3SJLD

Crystal structure of the p107s-maug/pre-methylamine dehydrogenase complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein mauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 95
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sjlD00
1JJUB 3W15A 5JWZA 3JZHA 1PI6A 2HYEA 4GGCA 2OVRB 2XL2A 3SWSD 1S4UX 4N14A 2P9KC 3HFQA 3IKOA 1JMZB 4JT6C 4BUJC 3NVNA 4E54A 3PXSD 2O9KA 4CI2A 5HE0B 4L3GD 3RSEC 2HKMA 3BWSA 3PSCB 3MXXA 4A09A 3C5MA 1N6FA 3L4MD 3F3GA 5C9ZB 2AQ5A 3SXTD 4A08A 4UI9R 4CZVA 2AH1A 3UVMA 2PM9A 3SBQA 4O9DA 3DXMC 2IAAA 3AL8A 5EALA 4J0WA 3VA6A 4J86A 4U7AA 4LG9A 5EM2B 4E5ZA 2IURA 2CO0A 5I5MA 3P4FA 2BCJB 2HXCA 3I7LA 3IJ1A 4Z8LA 5GXHA 4J73A 3IJCA 5HQGA 4ES0A 3OKTA 4YVDA 4G56B 3MKSB 4X61B 4A11A 4ERQA 4GZ8A 3OL2A 3MZKA 4CI3A 3DSMA 3DXKC 5IJ8E 4O1QD 4QRJA 4FA5D 3C75H 4PNKB 1XIPA 4JSPC 1K8KC 2AGXA 3IJ0A 3JAMg 4NSXA 5EMJB 5CYKB 3EI1A 4X60B 5H14A 3C99A 3VGZA 1N6DA 1SHYB 1P22A 5KDOB 2CNXA 4CY2A 3KRXB 5FXYA 2XU7A 4A09B 2I0RA 3SJLD 2G99A 3U4YA 3J80g 3SCYA 1JMXB 5IJ7E 3A0FA 1JOFA 1XHMA 2IWFA 3UR4A 4O45A 4A08B 3EI2A 4FHLA 4L1QD 3UVLA 5EMLB 5IGQA 5SXMA 2PM9B 1B9XA 2OK6A 4PC0A 3AL8B 1K32A 1FWXA 1SQ9A 5FQDA 4E5ZB 2GNQA 3SBPA 1MG2A 5CXCA 2MTAH 3ODTA 4I79A 2H68A 4X63B 3I8EA 3I8CA 4A0AA 2OK4A 2YNNA 3L4OD 4D6VA 2PM6B 2GC7A 4D0KA 4XYIA 3RFHA 1TYQC 4MK0B 4GGAA 4PSXB 3PE7A 2YBAA 2BBKH 5FKTA 3UVKA 4ZN4A 5THAA 2H47A 3N0DA 4FAVD 3BG0A 5FKSA 2OVQB 3GFCA 2QC5A 5GMKn 1QNIA 1YFQA 3ZWLB 5I5IA 3I7OA 3EI4A 5H1MA 3JRPA 3UVOA 1TBGA 2P9UC 2B5LA 2H3XA 3EMHA 3NVQA 2H14A 3OW8A 5B4WA 3RLMD 4J81A 1B9YA 2J57G 1ERJA 3I89A 4H5JA 2AGYA 3IIYA 4FA4D 3I2NA 1PBYB 4PBZA 2IUPA 3UVNA 2QXVA 5HE1B 5EMKB 4H5IA 3MZLA 5IC7A 5TDHB 2YB8B 2OJYA 3EWEA 3SVWD 3MKQA 2HJ4A 3VH0A 4GM3A 5CXCB 4QT8A 3E0CA 3F3FA 2J55H 2H6QA 2P9IC 3OKYA 5EAMA 4GQ2P 2AGZA 4GM9A 4L9OA 4ZOYA 2Z2OA 5EAPA 1SQJA 3V7DB 3CFSB 4QL1A 4A2LA 4O3TB 3I7NA 4GQ1A 4CZXA 2OVPB 1PGUA 2H9LA 3SN6B 3SLED 4A2MA 4JT5C 1OLZA 3SFZA 4J78A 4ZOVA 5C2VB 2XL3A 4FB1D 2I3SA 4GM8A 4E54B 2PBIB 2AGLA 3PXTD 4EWRA 1MG3A 3I7KA 2AGWA 4JSXC 2IUQA 4BH6A 2YMUA 3FGBA 3DM0A 5FA5B 4QQEA 2I0TA 3BG1A 2YNOA 4JD2C 2IWKA 4FWWA 4U1EI 2H6NA 1NR0A 4K3ID 4ESGA 2B5NA 4AOWA 2Z2NA 2P9NC 4IA9A 4GGDA 1GP2B 4JSNC 5EMMB 4A11B 3OL2B 4AEZA 3SHFA 3PVWB 4O3UB 5EM2A 1PEVA 3AH8B 4XYHA 4J84A 3K26A 2H9MA 3C9CA 2H13A 3RFGA 3GREA 5FKRA 5H17A 4CY1A 5HE2B 4A7JA 3ORVD 4CZYA 3EI1B 4PXWA 4GMBA 4ZOZA 4A0BA 2PM7B 4JSVC 4X3EA 3RN0D 5GSAA 3EG6A 4TZ4A 3CIKB 4GQBB 3JROA 3RN1D 4J77A 4XEIC 3SMRA 1A0RB 3B7FA 4J79A 3JB9L 2G9AA 1VYHC 5CYKA 4KFMB 4FAND 3EI2B 4CY5A 2CN3A 2I3TA 3I7HA 4J8BA 4FA9D 2H9PA 3RMZD 3V5WB 3EU7A 3F3PA 3AFCA 3V9FA 5K1CC 4J82A 3N0EA 4A0AB 4OZUA 4J0XA 3NVXA 1U2VC 5IT9g 2IUVA 2UZYB 3SBRA 5EARA 3RRMC 5TEEA 5HE3B 4L3HD 3UKUC 5C2WB 3PSLA 2UZXB 4OWRA 3I7PA 4CC9A 2CN2A 5CXBA 2P9SC 2TRCB 2B4EA 5TEFA 3JZNA 4LGNA 4IMMA 3FRXA 3CFVA 3EI3A 3JZGA 3MMYA 3UKRC 1N6EA 3EI4B 4ZOXA 3KRWB 4A0BB 4ERYA 4R7AB 1GG2B 4BL0A 4JXMA 2YNPA 1GXRA 2HKRA 2W18A 2AH0A 1L0QA 2I0SA 3JPXA 4K3JB 4CI1A 2OIZA 2B5MA 3FM0A 5IGOA 2H6KA 2P9PC 2Q7QA 2HESX 5FLXg 4CI8A 1R5MA 5I5JA 5AMSA 4LG8A 2H9NA 4FA1D 3AL9A 5GXIA 2HJBA 3K27A 4J87A 1NEXB 2J56H 3IIWA 1XKSA 2CO0C 5A2Qg 3OTTA 4PBYA 2XYIA 1MDAH 3OKYB 1RI6A 5AJAA 4ERZA 1GOTB 1U4CA 2CE8A 3J81g 3PVUB 4HDJA 3PXWD 3OKWA 5CXBB 2GC4A 1Q47A 5AFU3 5K19A 5HYNB 3DWLC 3ULEC 4Y5RD 1OMWB 4CY3A 4J8GA 4PSWB 2EBSA 4Y7RA 2CE9A 3EI3B 5TF2A 5FKQA 2Z2PA 2P9LC
chains in the Genus database with same CATH superfamily
1JJUB 5FFOA 3W15A 5JWZA 5M61A 3JZHA 1PI6A 2HYEA 3IURA 2OVRB 4GGCA 2VDRA 2XL2A 3SWSD 1S4UX 4N14A 2P9KC 3HFQA 3IKOA 4G1EA 1JMZB 4JT6C 4BUJC 3NVNA 4E54A 4IRZA 3PXSD 2O9KA 4AN1A 2HU5A 4CI2A 5HE0B 4L3GD 3RSEC 2HKMA 3BWSA 3PSCB 3MXXA 4A09A 3C5MA 1N6FA 3L4MD 3F3GA 5C9ZB 2AQ5A 3MUNA 3SXTD 4UI9R 4A08A 4CZVA 2AH1A 3NIGA 3IUNA 4WK2A 3UVMA 2PM9A 3SBQA 3VI4A 4O9DA 3DXMC 2IAAA 3AL8A 4L1MA 5EALA 4J0WA 3VA6A 4J86A 5M5VA 4U7AA 4LG9A 5EM2B 4E5ZA 2IURA 2CO0A 5I5MA 3P4FA 4JHNA 2BCJB 2HXCA 2HU8A 3I7LA 3IJ1A 4Z8LA 5GXHA 4NENA 2VDKA 3IJCA 4J73A 5HQGA 4ES0A 3OKTA 3O4IA 4YVDA 4G56B 3ZDXA 1K3IA 3MKSB 1JTDB 4X61B 4A11A 4GZ8A 3OL2A 3MZKA 4ERQA 3KCIA 4CI3A 4G55A 3DSMA 3DXKC 5IJ8E 3NIDA 4O1QD 4BCCA 4QRJA 4FA5D 3C75H 4PNKB 1XIPA 1K8KC 2AGXA 3IJ0A 4JSPC 3JAMg 1C9LA 4NSXA 2BKLA 5EMJB 5CYKB 3EI1A 4X60B 5H14A 3C99A 3VGZA 1N6DA 1SHYB 1VE7A 1P22A 2EIDA 2JKXA 5KDOB 2CNXA 4CY2A 2XDWA 3KRXB 5FXYA 2XU7A 4A09B 2I0RA 4UM9A 2G99A 3SJLD 3U4YA 3J80g 4QAMA 3SCYA 1JMXB 5IJ7E 3A0FA 1VZ2A 1JOFA 1XHMA 2IWFA 3IVMA 4O45A 3UR4A 3EI2A 4A08B 4FHLA 4L1QD 3UVLA 5EMLB 5IGQA 1UOOA 5SXMA 2PM9B 3IULA 1B9XA 2OK6A 4PC0A 5M5UA 3AL8B 1K32A 1E5TA 1FWXA 1SQ9A 5FQDA 4E5ZB 1E8MA 2GNQA 1GOHA 1MG2A 5CXCA 3SBPA 1TYEA 2MTAH 3ODTA 4I79A 2H68A 4X63B 3I8EA 3I8CA 4A0AA 3K72A 2OK4A 2YNNA 3L4OD 2VDNA 3QI0A 4D6VA 2PM6B 2GC7A 4D0KA 4XYIA 1H2ZA 1H2XA 1E8NA 4AMZA 3RFHA 1TYQC 4MK0B 4GGAA 4PSXB 3PE7A 2YBAA 1JV2A 2BBKH 5FKTA 3UVKA 4ZN4A 5THAA 2H47A 5E6UA 3N0DA 4FAVD 3BG0A 5FKSA 2OVQB 3GFCA 2QC5A 5GMKn 1QNIA 1YFQA 3ZWLB 5I5IA 3I7OA 3EI4A 3K6SA 3EQ7A 5H1MA 3JRPA 3UVOA 4JHPC 3V4PA 1TBGA 2P9UC 2B5LA 3OF7A 2H3XA 3EMHA 3NVQA 2H14A 3OW8A 5B4WA 3RLMD 3FCSA 4J81A 1B9YA 1H2WA 5M5TA 2J57G 1ERJA 3I89A 4H5JA 3MUOA 2AGYA 4DNUA 3IIYA 4FA4D 3O4GA 2EIBA 3I2NA 1PBYB 4PBZA 4WK0A 2IUPA 3UVNA 2QXVA 5HE1B 5EMKB 4H5IA 3MZLA 5IC7A 5TDHB 2YB8B 2OJYA 3EWEA 3SVWD 3MKQA 2HJ4A 3VH0A 4GM3A 5CXCB 4QT8A 3ZE1A 1UOQA 3E0CA 4BCBA 3F3FA 2J55H 2H6QA 2P9IC 3NIFA 3OKYA 5EAMA 4GQ2P 3T3PA 2AGZA 4GM9A 4L9OA 4ZOYA 2Z2OA 3IJEA 5C92A 5EAPA 1SQJA 3V7DB 3CFSB 4QL1A 4A2LA 4O3TB 3I7NA 4GQ1A 4CZXA 2OVPB 1A12A 1PGUA 2H9LA 3SN6B 1QFSA 3SLED 4A2MA 4JT5C 1OLZA 3IUMA 3SFZA 4J78A 4ZOVA 5C2VB 4NC4A 2XL3A 4FB1D 2I3SA 5FFGA 3ZDZA 4GM8A 4E54B 2PBIB 4AMYA 2AGLA 3PXTD 4EWRA 1MG3A 4DNWA 3I7KA 2AGWA 4JSXC 2IUQA 5HDBA 4BH6A 2YMUA 3FGBA 3DM0A 5FA5B 4QQEA 2I0TA 3BG1A 4BP9A 5C86A 2YNOA 4JD2C 2IWKA 4FWWA 1M1XA 1VE6A 2H6NA 4U1EI 5M5RA 1NR0A 4K3ID 4ESGA 2VZ3A 2B5NA 4AOWA 2Z2NA 2P9NC 4IA9A 4GGDA 1GP2B 4MMZA 3ZE2A 4JSNC 4BCDA 3K71A 5M5SA 3O4HA 2VC2A 4A11B 5EMMB 3OL2B 4AEZA 3SHFA 3PVWB 4O3UB 5EM2A 1C9IA 1PEVA 3AH8B 4XYHA 4J84A 1I2MB 3K26A 2H9MA 3C9CA 2H13A 3RFGA 3GREA 5FKRA 5H17A 4CY1A 5HE2B 4MMXA 4A7JA 3ORVD 1T2XA 4CZYA 3EI1B 1U8CA 4PXWA 4GMBA 4ZOZA 4A0BA 2PM7B 4JSVC 3EQ9A 4X3EA 3RN0D 5GSAA 3EG6A 4TZ4A 3CIKB 4GQBB 3JROA 3RN1D 4J77A 2XZGA 4XEIC 3SMRA 1A0RB 3B7FA 3DDUA 4J79A 4AX4A 3JB9L 1O6FA 1BPOA 1VYHC 2G9AA 5CYKA 4KFMB 2HU7A 4FAND 3EI2B 1GOGA 2VDQA 4CY5A 4D9SA 2CN3A 1O6GA 2I3TA 2WQ8A 4O02A 3IUQA 3I7HA 2QZPA 2EIEA 4J8BA 4FA9D 2H9PA 3RMZD 3V5WB 3ZDYA 3EU7A 3F3PA 3AFCA 3V9FA 5K1CC 4J82A 3N0EA 4A0AB 4OZUA 4J0XA 3NVXA 1L5GA 1U2VC 5IT9g 2IUVA 2UZYB 5E6SA 3SBRA 5EARA 3RRMC 2XE4A 5TEEA 5HE3B 4L3HD 3UKUC 5C2WB 3PSLA 2UZXB 4OWRA 1GOFA 3I7PA 4NBMA 3V4VA 4UM8A 4CC9A 2CN2A 5CXBA 2P9SC 2TRCB 2B4EA 5TEFA 3JZNA 4LGNA 4MMYA 4IMMA 3FRXA 3O4JA 3VI3A 1YR2A 3CFVA 3T3MA 3EI3A 3JZGA 3MMYA 3UKRC 4AN0A 1N6EA 3EI4B 4ZOXA 3KRWB 4A0BB 1VZ3A 4ERYA 4G1MA 4R7AB 1GG2B 4BL0A 4JXMA 2YNPA 1GXRA 2VZ1A 2HKRA 2W18A 2AH0A 1UOPA 1H2YA 1L0QA 2I0SA 3EQ8A 3QHYB 3GD1I 4Z7QA 2EICA 3JPXA 4K3JB 4CI1A 2OIZA 2B5MA 3FM0A 3IUJA 5IGOA 2H6KA 2P9PC 4BP8A 2Q7QA 2HESX 5FLXg 4CI8A 1R5MA 5I5JA 4Z7OA 5AMSA 1UTCA 4LG8A 2H9NA 4FA1D 3AL9A 5GXIA 2HJBA 3K27A 4J87A 1NEXB 2J56H 3IIWA 1XKSA 2CO0C 4O2WA 5A2Qg 3OTTA 4PBYA 2XYIA 1MDAH 3OKYB 1RI6A 3MVDK 5AJAA 4ERZA 4Z7NA 1GOTB 2QR5A 5E6RA 2VDPA 4RE5A 1U4CA 2CE8A 4NAAA 3J81g 3PVUB 3GC3B 4HDJA 2VDOA 3PXWD 4WK4A 3OKWA 5CXBB 2GC4A 1Q47A 5AFU3 5K19A 5HYNB 4WJKA 2VDMA 2VDLA 3ZE0A 3DWLC 3ULEC 4Y5RD 1OMWB 4CY3A 3FCUA 4J8GA 4PSWB 2EBSA 4Y7RA 2CE9A 3EI3B 1QFMA 4RE6A 5TF2A 5FKQA 4DNVA 2Z2PA 2P9LC
chains in the Genus database with same CATH topology
1JJUB 3W15A 5JWZA 3JZHA 1PI6A 2HYEA 4GGCA 2OVRB 2XL2A 3SWSD 1S4UX 4N14A 2P9KC 3HFQA 3IKOA 1JMZB 4JT6C 4BUJC 3NVNA 4E54A 3PXSD 2O9KA 4CI2A 5HE0B 4L3GD 3RSEC 2HKMA 3BWSA 3PSCB 3MXXA 4A09A 3C5MA 1N6FA 3L4MD 3F3GA 5C9ZB 2AQ5A 3SXTD 4A08A 4UI9R 4CZVA 2AH1A 3UVMA 2PM9A 3SBQA 4O9DA 3DXMC 2IAAA 3AL8A 5EALA 4J0WA 3VA6A 4J86A 4U7AA 4LG9A 5EM2B 4E5ZA 2IURA 2CO0A 5I5MA 3P4FA 2BCJB 2HXCA 3I7LA 3IJ1A 4Z8LA 5GXHA 4J73A 3IJCA 5HQGA 4ES0A 3OKTA 4YVDA 4G56B 3MKSB 4X61B 4A11A 4ERQA 4GZ8A 3OL2A 3MZKA 4CI3A 3DSMA 3DXKC 5IJ8E 4O1QD 4QRJA 4FA5D 3C75H 4PNKB 1XIPA 4JSPC 1K8KC 2AGXA 3IJ0A 3JAMg 4NSXA 5EMJB 5CYKB 3EI1A 4X60B 5H14A 3C99A 3VGZA 1N6DA 1SHYB 1P22A 5KDOB 2CNXA 4CY2A 3KRXB 5FXYA 2XU7A 4A09B 2I0RA 3SJLD 2G99A 3U4YA 3J80g 3SCYA 1JMXB 5IJ7E 3A0FA 1JOFA 1XHMA 2IWFA 3UR4A 4O45A 4A08B 3EI2A 4FHLA 4L1QD 3UVLA 5EMLB 5IGQA 5SXMA 2PM9B 1B9XA 2OK6A 4PC0A 3AL8B 1K32A 1FWXA 1SQ9A 5FQDA 4E5ZB 2GNQA 3SBPA 1MG2A 5CXCA 2MTAH 3ODTA 4I79A 2H68A 4X63B 3I8EA 3I8CA 4A0AA 2OK4A 2YNNA 3L4OD 4D6VA 2PM6B 2GC7A 4D0KA 4XYIA 3RFHA 1TYQC 4MK0B 4GGAA 4PSXB 3PE7A 2YBAA 2BBKH 5FKTA 3UVKA 4ZN4A 5THAA 2H47A 3N0DA 4FAVD 3BG0A 5FKSA 2OVQB 3GFCA 2QC5A 5GMKn 1QNIA 1YFQA 3ZWLB 5I5IA 3I7OA 3EI4A 5H1MA 3JRPA 3UVOA 1TBGA 2P9UC 2B5LA 2H3XA 3EMHA 3NVQA 2H14A 3OW8A 5B4WA 3RLMD 4J81A 1B9YA 2J57G 1ERJA 3I89A 4H5JA 2AGYA 3IIYA 4FA4D 3I2NA 1PBYB 4PBZA 2IUPA 3UVNA 2QXVA 5HE1B 5EMKB 4H5IA 3MZLA 5IC7A 5TDHB 2YB8B 2OJYA 3EWEA 3SVWD 3MKQA 2HJ4A 3VH0A 4GM3A 5CXCB 4QT8A 3E0CA 3F3FA 2J55H 2H6QA 2P9IC 3OKYA 5EAMA 4GQ2P 2AGZA 4GM9A 4L9OA 4ZOYA 2Z2OA 5EAPA 1SQJA 3V7DB 3CFSB 4QL1A 4A2LA 4O3TB 3I7NA 4GQ1A 4CZXA 2OVPB 1PGUA 2H9LA 3SN6B 3SLED 4A2MA 4JT5C 1OLZA 3SFZA 4J78A 4ZOVA 5C2VB 2XL3A 4FB1D 2I3SA 4GM8A 4E54B 2PBIB 2AGLA 3PXTD 4EWRA 1MG3A 3I7KA 2AGWA 4JSXC 2IUQA 4BH6A 2YMUA 3FGBA 3DM0A 5FA5B 4QQEA 2I0TA 3BG1A 2YNOA 4JD2C 2IWKA 4FWWA 4U1EI 2H6NA 1NR0A 4K3ID 4ESGA 2B5NA 4AOWA 2Z2NA 2P9NC 4IA9A 4GGDA 1GP2B 4JSNC 5EMMB 4A11B 3OL2B 4AEZA 3SHFA 3PVWB 4O3UB 5EM2A 1PEVA 3AH8B 4XYHA 4J84A 3K26A 2H9MA 3C9CA 2H13A 3RFGA 3GREA 5FKRA 5H17A 4CY1A 5HE2B 4A7JA 3ORVD 4CZYA 3EI1B 4PXWA 4GMBA 4ZOZA 4A0BA 2PM7B 4JSVC 4X3EA 3RN0D 5GSAA 3EG6A 4TZ4A 3CIKB 4GQBB 3JROA 3RN1D 4J77A 4XEIC 3SMRA 1A0RB 3B7FA 4J79A 3JB9L 2G9AA 1VYHC 5CYKA 4KFMB 4FAND 3EI2B 4CY5A 2CN3A 2I3TA 3I7HA 4J8BA 4FA9D 2H9PA 3RMZD 3V5WB 3EU7A 3F3PA 3AFCA 3V9FA 5K1CC 4J82A 3N0EA 4A0AB 4OZUA 4J0XA 3NVXA 1U2VC 5IT9g 2IUVA 2UZYB 3SBRA 5EARA 3RRMC 5TEEA 5HE3B 4L3HD 3UKUC 5C2WB 3PSLA 2UZXB 4OWRA 3I7PA 4CC9A 2CN2A 5CXBA 2P9SC 2TRCB 2B4EA 5TEFA 3JZNA 4LGNA 4IMMA 3FRXA 3CFVA 3EI3A 3JZGA 3MMYA 3UKRC 1N6EA 3EI4B 4ZOXA 3KRWB 4A0BB 4ERYA 4R7AB 1GG2B 4BL0A 4JXMA 2YNPA 1GXRA 2HKRA 2W18A 2AH0A 1L0QA 2I0SA 3JPXA 4K3JB 4CI1A 2OIZA 2B5MA 3FM0A 5IGOA 2H6KA 2P9PC 2Q7QA 2HESX 5FLXg 4CI8A 1R5MA 5I5JA 5AMSA 4LG8A 2H9NA 4FA1D 3AL9A 5GXIA 2HJBA 3K27A 4J87A 1NEXB 2J56H 3IIWA 1XKSA 2CO0C 5A2Qg 3OTTA 4PBYA 2XYIA 1MDAH 3OKYB 1RI6A 5AJAA 4ERZA 1GOTB 1U4CA 2CE8A 3J81g 3PVUB 4HDJA 3PXWD 3OKWA 5CXBB 2GC4A 1Q47A 5AFU3 5K19A 5HYNB 3DWLC 3ULEC 4Y5RD 1OMWB 4CY3A 4J8GA 4PSWB 2EBSA 4Y7RA 2CE9A 3EI3B 5TF2A 5FKQA 2Z2PA 2P9LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJU B;  3W15 A;  5JWZ A;  3JZH A;  1PI6 A;  2HYE A;  4GGC A;  2OVR B;  2XL2 A;  3SWS D;  1S4U X;  4N14 A;  2P9K C;  3HFQ A;  3IKO A;  1JMZ B;  4JT6 C;  4BUJ C;  3NVN A;  4E54 A;  3PXS D;  2O9K A;  4CI2 A;  5HE0 B;  4L3G D;  3RSE C;  2HKM A;  3BWS A;  3PSC B;  3MXX A;  4A09 A;  3C5M A;  1N6F A;  3L4M D;  3F3G A;  5C9Z B;  2AQ5 A;  3SXT D;  4A08 A;  4UI9 R;  4CZV A;  2AH1 A;  3UVM A;  2PM9 A;  3SBQ A;  4O9D A;  3DXM C;  2IAA A;  3AL8 A;  5EAL A;  4J0W A;  3VA6 A;  4J86 A;  4U7A A;  4LG9 A;  5EM2 B;  4E5Z A;  2IUR A;  2CO0 A;  5I5M A;  3P4F A;  2BCJ B;  2HXC A;  3I7L A;  3IJ1 A;  4Z8L A;  5GXH A;  4J73 A;  3IJC A;  5HQG A;  4ES0 A;  3OKT A;  4YVD A;  4G56 B;  3MKS B;  4X61 B;  4A11 A;  4ERQ A;  4GZ8 A;  3OL2 A;  3MZK A;  4CI3 A;  3DSM A;  3DXK C;  5IJ8 E;  4O1Q D;  4QRJ A;  4FA5 D;  3C75 H;  4PNK B;  1XIP A;  4JSP C;  1K8K C;  2AGX A;  3IJ0 A;  3JAM g;  4NSX A;  5EMJ B;  5CYK B;  3EI1 A;  4X60 B;  5H14 A;  3C99 A;  3VGZ A;  1N6D A;  1SHY B;  1P22 A;  5KDO B;  2CNX A;  4CY2 A;  3KRX B;  5FXY A;  2XU7 A;  4A09 B;  2I0R A;  3SJL D;  2G99 A;  3U4Y A;  3J80 g;  3SCY A;  1JMX B;  5IJ7 E;  3A0F A;  1JOF A;  1XHM A;  2IWF A;  3UR4 A;  4O45 A;  4A08 B;  3EI2 A;  4FHL A;  4L1Q D;  3UVL A;  5EML B;  5IGQ A;  5SXM A;  2PM9 B;  1B9X A;  2OK6 A;  4PC0 A;  3AL8 B;  1K32 A;  1FWX A;  1SQ9 A;  5FQD A;  4E5Z B;  2GNQ A;  3SBP A;  1MG2 A;  5CXC A;  2MTA H;  3ODT A;  4I79 A;  2H68 A;  4X63 B;  3I8E A;  3I8C A;  4A0A A;  2OK4 A;  2YNN A;  3L4O D;  4D6V A;  2PM6 B;  2GC7 A;  4D0K A;  4XYI A;  3RFH A;  1TYQ C;  4MK0 B;  4GGA A;  4PSX B;  3PE7 A;  2YBA A;  2BBK H;  5FKT A;  3UVK A;  4ZN4 A;  5THA A;  2H47 A;  3N0D A;  4FAV D;  3BG0 A;  5FKS A;  2OVQ B;  3GFC A;  2QC5 A;  5GMK n;  1QNI A;  1YFQ A;  3ZWL B;  5I5I A;  3I7O A;  3EI4 A;  5H1M A;  3JRP A;  3UVO A;  1TBG A;  2P9U C;  2B5L A;  2H3X A;  3EMH A;  3NVQ A;  2H14 A;  3OW8 A;  5B4W A;  3RLM D;  4J81 A;  1B9Y A;  2J57 G;  1ERJ A;  3I89 A;  4H5J A;  2AGY A;  3IIY A;  4FA4 D;  3I2N A;  1PBY B;  4PBZ A;  2IUP A;  3UVN A;  2QXV A;  5HE1 B;  5EMK B;  4H5I A;  3MZL A;  5IC7 A;  5TDH B;  2YB8 B;  2OJY A;  3EWE A;  3SVW D;  3MKQ A;  2HJ4 A;  3VH0 A;  4GM3 A;  5CXC B;  4QT8 A;  3E0C A;  3F3F A;  2J55 H;  2H6Q A;  2P9I C;  3OKY A;  5EAM A;  4GQ2 P;  2AGZ A;  4GM9 A;  4L9O A;  4ZOY A;  2Z2O A;  5EAP A;  1SQJ A;  3V7D B;  3CFS B;  4QL1 A;  4A2L A;  4O3T B;  3I7N A;  4GQ1 A;  4CZX A;  2OVP B;  1PGU A;  2H9L A;  3SN6 B;  3SLE D;  4A2M A;  4JT5 C;  1OLZ A;  3SFZ A;  4J78 A;  4ZOV A;  5C2V B;  2XL3 A;  4FB1 D;  2I3S A;  4GM8 A;  4E54 B;  2PBI B;  2AGL A;  3PXT D;  4EWR A;  1MG3 A;  3I7K A;  2AGW A;  4JSX C;  2IUQ A;  4BH6 A;  2YMU A;  3FGB A;  3DM0 A;  5FA5 B;  4QQE A;  2I0T A;  3BG1 A;  2YNO A;  4JD2 C;  2IWK A;  4FWW A;  4U1E I;  2H6N A;  1NR0 A;  4K3I D;  4ESG A;  2B5N A;  4AOW A;  2Z2N A;  2P9N C;  4IA9 A;  4GGD A;  1GP2 B;  4JSN C;  5EMM B;  4A11 B;  3OL2 B;  4AEZ A;  3SHF A;  3PVW B;  4O3U B;  5EM2 A;  1PEV A;  3AH8 B;  4XYH A;  4J84 A;  3K26 A;  2H9M A;  3C9C A;  2H13 A;  3RFG A;  3GRE A;  5FKR A;  5H17 A;  4CY1 A;  5HE2 B;  4A7J A;  3ORV D;  4CZY A;  3EI1 B;  4PXW A;  4GMB A;  4ZOZ A;  4A0B A;  2PM7 B;  4JSV C;  4X3E A;  3RN0 D;  5GSA A;  3EG6 A;  4TZ4 A;  3CIK B;  4GQB B;  3JRO A;  3RN1 D;  4J77 A;  4XEI C;  3SMR A;  1A0R B;  3B7F A;  4J79 A;  3JB9 L;  2G9A A;  1VYH C;  5CYK A;  4KFM B;  4FAN D;  3EI2 B;  4CY5 A;  2CN3 A;  2I3T A;  3I7H A;  4J8B A;  4FA9 D;  2H9P A;  3RMZ D;  3V5W B;  3EU7 A;  3F3P A;  3AFC A;  3V9F A;  5K1C C;  4J82 A;  3N0E A;  4A0A B;  4OZU A;  4J0X A;  3NVX A;  1U2V C;  5IT9 g;  2IUV A;  2UZY B;  3SBR A;  5EAR A;  3RRM C;  5TEE A;  5HE3 B;  4L3H D;  3UKU C;  5C2W B;  3PSL A;  2UZX B;  4OWR A;  3I7P A;  4CC9 A;  2CN2 A;  5CXB A;  2P9S C;  2TRC B;  2B4E A;  5TEF A;  3JZN A;  4LGN A;  4IMM A;  3FRX A;  3CFV A;  3EI3 A;  3JZG A;  3MMY A;  3UKR C;  1N6E A;  3EI4 B;  4ZOX A;  3KRW B;  4A0B B;  4ERY A;  4R7A B;  1GG2 B;  4BL0 A;  4JXM A;  2YNP A;  1GXR A;  2HKR A;  2W18 A;  2AH0 A;  1L0Q A;  2I0S A;  3JPX A;  4K3J B;  4CI1 A;  2OIZ A;  2B5M A;  3FM0 A;  5IGO A;  2H6K A;  2P9P C;  2Q7Q A;  2HES X;  5FLX g;  4CI8 A;  1R5M A;  5I5J A;  5AMS A;  4LG8 A;  2H9N A;  4FA1 D;  3AL9 A;  5GXI A;  2HJB A;  3K27 A;  4J87 A;  1NEX B;  2J56 H;  3IIW A;  1XKS A;  2CO0 C;  5A2Q g;  3OTT A;  4PBY A;  2XYI A;  1MDA H;  3OKY B;  1RI6 A;  5AJA A;  4ERZ A;  1GOT B;  1U4C A;  2CE8 A;  3J81 g;  3PVU B;  4HDJ A;  3PXW D;  3OKW A;  5CXB B;  2GC4 A;  1Q47 A;  5AFU 3;  5K19 A;  5HYN B;  3DWL C;  3ULE C;  4Y5R D;  1OMW B;  4CY3 A;  4J8G A;  4PSW B;  2EBS A;  4Y7R A;  2CE9 A;  3EI3 B;  5TF2 A;  5FKQ A;  2Z2P A;  2P9L C; 
#chains in the Genus database with same CATH topology
 1JJU B;  5FFO A;  3W15 A;  5JWZ A;  5M61 A;  3JZH A;  1PI6 A;  2HYE A;  3IUR A;  2OVR B;  4GGC A;  2VDR A;  2XL2 A;  3SWS D;  1S4U X;  4N14 A;  2P9K C;  3HFQ A;  3IKO A;  4G1E A;  1JMZ B;  4JT6 C;  4BUJ C;  3NVN A;  4E54 A;  4IRZ A;  3PXS D;  2O9K A;  4AN1 A;  2HU5 A;  4CI2 A;  5HE0 B;  4L3G D;  3RSE C;  2HKM A;  3BWS A;  3PSC B;  3MXX A;  4A09 A;  3C5M A;  1N6F A;  3L4M D;  3F3G A;  5C9Z B;  2AQ5 A;  3MUN A;  3SXT D;  4UI9 R;  4A08 A;  4CZV A;  2AH1 A;  3NIG A;  3IUN A;  4WK2 A;  3UVM A;  2PM9 A;  3SBQ A;  3VI4 A;  4O9D A;  3DXM C;  2IAA A;  3AL8 A;  4L1M A;  5EAL A;  4J0W A;  3VA6 A;  4J86 A;  5M5V A;  4U7A A;  4LG9 A;  5EM2 B;  4E5Z A;  2IUR A;  2CO0 A;  5I5M A;  3P4F A;  4JHN A;  2BCJ B;  2HXC A;  2HU8 A;  3I7L A;  3IJ1 A;  4Z8L A;  5GXH A;  4NEN A;  2VDK A;  3IJC A;  4J73 A;  5HQG A;  4ES0 A;  3OKT A;  3O4I A;  4YVD A;  4G56 B;  3ZDX A;  1K3I A;  3MKS B;  1JTD B;  4X61 B;  4A11 A;  4GZ8 A;  3OL2 A;  3MZK A;  4ERQ A;  3KCI A;  4CI3 A;  4G55 A;  3DSM A;  3DXK C;  5IJ8 E;  3NID A;  4O1Q D;  4BCC A;  4QRJ A;  4FA5 D;  3C75 H;  4PNK B;  1XIP A;  1K8K C;  2AGX A;  3IJ0 A;  4JSP C;  3JAM g;  1C9L A;  4NSX A;  2BKL A;  5EMJ B;  5CYK B;  3EI1 A;  4X60 B;  5H14 A;  3C99 A;  3VGZ A;  1N6D A;  1SHY B;  1VE7 A;  1P22 A;  2EID A;  2JKX A;  5KDO B;  2CNX A;  4CY2 A;  2XDW A;  3KRX B;  5FXY A;  2XU7 A;  4A09 B;  2I0R A;  4UM9 A;  2G99 A;  3SJL D;  3U4Y A;  3J80 g;  4QAM A;  3SCY A;  1JMX B;  5IJ7 E;  3A0F A;  1VZ2 A;  1JOF A;  1XHM A;  2IWF A;  3IVM A;  4O45 A;  3UR4 A;  3EI2 A;  4A08 B;  4FHL A;  4L1Q D;  3UVL A;  5EML B;  5IGQ A;  1UOO A;  5SXM A;  2PM9 B;  3IUL A;  1B9X A;  2OK6 A;  4PC0 A;  5M5U A;  3AL8 B;  1K32 A;  1E5T A;  1FWX A;  1SQ9 A;  5FQD A;  4E5Z B;  1E8M A;  2GNQ A;  1GOH A;  1MG2 A;  5CXC A;  3SBP A;  1TYE A;  2MTA H;  3ODT A;  4I79 A;  2H68 A;  4X63 B;  3I8E A;  3I8C A;  4A0A A;  3K72 A;  2OK4 A;  2YNN A;  3L4O D;  2VDN A;  3QI0 A;  4D6V A;  2PM6 B;  2GC7 A;  4D0K A;  4XYI A;  1H2Z A;  1H2X A;  1E8N A;  4AMZ A;  3RFH A;  1TYQ C;  4MK0 B;  4GGA A;  4PSX B;  3PE7 A;  2YBA A;  1JV2 A;  2BBK H;  5FKT A;  3UVK A;  4ZN4 A;  5THA A;  2H47 A;  5E6U A;  3N0D A;  4FAV D;  3BG0 A;  5FKS A;  2OVQ B;  3GFC A;  2QC5 A;  5GMK n;  1QNI A;  1YFQ A;  3ZWL B;  5I5I A;  3I7O A;  3EI4 A;  3K6S A;  3EQ7 A;  5H1M A;  3JRP A;  3UVO A;  4JHP C;  3V4P A;  1TBG A;  2P9U C;  2B5L A;  3OF7 A;  2H3X A;  3EMH A;  3NVQ A;  2H14 A;  3OW8 A;  5B4W A;  3RLM D;  3FCS A;  4J81 A;  1B9Y A;  1H2W A;  5M5T A;  2J57 G;  1ERJ A;  3I89 A;  4H5J A;  3MUO A;  2AGY A;  4DNU A;  3IIY A;  4FA4 D;  3O4G A;  2EIB A;  3I2N A;  1PBY B;  4PBZ A;  4WK0 A;  2IUP A;  3UVN A;  2QXV A;  5HE1 B;  5EMK B;  4H5I A;  3MZL A;  5IC7 A;  5TDH B;  2YB8 B;  2OJY A;  3EWE A;  3SVW D;  3MKQ A;  2HJ4 A;  3VH0 A;  4GM3 A;  5CXC B;  4QT8 A;  3ZE1 A;  1UOQ A;  3E0C A;  4BCB A;  3F3F A;  2J55 H;  2H6Q A;  2P9I C;  3NIF A;  3OKY A;  5EAM A;  4GQ2 P;  3T3P A;  2AGZ A;  4GM9 A;  4L9O A;  4ZOY A;  2Z2O A;  3IJE A;  5C92 A;  5EAP A;  1SQJ A;  3V7D B;  3CFS B;  4QL1 A;  4A2L A;  4O3T B;  3I7N A;  4GQ1 A;  4CZX A;  2OVP B;  1A12 A;  1PGU A;  2H9L A;  3SN6 B;  1QFS A;  3SLE D;  4A2M A;  4JT5 C;  1OLZ A;  3IUM A;  3SFZ A;  4J78 A;  4ZOV A;  5C2V B;  4NC4 A;  2XL3 A;  4FB1 D;  2I3S A;  5FFG A;  3ZDZ A;  4GM8 A;  4E54 B;  2PBI B;  4AMY A;  2AGL A;  3PXT D;  4EWR A;  1MG3 A;  4DNW A;  3I7K A;  2AGW A;  4JSX C;  2IUQ A;  5HDB A;  4BH6 A;  2YMU A;  3FGB A;  3DM0 A;  5FA5 B;  4QQE A;  2I0T A;  3BG1 A;  4BP9 A;  5C86 A;  2YNO A;  4JD2 C;  2IWK A;  4FWW A;  1M1X A;  1VE6 A;  2H6N A;  4U1E I;  5M5R A;  1NR0 A;  4K3I D;  4ESG A;  2VZ3 A;  2B5N A;  4AOW A;  2Z2N A;  2P9N C;  4IA9 A;  4GGD A;  1GP2 B;  4MMZ A;  3ZE2 A;  4JSN C;  4BCD A;  3K71 A;  5M5S A;  3O4H A;  2VC2 A;  4A11 B;  5EMM B;  3OL2 B;  4AEZ A;  3SHF A;  3PVW B;  4O3U B;  5EM2 A;  1C9I A;  1PEV A;  3AH8 B;  4XYH A;  4J84 A;  1I2M B;  3K26 A;  2H9M A;  3C9C A;  2H13 A;  3RFG A;  3GRE A;  5FKR A;  5H17 A;  4CY1 A;  5HE2 B;  4MMX A;  4A7J A;  3ORV D;  1T2X A;  4CZY A;  3EI1 B;  1U8C A;  4PXW A;  4GMB A;  4ZOZ A;  4A0B A;  2PM7 B;  4JSV C;  3EQ9 A;  4X3E A;  3RN0 D;  5GSA A;  3EG6 A;  4TZ4 A;  3CIK B;  4GQB B;  3JRO A;  3RN1 D;  4J77 A;  2XZG A;  4XEI C;  3SMR A;  1A0R B;  3B7F A;  3DDU A;  4J79 A;  4AX4 A;  3JB9 L;  1O6F A;  1BPO A;  1VYH C;  2G9A A;  5CYK A;  4KFM B;  2HU7 A;  4FAN D;  3EI2 B;  1GOG A;  2VDQ A;  4CY5 A;  4D9S A;  2CN3 A;  1O6G A;  2I3T A;  2WQ8 A;  4O02 A;  3IUQ A;  3I7H A;  2QZP A;  2EIE A;  4J8B A;  4FA9 D;  2H9P A;  3RMZ D;  3V5W B;  3ZDY A;  3EU7 A;  3F3P A;  3AFC A;  3V9F A;  5K1C C;  4J82 A;  3N0E A;  4A0A B;  4OZU A;  4J0X A;  3NVX A;  1L5G A;  1U2V C;  5IT9 g;  2IUV A;  2UZY B;  5E6S A;  3SBR A;  5EAR A;  3RRM C;  2XE4 A;  5TEE A;  5HE3 B;  4L3H D;  3UKU C;  5C2W B;  3PSL A;  2UZX B;  4OWR A;  1GOF A;  3I7P A;  4NBM A;  3V4V A;  4UM8 A;  4CC9 A;  2CN2 A;  5CXB A;  2P9S C;  2TRC B;  2B4E A;  5TEF A;  3JZN A;  4LGN A;  4MMY A;  4IMM A;  3FRX A;  3O4J A;  3VI3 A;  1YR2 A;  3CFV A;  3T3M A;  3EI3 A;  3JZG A;  3MMY A;  3UKR C;  4AN0 A;  1N6E A;  3EI4 B;  4ZOX A;  3KRW B;  4A0B B;  1VZ3 A;  4ERY A;  4G1M A;  4R7A B;  1GG2 B;  4BL0 A;  4JXM A;  2YNP A;  1GXR A;  2VZ1 A;  2HKR A;  2W18 A;  2AH0 A;  1UOP A;  1H2Y A;  1L0Q A;  2I0S A;  3EQ8 A;  3QHY B;  3GD1 I;  4Z7Q A;  2EIC A;  3JPX A;  4K3J B;  4CI1 A;  2OIZ A;  2B5M A;  3FM0 A;  3IUJ A;  5IGO A;  2H6K A;  2P9P C;  4BP8 A;  2Q7Q A;  2HES X;  5FLX g;  4CI8 A;  1R5M A;  5I5J A;  4Z7O A;  5AMS A;  1UTC A;  4LG8 A;  2H9N A;  4FA1 D;  3AL9 A;  5GXI A;  2HJB A;  3K27 A;  4J87 A;  1NEX B;  2J56 H;  3IIW A;  1XKS A;  2CO0 C;  4O2W A;  5A2Q g;  3OTT A;  4PBY A;  2XYI A;  1MDA H;  3OKY B;  1RI6 A;  3MVD K;  5AJA A;  4ERZ A;  4Z7N A;  1GOT B;  2QR5 A;  5E6R A;  2VDP A;  4RE5 A;  1U4C A;  2CE8 A;  4NAA A;  3J81 g;  3PVU B;  3GC3 B;  4HDJ A;  2VDO A;  3PXW D;  4WK4 A;  3OKW A;  5CXB B;  2GC4 A;  1Q47 A;  5AFU 3;  5K19 A;  5HYN B;  4WJK A;  2VDM A;  2VDL A;  3ZE0 A;  3DWL C;  3ULE C;  4Y5R D;  1OMW B;  4CY3 A;  3FCU A;  4J8G A;  4PSW B;  2EBS A;  4Y7R A;  2CE9 A;  3EI3 B;  1QFM A;  4RE6 A;  5TF2 A;  5FKQ A;  4DNV A;  2Z2P A;  2P9L C; 
#chains in the Genus database with same CATH homology
 1JJU B;  3W15 A;  5JWZ A;  3JZH A;  1PI6 A;  2HYE A;  4GGC A;  2OVR B;  2XL2 A;  3SWS D;  1S4U X;  4N14 A;  2P9K C;  3HFQ A;  3IKO A;  1JMZ B;  4JT6 C;  4BUJ C;  3NVN A;  4E54 A;  3PXS D;  2O9K A;  4CI2 A;  5HE0 B;  4L3G D;  3RSE C;  2HKM A;  3BWS A;  3PSC B;  3MXX A;  4A09 A;  3C5M A;  1N6F A;  3L4M D;  3F3G A;  5C9Z B;  2AQ5 A;  3SXT D;  4A08 A;  4UI9 R;  4CZV A;  2AH1 A;  3UVM A;  2PM9 A;  3SBQ A;  4O9D A;  3DXM C;  2IAA A;  3AL8 A;  5EAL A;  4J0W A;  3VA6 A;  4J86 A;  4U7A A;  4LG9 A;  5EM2 B;  4E5Z A;  2IUR A;  2CO0 A;  5I5M A;  3P4F A;  2BCJ B;  2HXC A;  3I7L A;  3IJ1 A;  4Z8L A;  5GXH A;  4J73 A;  3IJC A;  5HQG A;  4ES0 A;  3OKT A;  4YVD A;  4G56 B;  3MKS B;  4X61 B;  4A11 A;  4ERQ A;  4GZ8 A;  3OL2 A;  3MZK A;  4CI3 A;  3DSM A;  3DXK C;  5IJ8 E;  4O1Q D;  4QRJ A;  4FA5 D;  3C75 H;  4PNK B;  1XIP A;  4JSP C;  1K8K C;  2AGX A;  3IJ0 A;  3JAM g;  4NSX A;  5EMJ B;  5CYK B;  3EI1 A;  4X60 B;  5H14 A;  3C99 A;  3VGZ A;  1N6D A;  1SHY B;  1P22 A;  5KDO B;  2CNX A;  4CY2 A;  3KRX B;  5FXY A;  2XU7 A;  4A09 B;  2I0R A;  3SJL D;  2G99 A;  3U4Y A;  3J80 g;  3SCY A;  1JMX B;  5IJ7 E;  3A0F A;  1JOF A;  1XHM A;  2IWF A;  3UR4 A;  4O45 A;  4A08 B;  3EI2 A;  4FHL A;  4L1Q D;  3UVL A;  5EML B;  5IGQ A;  5SXM A;  2PM9 B;  1B9X A;  2OK6 A;  4PC0 A;  3AL8 B;  1K32 A;  1FWX A;  1SQ9 A;  5FQD A;  4E5Z B;  2GNQ A;  3SBP A;  1MG2 A;  5CXC A;  2MTA H;  3ODT A;  4I79 A;  2H68 A;  4X63 B;  3I8E A;  3I8C A;  4A0A A;  2OK4 A;  2YNN A;  3L4O D;  4D6V A;  2PM6 B;  2GC7 A;  4D0K A;  4XYI A;  3RFH A;  1TYQ C;  4MK0 B;  4GGA A;  4PSX B;  3PE7 A;  2YBA A;  2BBK H;  5FKT A;  3UVK A;  4ZN4 A;  5THA A;  2H47 A;  3N0D A;  4FAV D;  3BG0 A;  5FKS A;  2OVQ B;  3GFC A;  2QC5 A;  5GMK n;  1QNI A;  1YFQ A;  3ZWL B;  5I5I A;  3I7O A;  3EI4 A;  5H1M A;  3JRP A;  3UVO A;  1TBG A;  2P9U C;  2B5L A;  2H3X A;  3EMH A;  3NVQ A;  2H14 A;  3OW8 A;  5B4W A;  3RLM D;  4J81 A;  1B9Y A;  2J57 G;  1ERJ A;  3I89 A;  4H5J A;  2AGY A;  3IIY A;  4FA4 D;  3I2N A;  1PBY B;  4PBZ A;  2IUP A;  3UVN A;  2QXV A;  5HE1 B;  5EMK B;  4H5I A;  3MZL A;  5IC7 A;  5TDH B;  2YB8 B;  2OJY A;  3EWE A;  3SVW D;  3MKQ A;  2HJ4 A;  3VH0 A;  4GM3 A;  5CXC B;  4QT8 A;  3E0C A;  3F3F A;  2J55 H;  2H6Q A;  2P9I C;  3OKY A;  5EAM A;  4GQ2 P;  2AGZ A;  4GM9 A;  4L9O A;  4ZOY A;  2Z2O A;  5EAP A;  1SQJ A;  3V7D B;  3CFS B;  4QL1 A;  4A2L A;  4O3T B;  3I7N A;  4GQ1 A;  4CZX A;  2OVP B;  1PGU A;  2H9L A;  3SN6 B;  3SLE D;  4A2M A;  4JT5 C;  1OLZ A;  3SFZ A;  4J78 A;  4ZOV A;  5C2V B;  2XL3 A;  4FB1 D;  2I3S A;  4GM8 A;  4E54 B;  2PBI B;  2AGL A;  3PXT D;  4EWR A;  1MG3 A;  3I7K A;  2AGW A;  4JSX C;  2IUQ A;  4BH6 A;  2YMU A;  3FGB A;  3DM0 A;  5FA5 B;  4QQE A;  2I0T A;  3BG1 A;  2YNO A;  4JD2 C;  2IWK A;  4FWW A;  4U1E I;  2H6N A;  1NR0 A;  4K3I D;  4ESG A;  2B5N A;  4AOW A;  2Z2N A;  2P9N C;  4IA9 A;  4GGD A;  1GP2 B;  4JSN C;  5EMM B;  4A11 B;  3OL2 B;  4AEZ A;  3SHF A;  3PVW B;  4O3U B;  5EM2 A;  1PEV A;  3AH8 B;  4XYH A;  4J84 A;  3K26 A;  2H9M A;  3C9C A;  2H13 A;  3RFG A;  3GRE A;  5FKR A;  5H17 A;  4CY1 A;  5HE2 B;  4A7J A;  3ORV D;  4CZY A;  3EI1 B;  4PXW A;  4GMB A;  4ZOZ A;  4A0B A;  2PM7 B;  4JSV C;  4X3E A;  3RN0 D;  5GSA A;  3EG6 A;  4TZ4 A;  3CIK B;  4GQB B;  3JRO A;  3RN1 D;  4J77 A;  4XEI C;  3SMR A;  1A0R B;  3B7F A;  4J79 A;  3JB9 L;  2G9A A;  1VYH C;  5CYK A;  4KFM B;  4FAN D;  3EI2 B;  4CY5 A;  2CN3 A;  2I3T A;  3I7H A;  4J8B A;  4FA9 D;  2H9P A;  3RMZ D;  3V5W B;  3EU7 A;  3F3P A;  3AFC A;  3V9F A;  5K1C C;  4J82 A;  3N0E A;  4A0A B;  4OZU A;  4J0X A;  3NVX A;  1U2V C;  5IT9 g;  2IUV A;  2UZY B;  3SBR A;  5EAR A;  3RRM C;  5TEE A;  5HE3 B;  4L3H D;  3UKU C;  5C2W B;  3PSL A;  2UZX B;  4OWR A;  3I7P A;  4CC9 A;  2CN2 A;  5CXB A;  2P9S C;  2TRC B;  2B4E A;  5TEF A;  3JZN A;  4LGN A;  4IMM A;  3FRX A;  3CFV A;  3EI3 A;  3JZG A;  3MMY A;  3UKR C;  1N6E A;  3EI4 B;  4ZOX A;  3KRW B;  4A0B B;  4ERY A;  4R7A B;  1GG2 B;  4BL0 A;  4JXM A;  2YNP A;  1GXR A;  2HKR A;  2W18 A;  2AH0 A;  1L0Q A;  2I0S A;  3JPX A;  4K3J B;  4CI1 A;  2OIZ A;  2B5M A;  3FM0 A;  5IGO A;  2H6K A;  2P9P C;  2Q7Q A;  2HES X;  5FLX g;  4CI8 A;  1R5M A;  5I5J A;  5AMS A;  4LG8 A;  2H9N A;  4FA1 D;  3AL9 A;  5GXI A;  2HJB A;  3K27 A;  4J87 A;  1NEX B;  2J56 H;  3IIW A;  1XKS A;  2CO0 C;  5A2Q g;  3OTT A;  4PBY A;  2XYI A;  1MDA H;  3OKY B;  1RI6 A;  5AJA A;  4ERZ A;  1GOT B;  1U4C A;  2CE8 A;  3J81 g;  3PVU B;  4HDJ A;  3PXW D;  3OKW A;  5CXB B;  2GC4 A;  1Q47 A;  5AFU 3;  5K19 A;  5HYN B;  3DWL C;  3ULE C;  4Y5R D;  1OMW B;  4CY3 A;  4J8G A;  4PSW B;  2EBS A;  4Y7R A;  2CE9 A;  3EI3 B;  5TF2 A;  5FKQ A;  2Z2P A;  2P9L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...