A 5E6UA 4R7AB 4J81A 2HU8A 4K3ID 1C9LA 3SJLD 2PM6B 3ZE0A 4D0KA 2G9AA 2IWKA 3O4IA 3IVMA 3NIGA 2CE9A 4L1QD 2H9MA 4G56B 5EMKB 3IKOA 4X61B 2XE4A 2H9NA 2IUVA 3IUNA 4J0WA 1ERJA 1UTCA 5C9ZB 4NAAA 3MZKA 3ORVD 1PEVA 4GM3A 4AX4A 5HE0B 3I7OA 3F3FA 2H47A 3SXTD 2PBIB 4BCBA 3JB9L 4A2LA 4Y7RA 3RLMD 2H6NA 3GC3B 4CZVA 3VI3A 2OVRB 3SLED 4AMZA 3HFQA 2XL2A 3C5MA 3O4GA 3RFGA 2AGWA 2XZGA 1B9YA 1OMWB 1JTDB 5B4WA 1JV2A 3C99A 3EWEA 4PBZA 3JPXA 3EQ9A 2H13A 3QHYB 1M1XA 4GM9A 5E6SA 4NSXA 3V7DB 3AL9A 2VDRA 5EAPA 2P9PC 2B4EA 4K3JB 1UOOA 5K1CC 2HU7A 2UZXB 5EMLB 3I89A 5FKTA 4X63B 1N6EA 4DNWA 1Q47A 4I79A 3OF7A 5HE3B 3N0DA 3IJ0A 2I0TA 2MTAH 4PSWB 1MDAH 3T3MA 3VH0A 3SBPA 3MMYA 2OIZA 5GXHA 4A11B 4ERYA 5EALA 2I0SA 4J73A 4EWRA 3RSEC 5IJ7E 4CI8A 1H2WA 3ZDZA 5FA5B 2P9KC 2YNPA 4CC9A 1L0QA 1JJUB 2VZ1A 4RE5A 5AMSA 3SMRA 1VYHC 3EQ8A 2CN2A 1N6FA 4FAVD 4PSXB 2VDPA 4ESGA 3OTTA 3IURA 3UVMA 2H9LA 3V9FA 3GREA 4X3EA 4AN1A 4MMYA 3SVWD 5EM2A 1XIPA 2HJBA 4GQ2P 1A0RB 5HQGA 3JROA 4FAND 4O1QD 1JMXB 3KRWB 1GP2B 2OJYA 4JSNC 3O4JA 4Z8LA 2W18A 4GGDA 3UKUC 4UM9A 4ZN4A 5HE1B 2CNXA 4L3HD 3EU7A 2XL3A 3E0CA 4Z7NA 4QAMA 4Y5RD 4CY3A 1K3IA 5CYKA 5EMJB 5I5IA 3CIKB 4FA5D 3U4YA 4UM8A 3C9CA 3MKSB 5SXMA 3SCYA 4J82A 4MK0B 4GQ1A 3DXKC 3EI3A 4BCDA 3RN1D 4CZXA 3OL2A 3DM0A 2QZPA 3PSCB 2VZ3A 4OZUA 3MUNA 2YNNA 3V4PA 4OWRA 1PGUA 4PXWA 5H17A 3VGZA 2HESX 4ERZA 2YMUA 1R5MA 3EI4B 2PM7B 4J86A 4AN0A 2AGLA 2BCJB 5M5SA 2G99A 5THAA 4O45A 2VDNA 5M5RA 3DXMC 4O3TB 2HKRA 4FB1D 4AEZA 3BWSA 2OVPB 4CY1A 1TBGA 2WQ8A 3OL2B 3AL8A 4E5ZA 3MUOA 1RI6A 1L5GA 4GGCA 3JZGA 3ZDXA 1PI6A 2VDOA 1VZ2A 3IIWA 4ZOVA 4L3GD 3L4OD 1YFQA 2J57G 3F3PA 4J8BA 4A2MA 2I3TA 1K32A 3RRMC 2VC2A 3VA6A 4LG8A 4CY5A 1QFSA 3C75H 3FM0A 3BG0A 1NEXB 2B5NA 3I7KA 4BH6A 2Z2NA 3ZDYA 4H5IA 4A09A 2B5LA 4A08A 4GQBB 3EG6A 3PXTD 3K72A 4BUJC 3IUQA 3RFHA 5GMKn 2HU5A 3UVNA 5I5JA 3FRXA 3V5WB 5IGOA 4E54A 2I0RA 4ES0A 4WK0A 2JKXA 3RMZD 3B7FA 2AH1A 4JT6C 2GNQA 4FHLA 2CN3A 4IMMA 2CE8A 4IRZA 2XU7A 1GG2B 1VE7A 4J78A 3IJEA 3DSMA 1SHYB 3ODTA 5FFGA 3SHFA 5TEFA 4G1MA 1QNIA 1E8MA 2AGXA 4XYIA 1TYQC 5A2Qg 3I7LA 3DWLC 4GMBA 4Z7OA 1GOTB 4L9OA 4GGAA 5IT9g 4ERQA 1E8NA 4QQEA 2HYEA 4QRJA 2B5MA 5FFOA 3EI2B 2P9SC 4L1MA 5CXBA 3PVUB 3EI4A 2OK6A 5TEEA 3NIDA 4CI3A 3K27A 2YB8B
chains in the Genus database with same CATH topology
3OKWA 1OLZA 2AH0A 3IJCA 2H6QA 2O9KA 4U7AA 3UR4A 4E54B 5CXCB 3AH8B 4HDJA 2AGYA 4J8GA 4A0AB 4JT5C 2P9LC 3SWSD 5HYNB 4JD2C 3FGBA 4J77A 2CO0A 4FA9D 1K8KC 5CXCA 5EAMA 3UVKA 2P9IC 5IC7A 4QT8A 4A0BA 4GZ8A 3SFZA 3RN0D 2PM9A 2EBSA 2IURA 4A0AA 1P22A 1B9XA 5I5MA 4ZOYA 5AFU3 4FWWA 4J84A 3GFCA 2P9UC 2BBKH 4ZOXA 2Q7QA 1XKSA 2J55H 3MKQA 3SBQA 5JWZA 5FKRA 2OVQB 4J0XA 2IUQA 3PXSD 3PXWD 3JZNA 5FLXg 3I7PA 4CZYA 1S4UX 3AFCA 5AJAA 3I2NA 4CI1A 1XHMA 2CO0C 4JXMA 3KRXB 2HKMA 5CYKB 5EMMB 4XEIC 5FXYA 3UVLA 3EMHA 3ULEC 3F3GA 3EI3B 2GC7A 1SQJA 3I8CA 2TRCB 3W15A 3IIYA 4A7JA 4LG9A 5KDOB 4KFMB 2AGZA 3OKTA 4N14A 1MG3A 4BL0A 4PC0A 4A08B 3OKYA 3EI1A 5HE2B 1FWXA 4PNKB 3UVOA 3CFVA 4JSPC 3JZHA 4XYHA 5IGQA 5K19A 5FKQA 3I8EA 4QL1A 2J56H 1JOFA 3AL8B 4D6VA 4J79A 1JMZB 4LGNA 4ZOZA 5EARA 3IJ1A 5FKSA 3NVXA 5GXIA 2XYIA 2HJ4A 3CFSB 4FA4D 3L4MD 4O9DA 3NVQA 3A0FA 1GXRA 1N6DA 3PVWB 4IA9A 5H14A 2OK4A 2PM9B 3J81g 4H5JA 4A0BB 4U1EI 5H1MA 4AOWA 3NVNA 2IAAA 2Z2PA 3OW8A 2YBAA 2UZYB 3EI1B 5TDHB 4PBYA 2YNOA 1PBYB 4A11A 3BG1A 2H3XA 4O3UB 5GSAA 3J80g 4J87A 2QC5A 2AQ5A 3I7HA 2I3SA 3K26A 2IUPA 2QXVA 5EM2B 1NR0A 2Z2OA 5FQDA 4A09B 3ZWLB 3PE7A 3MXXA 2P9NC 5C2VB 3N0EA 3UKRC 4E5ZB 3JRPA 4JSVC 1SQ9A 2H68A 3SBRA 2HXCA 4UI9R 3OKYB 4CY2A 4GM8A 1MG2A 2H14A 1U2VC 4YVDA 5CXBB 5IJ8E 4JSXC 3EI2A 2GC4A 3SN6B 1U4CA 5TF2A 2H6KA 3MZLA 4FA1D 2H9PA 4CI2A 3PSLA 4X60B 3JAMg 2IWFA 3I7NA 3P4FA 5C2WB 4TZ4A 4R7AB 4J81A 4K3ID 3SJLD 2PM6B 4D0KA 2G9AA 2IWKA 2CE9A 4L1QD 2H9MA 4G56B 5EMKB 3IKOA 4X61B 2H9NA 2IUVA 4J0WA 1ERJA 5C9ZB 3MZKA 3ORVD 1PEVA 4GM3A 5HE0B 3I7OA 3F3FA 2H47A 3SXTD 2PBIB 3JB9L 4A2LA 4Y7RA 3RLMD 2H6NA 4CZVA 2OVRB 3SLED 3HFQA 2XL2A 3C5MA 3RFGA 2AGWA 1B9YA 1OMWB 5B4WA 3C99A 3EWEA 4PBZA 3JPXA 2H13A 4GM9A 4NSXA 3V7DB 3AL9A 5EAPA 2P9PC 2B4EA 4K3JB 5K1CC 2UZXB 5EMLB 3I89A 5FKTA 4X63B 1N6EA 1Q47A 4I79A 5HE3B 3N0DA 3IJ0A 2I0TA 2MTAH 4PSWB 1MDAH 3VH0A 3SBPA 3MMYA 2OIZA 5GXHA 4A11B 4ERYA 5EALA 2I0SA 4J73A 4EWRA 3RSEC 5IJ7E 4CI8A 5FA5B 2P9KC 2YNPA 4CC9A 1L0QA 1JJUB 5AMSA 3SMRA 1VYHC 2CN2A 1N6FA 4FAVD 4PSXB 4ESGA 3OTTA 3UVMA 2H9LA 3V9FA 3GREA 4X3EA 3SVWD 5EM2A 1XIPA 2HJBA 4GQ2P 1A0RB 5HQGA 3JROA 4FAND 4O1QD 1JMXB 3KRWB 1GP2B 2OJYA 4JSNC 4Z8LA 2W18A 4GGDA 3UKUC 4ZN4A 5HE1B 2CNXA 4L3HD 3EU7A 3E0CA 2XL3A 4Y5RD 4CY3A 5CYKA 5EMJB 5I5IA 3CIKB 4FA5D 3U4YA 3C9CA 3MKSB 5SXMA 3SCYA 4J82A 4MK0B 4GQ1A 3DXKC 3EI3A 3RN1D 4CZXA 3OL2A 3DM0A 3PSCB 4OZUA 2YNNA 4OWRA 1PGUA 4PXWA 5H17A 3VGZA 2HESX 4ERZA 2YMUA 1R5MA 3EI4B 2PM7B 4J86A 2AGLA 2BCJB 2G99A 5THAA 4O45A 3DXMC 4O3TB 2HKRA 4FB1D 4AEZA 3BWSA 2OVPB 4CY1A 1TBGA 3OL2B 4E5ZA 3AL8A 1RI6A 4GGCA 3JZGA 1PI6A 3IIWA 4ZOVA 4L3GD 3L4OD 1YFQA 4J8BA 2J57G 3F3PA 4A2MA 2I3TA 1K32A 3RRMC 3VA6A 4LG8A 4CY5A 3C75H 3FM0A 3BG0A 1NEXB 2B5NA 3I7KA 4BH6A 2Z2NA 4H5IA 4A09A 2B5LA 4A08A 4GQBB 3EG6A 3PXTD 4BUJC 3RFHA 5GMKn 3UVNA 5I5JA 3FRXA 3V5WB 5IGOA 4E54A 2I0RA 4ES0A 3RMZD 3B7FA 2AH1A 4JT6C 2GNQA 4FHLA 2CN3A 4IMMA 2CE8A 2XU7A 1GG2B 4J78A 3DSMA 1SHYB 3ODTA 3SHFA 5TEFA 1QNIA 2AGXA 4XYIA 1TYQC 5A2Qg 3I7LA 3DWLC 4GMBA 1GOTB 4L9OA 4GGAA 5IT9g 4ERQA 4QQEA 2HYEA 4QRJA 2B5MA 3EI2B 2P9SC 5CXBA 3PVUB 3EI4A 2OK6A 5TEEA 4CI3A 3K27A 2YB8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKW A;  1OLZ A;  2AH0 A;  3IJC A;  2H6Q A;  2O9K A;  4U7A A;  3UR4 A;  4E54 B;  5CXC B;  3AH8 B;  4HDJ A;  2AGY A;  4J8G A;  4A0A B;  4JT5 C;  2P9L C;  3SWS D;  5HYN B;  4JD2 C;  3FGB A;  4J77 A;  2CO0 A;  4FA9 D;  1K8K C;  5CXC A;  5EAM A;  3UVK A;  2P9I C;  5IC7 A;  4QT8 A;  4A0B A;  4GZ8 A;  3SFZ A;  3RN0 D;  2PM9 A;  2EBS A;  2IUR A;  4A0A A;  1P22 A;  1B9X A;  5I5M A;  4ZOY A;  5AFU 3;  4FWW A;  4J84 A;  3GFC A;  2P9U C;  2BBK H;  4ZOX A;  2Q7Q A;  1XKS A;  2J55 H;  3MKQ A;  3SBQ A;  5JWZ A;  5FKR A;  2OVQ B;  4J0X A;  2IUQ A;  3PXS D;  3PXW D;  3JZN A;  5FLX g;  3I7P A;  4CZY A;  1S4U X;  3AFC A;  5AJA A;  3I2N A;  4CI1 A;  1XHM A;  2CO0 C;  4JXM A;  3KRX B;  2HKM A;  5CYK B;  5EMM B;  4XEI C;  5FXY A;  3UVL A;  3EMH A;  3ULE C;  3F3G A;  3EI3 B;  2GC7 A;  1SQJ A;  3I8C A;  2TRC B;  3W15 A;  3IIY A;  4A7J A;  4LG9 A;  5KDO B;  4KFM B;  2AGZ A;  3OKT A;  4N14 A;  1MG3 A;  4BL0 A;  4PC0 A;  4A08 B;  3OKY A;  3EI1 A;  5HE2 B;  1FWX A;  4PNK B;  3UVO A;  3CFV A;  4JSP C;  3JZH A;  4XYH A;  5IGQ A;  5K19 A;  5FKQ A;  3I8E A;  4QL1 A;  2J56 H;  1JOF A;  3AL8 B;  4D6V A;  4J79 A;  1JMZ B;  4LGN A;  4ZOZ A;  5EAR A;  3IJ1 A;  5FKS A;  3NVX A;  5GXI A;  2XYI A;  2HJ4 A;  3CFS B;  4FA4 D;  3L4M D;  4O9D A;  3NVQ A;  3A0F A;  1GXR A;  1N6D A;  3PVW B;  4IA9 A;  5H14 A;  2OK4 A;  2PM9 B;  3J81 g;  4H5J A;  4A0B B;  4U1E I;  5H1M A;  4AOW A;  3NVN A;  2IAA A;  2Z2P A;  3OW8 A;  2YBA A;  2UZY B;  3EI1 B;  5TDH B;  4PBY A;  2YNO A;  1PBY B;  4A11 A;  3BG1 A;  2H3X A;  4O3U B;  5GSA A;  3J80 g;  4J87 A;  2QC5 A;  2AQ5 A;  3I7H A;  2I3S A;  3K26 A;  2IUP A;  2QXV A;  5EM2 B;  1NR0 A;  2Z2O A;  5FQD A;  4A09 B;  3ZWL B;  3PE7 A;  3MXX A;  2P9N C;  5C2V B;  3N0E A;  3UKR C;  4E5Z B;  3JRP A;  4JSV C;  1SQ9 A;  2H68 A;  3SBR A;  2HXC A;  4UI9 R;  3OKY B;  4CY2 A;  4GM8 A;  1MG2 A;  2H14 A;  1U2V C;  4YVD A;  5CXB B;  5IJ8 E;  4JSX C;  3EI2 A;  2GC4 A;  3SN6 B;  1U4C A;  5TF2 A;  2H6K A;  3MZL A;  4FA1 D;  2H9P A;  4CI2 A;  3PSL A;  4X60 B;  3JAM g;  2IWF A;  3I7N A;  3P4F A;  5C2W B;  4TZ4 A;  4R7A B;  4J81 A;  4K3I D;  3SJL D;  2PM6 B;  4D0K A;  2G9A A;  2IWK A;  2CE9 A;  4L1Q D;  2H9M A;  4G56 B;  5EMK B;  3IKO A;  4X61 B;  2H9N A;  2IUV A;  4J0W A;  1ERJ A;  5C9Z B;  3MZK A;  3ORV D;  1PEV A;  4GM3 A;  5HE0 B;  3I7O A;  3F3F A;  2H47 A;  3SXT D;  2PBI B;  3JB9 L;  4A2L A;  4Y7R A;  3RLM D;  2H6N A;  4CZV A;  2OVR B;  3SLE D;  3HFQ A;  2XL2 A;  3C5M A;  3RFG A;  2AGW A;  1B9Y A;  1OMW B;  5B4W A;  3C99 A;  3EWE A;  4PBZ A;  3JPX A;  2H13 A;  4GM9 A;  4NSX A;  3V7D B;  3AL9 A;  5EAP A;  2P9P C;  2B4E A;  4K3J B;  5K1C C;  2UZX B;  5EML B;  3I89 A;  5FKT A;  4X63 B;  1N6E A;  1Q47 A;  4I79 A;  5HE3 B;  3N0D A;  3IJ0 A;  2I0T A;  2MTA H;  4PSW B;  1MDA H;  3VH0 A;  3SBP A;  3MMY A;  2OIZ A;  5GXH A;  4A11 B;  4ERY A;  5EAL A;  2I0S A;  4J73 A;  4EWR A;  3RSE C;  5IJ7 E;  4CI8 A;  5FA5 B;  2P9K C;  2YNP A;  4CC9 A;  1L0Q A;  1JJU B;  5AMS A;  3SMR A;  1VYH C;  2CN2 A;  1N6F A;  4FAV D;  4PSX B;  4ESG A;  3OTT A;  3UVM A;  2H9L A;  3V9F A;  3GRE A;  4X3E A;  3SVW D;  5EM2 A;  1XIP A;  2HJB A;  4GQ2 P;  1A0R B;  5HQG A;  3JRO A;  4FAN D;  4O1Q D;  1JMX B;  3KRW B;  1GP2 B;  2OJY A;  4JSN C;  4Z8L A;  2W18 A;  4GGD A;  3UKU C;  4ZN4 A;  5HE1 B;  2CNX A;  4L3H D;  3EU7 A;  3E0C A;  2XL3 A;  4Y5R D;  4CY3 A;  5CYK A;  5EMJ B;  5I5I A;  3CIK B;  4FA5 D;  3U4Y A;  3C9C A;  3MKS B;  5SXM A;  3SCY A;  4J82 A;  4MK0 B;  4GQ1 A;  3DXK C;  3EI3 A;  3RN1 D;  4CZX A;  3OL2 A;  3DM0 A;  3PSC B;  4OZU A;  2YNN A;  4OWR A;  1PGU A;  4PXW A;  5H17 A;  3VGZ A;  2HES X;  4ERZ A;  2YMU A;  1R5M A;  3EI4 B;  2PM7 B;  4J86 A;  2AGL A;  2BCJ B;  2G99 A;  5THA A;  4O45 A;  3DXM C;  4O3T B;  2HKR A;  4FB1 D;  4AEZ A;  3BWS A;  2OVP B;  4CY1 A;  1TBG A;  3OL2 B;  4E5Z A;  3AL8 A;  1RI6 A;  4GGC A;  3JZG A;  1PI6 A;  3IIW A;  4ZOV A;  4L3G D;  3L4O D;  1YFQ A;  4J8B A;  2J57 G;  3F3P A;  4A2M A;  2I3T A;  1K32 A;  3RRM C;  3VA6 A;  4LG8 A;  4CY5 A;  3C75 H;  3FM0 A;  3BG0 A;  1NEX B;  2B5N A;  3I7K A;  4BH6 A;  2Z2N A;  4H5I A;  4A09 A;  2B5L A;  4A08 A;  4GQB B;  3EG6 A;  3PXT D;  4BUJ C;  3RFH A;  5GMK n;  3UVN A;  5I5J A;  3FRX A;  3V5W B;  5IGO A;  4E54 A;  2I0R A;  4ES0 A;  3RMZ D;  3B7F A;  2AH1 A;  4JT6 C;  2GNQ A;  4FHL A;  2CN3 A;  4IMM A;  2CE8 A;  2XU7 A;  1GG2 B;  4J78 A;  3DSM A;  1SHY B;  3ODT A;  3SHF A;  5TEF A;  1QNI A;  2AGX A;  4XYI A;  1TYQ C;  5A2Q g;  3I7L A;  3DWL C;  4GMB A;  1GOT B;  4L9O A;  4GGA A;  5IT9 g;  4ERQ A;  4QQE A;  2HYE A;  4QRJ A;  2B5M A;  3EI2 B;  2P9S C;  5CXB A;  3PVU B;  3EI4 A;  2OK6 A;  5TEE A;  4CI3 A;  3K27 A;  2YB8 B; 
#chains in the Genus database with same CATH topology
 3OKW A;  1OLZ A;  2AH0 A;  1UOP A;  3IJC A;  4O02 A;  2H6Q A;  2O9K A;  4U7A A;  3UR4 A;  4E54 B;  5CXC B;  3AH8 B;  4HDJ A;  2AGY A;  4J8G A;  4Z7Q A;  2EIC A;  2VDL A;  4A0A B;  4JT5 C;  2P9L C;  1GOH A;  5HDB A;  1O6F A;  1H2Y A;  4BCC A;  3SWS D;  5HYN B;  4JD2 C;  2EID A;  3FGB A;  4J77 A;  2BKL A;  2CO0 A;  3V4V A;  4FA9 D;  1K8K C;  5CXC A;  5EAM A;  3MVD K;  3UVK A;  2P9I C;  5IC7 A;  1YR2 A;  3ZE1 A;  4DNU A;  5C92 A;  4QT8 A;  4A0B A;  4GZ8 A;  3SFZ A;  3RN0 D;  2PM9 A;  2EBS A;  2IUR A;  4A0A A;  1I2M B;  1P22 A;  1B9X A;  4MMX A;  5I5M A;  3K71 A;  3ZE2 A;  4ZOY A;  1H2Z A;  3GD1 I;  5AFU 3;  4FWW A;  4J84 A;  4WK4 A;  1T2X A;  3GFC A;  2P9U C;  5M5T A;  2XDW A;  2BBK H;  4ZOX A;  4JHN A;  4RE6 A;  2Q7Q A;  1XKS A;  2J55 H;  3FCS A;  3MKQ A;  1GOG A;  3SBQ A;  3IUJ A;  3VI4 A;  5JWZ A;  5FKR A;  2OVQ B;  4J0X A;  3O4H A;  1A12 A;  2IUQ A;  3PXS D;  3PXW D;  3JZN A;  5FLX g;  3I7P A;  4BP8 A;  4CZY A;  5M5V A;  1S4U X;  3AFC A;  4JHP C;  5AJA A;  3I2N A;  4CI1 A;  1XHM A;  2CO0 C;  2VDK A;  4JXM A;  4G55 A;  3KRX B;  2HKM A;  5CYK B;  1VE6 A;  5EMM B;  4XEI C;  5FXY A;  3UVL A;  3EMH A;  3ULE C;  3F3G A;  3EI3 B;  2GC7 A;  1SQJ A;  3I8C A;  2TRC B;  2EIB A;  3W15 A;  3IIY A;  4A7J A;  3DDU A;  1TYE A;  4LG9 A;  5KDO B;  2QR5 A;  4KFM B;  2AGZ A;  3OKT A;  4N14 A;  5M61 A;  1MG3 A;  4BL0 A;  4NEN A;  4PC0 A;  4A08 B;  3OKY A;  3EI1 A;  5HE2 B;  1FWX A;  4PNK B;  3UVO A;  3CFV A;  3NIF A;  4JSP C;  1VZ3 A;  3JZH A;  2VDQ A;  4XYH A;  5IGQ A;  5K19 A;  5FKQ A;  1E5T A;  3I8E A;  4QL1 A;  2J56 H;  1JOF A;  3EQ7 A;  3AL8 B;  4D6V A;  1BPO A;  5M5U A;  4J79 A;  3KCI A;  1JMZ B;  4LGN A;  4ZOZ A;  5EAR A;  3IJ1 A;  5FKS A;  3NVX A;  5GXI A;  2XYI A;  1H2X A;  2HJ4 A;  3CFS B;  4FA4 D;  2EIE A;  3L4M D;  4O9D A;  3NVQ A;  3A0F A;  1GXR A;  1N6D A;  3PVW B;  1QFM A;  4IA9 A;  5H14 A;  4MMZ A;  5C86 A;  2OK4 A;  2PM9 B;  3J81 g;  4H5J A;  4DNV A;  4A0B B;  4U1E I;  5H1M A;  4AOW A;  3NVN A;  2IAA A;  2Z2P A;  3OW8 A;  2YBA A;  2UZY B;  3EI1 B;  5TDH B;  4PBY A;  5E6R A;  2YNO A;  1PBY B;  1GOF A;  4A11 A;  3BG1 A;  4NC4 A;  2H3X A;  1C9I A;  3IUL A;  1UOQ A;  4O2W A;  3T3P A;  4O3U B;  5GSA A;  3J80 g;  4J87 A;  2QC5 A;  2AQ5 A;  3K6S A;  3I7H A;  4G1E A;  2I3S A;  4NBM A;  3K26 A;  2IUP A;  2QXV A;  4WK2 A;  5EM2 B;  1NR0 A;  1U8C A;  2Z2O A;  5FQD A;  4A09 B;  3ZWL B;  3QI0 A;  2VDM A;  3PE7 A;  3MXX A;  2P9N C;  5C2V B;  3FCU A;  3N0E A;  3UKR C;  4E5Z B;  3JRP A;  1O6G A;  4JSV C;  1SQ9 A;  2H68 A;  3SBR A;  2HXC A;  4UI9 R;  3OKY B;  4CY2 A;  3IUM A;  4GM8 A;  1MG2 A;  2H14 A;  1U2V C;  4YVD A;  4AMY A;  5CXB B;  5IJ8 E;  4JSX C;  3EI2 A;  2GC4 A;  3SN6 B;  1U4C A;  5TF2 A;  4BP9 A;  2H6K A;  3MZL A;  4FA1 D;  2H9P A;  4WJK A;  4CI2 A;  3PSL A;  4X60 B;  4D9S A;  3JAM g;  2IWF A;  3I7N A;  3P4F A;  5C2W B;  4TZ4 A;  5E6U A;  4R7A B;  4J81 A;  2HU8 A;  4K3I D;  1C9L A;  3SJL D;  2PM6 B;  3ZE0 A;  4D0K A;  2G9A A;  2IWK A;  3O4I A;  3IVM A;  3NIG A;  2CE9 A;  4L1Q D;  2H9M A;  4G56 B;  5EMK B;  3IKO A;  4X61 B;  2XE4 A;  2H9N A;  2IUV A;  3IUN A;  4J0W A;  1ERJ A;  1UTC A;  5C9Z B;  4NAA A;  3MZK A;  3ORV D;  1PEV A;  4GM3 A;  4AX4 A;  5HE0 B;  3I7O A;  3F3F A;  2H47 A;  3SXT D;  2PBI B;  4BCB A;  3JB9 L;  4A2L A;  4Y7R A;  3RLM D;  2H6N A;  3GC3 B;  4CZV A;  3VI3 A;  2OVR B;  3SLE D;  4AMZ A;  3HFQ A;  2XL2 A;  3C5M A;  3O4G A;  3RFG A;  2AGW A;  2XZG A;  1B9Y A;  1OMW B;  1JTD B;  5B4W A;  1JV2 A;  3C99 A;  3EWE A;  4PBZ A;  3JPX A;  3EQ9 A;  2H13 A;  3QHY B;  1M1X A;  4GM9 A;  5E6S A;  4NSX A;  3V7D B;  3AL9 A;  2VDR A;  5EAP A;  2P9P C;  2B4E A;  4K3J B;  1UOO A;  5K1C C;  2HU7 A;  2UZX B;  5EML B;  3I89 A;  5FKT A;  4X63 B;  1N6E A;  4DNW A;  1Q47 A;  4I79 A;  3OF7 A;  5HE3 B;  3N0D A;  3IJ0 A;  2I0T A;  2MTA H;  4PSW B;  1MDA H;  3T3M A;  3VH0 A;  3SBP A;  3MMY A;  2OIZ A;  5GXH A;  4A11 B;  4ERY A;  5EAL A;  2I0S A;  4J73 A;  4EWR A;  3RSE C;  5IJ7 E;  4CI8 A;  1H2W A;  3ZDZ A;  5FA5 B;  2P9K C;  2YNP A;  4CC9 A;  1L0Q A;  1JJU B;  2VZ1 A;  4RE5 A;  5AMS A;  3SMR A;  1VYH C;  3EQ8 A;  2CN2 A;  1N6F A;  4FAV D;  4PSX B;  2VDP A;  4ESG A;  3OTT A;  3IUR A;  3UVM A;  2H9L A;  3V9F A;  3GRE A;  4X3E A;  4AN1 A;  4MMY A;  3SVW D;  5EM2 A;  1XIP A;  2HJB A;  4GQ2 P;  1A0R B;  5HQG A;  3JRO A;  4FAN D;  4O1Q D;  1JMX B;  3KRW B;  1GP2 B;  2OJY A;  4JSN C;  3O4J A;  4Z8L A;  2W18 A;  4GGD A;  3UKU C;  4UM9 A;  4ZN4 A;  5HE1 B;  2CNX A;  4L3H D;  3EU7 A;  2XL3 A;  3E0C A;  4Z7N A;  4QAM A;  4Y5R D;  4CY3 A;  1K3I A;  5CYK A;  5EMJ B;  5I5I A;  3CIK B;  4FA5 D;  3U4Y A;  4UM8 A;  3C9C A;  3MKS B;  5SXM A;  3SCY A;  4J82 A;  4MK0 B;  4GQ1 A;  3DXK C;  3EI3 A;  4BCD A;  3RN1 D;  4CZX A;  3OL2 A;  3DM0 A;  2QZP A;  3PSC B;  2VZ3 A;  4OZU A;  3MUN A;  2YNN A;  3V4P A;  4OWR A;  1PGU A;  4PXW A;  5H17 A;  3VGZ A;  2HES X;  4ERZ A;  2YMU A;  1R5M A;  3EI4 B;  2PM7 B;  4J86 A;  4AN0 A;  2AGL A;  2BCJ B;  5M5S A;  2G99 A;  5THA A;  4O45 A;  2VDN A;  5M5R A;  3DXM C;  4O3T B;  2HKR A;  4FB1 D;  4AEZ A;  3BWS A;  2OVP B;  4CY1 A;  1TBG A;  2WQ8 A;  3OL2 B;  3AL8 A;  4E5Z A;  3MUO A;  1RI6 A;  1L5G A;  4GGC A;  3JZG A;  3ZDX A;  1PI6 A;  2VDO A;  1VZ2 A;  3IIW A;  4ZOV A;  4L3G D;  3L4O D;  1YFQ A;  2J57 G;  3F3P A;  4J8B A;  4A2M A;  2I3T A;  1K32 A;  3RRM C;  2VC2 A;  3VA6 A;  4LG8 A;  4CY5 A;  1QFS A;  3C75 H;  3FM0 A;  3BG0 A;  1NEX B;  2B5N A;  3I7K A;  4BH6 A;  2Z2N A;  3ZDY A;  4H5I A;  4A09 A;  2B5L A;  4A08 A;  4GQB B;  3EG6 A;  3PXT D;  3K72 A;  4BUJ C;  3IUQ A;  3RFH A;  5GMK n;  2HU5 A;  3UVN A;  5I5J A;  3FRX A;  3V5W B;  5IGO A;  4E54 A;  2I0R A;  4ES0 A;  4WK0 A;  2JKX A;  3RMZ D;  3B7F A;  2AH1 A;  4JT6 C;  2GNQ A;  4FHL A;  2CN3 A;  4IMM A;  2CE8 A;  4IRZ A;  2XU7 A;  1GG2 B;  1VE7 A;  4J78 A;  3IJE A;  3DSM A;  1SHY B;  3ODT A;  5FFG A;  3SHF A;  5TEF A;  4G1M A;  1QNI A;  1E8M A;  2AGX A;  4XYI A;  1TYQ C;  5A2Q g;  3I7L A;  3DWL C;  4GMB A;  4Z7O A;  1GOT B;  4L9O A;  4GGA A;  5IT9 g;  4ERQ A;  1E8N A;  4QQE A;  2HYE A;  4QRJ A;  2B5M A;  5FFO A;  3EI2 B;  2P9S C;  4L1M A;  5CXB A;  3PVU B;  3EI4 A;  2OK6 A;  5TEE A;  3NID A;  4CI3 A;  3K27 A;  2YB8 B; 
#chains in the Genus database with same CATH homology
 3OKW A;  1OLZ A;  2AH0 A;  3IJC A;  2H6Q A;  2O9K A;  4U7A A;  3UR4 A;  4E54 B;  5CXC B;  3AH8 B;  4HDJ A;  2AGY A;  4J8G A;  4A0A B;  4JT5 C;  2P9L C;  3SWS D;  5HYN B;  4JD2 C;  3FGB A;  4J77 A;  2CO0 A;  4FA9 D;  1K8K C;  5CXC A;  5EAM A;  3UVK A;  2P9I C;  5IC7 A;  4QT8 A;  4A0B A;  4GZ8 A;  3SFZ A;  3RN0 D;  2PM9 A;  2EBS A;  2IUR A;  4A0A A;  1P22 A;  1B9X A;  5I5M A;  4ZOY A;  5AFU 3;  4FWW A;  4J84 A;  3GFC A;  2P9U C;  2BBK H;  4ZOX A;  2Q7Q A;  1XKS A;  2J55 H;  3MKQ A;  3SBQ A;  5JWZ A;  5FKR A;  2OVQ B;  4J0X A;  2IUQ A;  3PXS D;  3PXW D;  3JZN A;  5FLX g;  3I7P A;  4CZY A;  1S4U X;  3AFC A;  5AJA A;  3I2N A;  4CI1 A;  1XHM A;  2CO0 C;  4JXM A;  3KRX B;  2HKM A;  5CYK B;  5EMM B;  4XEI C;  5FXY A;  3UVL A;  3EMH A;  3ULE C;  3F3G A;  3EI3 B;  2GC7 A;  1SQJ A;  3I8C A;  2TRC B;  3W15 A;  3IIY A;  4A7J A;  4LG9 A;  5KDO B;  4KFM B;  2AGZ A;  3OKT A;  4N14 A;  1MG3 A;  4BL0 A;  4PC0 A;  4A08 B;  3OKY A;  3EI1 A;  5HE2 B;  1FWX A;  4PNK B;  3UVO A;  3CFV A;  4JSP C;  3JZH A;  4XYH A;  5IGQ A;  5K19 A;  5FKQ A;  3I8E A;  4QL1 A;  2J56 H;  1JOF A;  3AL8 B;  4D6V A;  4J79 A;  1JMZ B;  4LGN A;  4ZOZ A;  5EAR A;  3IJ1 A;  5FKS A;  3NVX A;  5GXI A;  2XYI A;  2HJ4 A;  3CFS B;  4FA4 D;  3L4M D;  4O9D A;  3NVQ A;  3A0F A;  1GXR A;  1N6D A;  3PVW B;  4IA9 A;  5H14 A;  2OK4 A;  2PM9 B;  3J81 g;  4H5J A;  4A0B B;  4U1E I;  5H1M A;  4AOW A;  3NVN A;  2IAA A;  2Z2P A;  3OW8 A;  2YBA A;  2UZY B;  3EI1 B;  5TDH B;  4PBY A;  2YNO A;  1PBY B;  4A11 A;  3BG1 A;  2H3X A;  4O3U B;  5GSA A;  3J80 g;  4J87 A;  2QC5 A;  2AQ5 A;  3I7H A;  2I3S A;  3K26 A;  2IUP A;  2QXV A;  5EM2 B;  1NR0 A;  2Z2O A;  5FQD A;  4A09 B;  3ZWL B;  3PE7 A;  3MXX A;  2P9N C;  5C2V B;  3N0E A;  3UKR C;  4E5Z B;  3JRP A;  4JSV C;  1SQ9 A;  2H68 A;  3SBR A;  2HXC A;  4UI9 R;  3OKY B;  4CY2 A;  4GM8 A;  1MG2 A;  2H14 A;  1U2V C;  4YVD A;  5CXB B;  5IJ8 E;  4JSX C;  3EI2 A;  2GC4 A;  3SN6 B;  1U4C A;  5TF2 A;  2H6K A;  3MZL A;  4FA1 D;  2H9P A;  4CI2 A;  3PSL A;  4X60 B;  3JAM g;  2IWF A;  3I7N A;  3P4F A;  5C2W B;  4TZ4 A;  4R7A B;  4J81 A;  4K3I D;  3SJL D;  2PM6 B;  4D0K A;  2G9A A;  2IWK A;  2CE9 A;  4L1Q D;  2H9M A;  4G56 B;  5EMK B;  3IKO A;  4X61 B;  2H9N A;  2IUV A;  4J0W A;  1ERJ A;  5C9Z B;  3MZK A;  3ORV D;  1PEV A;  4GM3 A;  5HE0 B;  3I7O A;  3F3F A;  2H47 A;  3SXT D;  2PBI B;  3JB9 L;  4A2L A;  4Y7R A;  3RLM D;  2H6N A;  4CZV A;  2OVR B;  3SLE D;  3HFQ A;  2XL2 A;  3C5M A;  3RFG A;  2AGW A;  1B9Y A;  1OMW B;  5B4W A;  3C99 A;  3EWE A;  4PBZ A;  3JPX A;  2H13 A;  4GM9 A;  4NSX A;  3V7D B;  3AL9 A;  5EAP A;  2P9P C;  2B4E A;  4K3J B;  5K1C C;  2UZX B;  5EML B;  3I89 A;  5FKT A;  4X63 B;  1N6E A;  1Q47 A;  4I79 A;  5HE3 B;  3N0D A;  3IJ0 A;  2I0T A;  2MTA H;  4PSW B;  1MDA H;  3VH0 A;  3SBP A;  3MMY A;  2OIZ A;  5GXH A;  4A11 B;  4ERY A;  5EAL A;  2I0S A;  4J73 A;  4EWR A;  3RSE C;  5IJ7 E;  4CI8 A;  5FA5 B;  2P9K C;  2YNP A;  4CC9 A;  1L0Q A;  1JJU B;  5AMS A;  3SMR A;  1VYH C;  2CN2 A;  1N6F A;  4FAV D;  4PSX B;  4ESG A;  3OTT A;  3UVM A;  2H9L A;  3V9F A;  3GRE A;  4X3E A;  3SVW D;  5EM2 A;  1XIP A;  2HJB A;  4GQ2 P;  1A0R B;  5HQG A;  3JRO A;  4FAN D;  4O1Q D;  1JMX B;  3KRW B;  1GP2 B;  2OJY A;  4JSN C;  4Z8L A;  2W18 A;  4GGD A;  3UKU C;  4ZN4 A;  5HE1 B;  2CNX A;  4L3H D;  3EU7 A;  3E0C A;  2XL3 A;  4Y5R D;  4CY3 A;  5CYK A;  5EMJ B;  5I5I A;  3CIK B;  4FA5 D;  3U4Y A;  3C9C A;  3MKS B;  5SXM A;  3SCY A;  4J82 A;  4MK0 B;  4GQ1 A;  3DXK C;  3EI3 A;  3RN1 D;  4CZX A;  3OL2 A;  3DM0 A;  3PSC B;  4OZU A;  2YNN A;  4OWR A;  1PGU A;  4PXW A;  5H17 A;  3VGZ A;  2HES X;  4ERZ A;  2YMU A;  1R5M A;  3EI4 B;  2PM7 B;  4J86 A;  2AGL A;  2BCJ B;  2G99 A;  5THA A;  4O45 A;  3DXM C;  4O3T B;  2HKR A;  4FB1 D;  4AEZ A;  3BWS A;  2OVP B;  4CY1 A;  1TBG A;  3OL2 B;  4E5Z A;  3AL8 A;  1RI6 A;  4GGC A;  3JZG A;  1PI6 A;  3IIW A;  4ZOV A;  4L3G D;  3L4O D;  1YFQ A;  4J8B A;  2J57 G;  3F3P A;  4A2M A;  2I3T A;  1K32 A;  3RRM C;  3VA6 A;  4LG8 A;  4CY5 A;  3C75 H;  3FM0 A;  3BG0 A;  1NEX B;  2B5N A;  3I7K A;  4BH6 A;  2Z2N A;  4H5I A;  4A09 A;  2B5L A;  4A08 A;  4GQB B;  3EG6 A;  3PXT D;  4BUJ C;  3RFH A;  5GMK n;  3UVN A;  5I5J A;  3FRX A;  3V5W B;  5IGO A;  4E54 A;  2I0R A;  4ES0 A;  3RMZ D;  3B7F A;  2AH1 A;  4JT6 C;  2GNQ A;  4FHL A;  2CN3 A;  4IMM A;  2CE8 A;  2XU7 A;  1GG2 B;  4J78 A;  3DSM A;  1SHY B;  3ODT A;  3SHF A;  5TEF A;  1QNI A;  2AGX A;  4XYI A;  1TYQ C;  5A2Q g;  3I7L A;  3DWL C;  4GMB A;  1GOT B;  4L9O A;  4GGA A;  5IT9 g;  4ERQ A;  4QQE A;  2HYE A;  4QRJ A;  2B5M A;  3EI2 B;  2P9S C;  5CXB A;  3PVU B;  3EI4 A;  2OK6 A;  5TEE A;  4CI3 A;  3K27 A;  2YB8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...