2VDRA

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, lggakqrgdv
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 108
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdrA00
1JV2A 4MMYA 3K6SA 1U8CA 1TYEA 2VDOA 3FCSA 2VDRA 1M1XA 3FCUA 4WK4A 3NIDA 1L5GA 4WK0A 3V4VA 2VDLA 5E6SA 3T3MA 3VI3A 2VC2A 4G1MA 3ZE1A 3ZE2A 3ZDZA 3VI4A 2VDMA 4UM8A 3ZDXA 3NIGA 3K72A 4Z7OA 5E6UA 4UM9A 4Z7QA 4O02A 3NIFA 4MMXA 5FFGA 2VDKA 5HDBA 4G1EA 3T3PA 2VDNA 5FFOA 3IJEA 4MMZA 4NENA 2VDPA 3ZDYA 2VDQA 3ZE0A 4IRZA 4WJKA 4WK2A 3K71A 5E6RA 4Z7NA 3V4PA
chains in the Genus database with same CATH superfamily
1B9YA 3IJ1A 2OVQB 5CXBB 3OL2B 2YNPA 4QQEA 5EMJB 3AH8B 1SHYB 1TBGA 2MTAH 2XU7A 4U7AA 1GOTB 4FB1D 1E8MA 2H9PA 1C9IA 4PNKB 4O02A 2H9LA 2VDKA 3SVWD 2OK6A 4GM3A 1PEVA 2EIBA 4L1MA 3ZDYA 1K8KC 2HJ4A 3F3GA 1OMWB 1O6FA 2I3SA 4K3JB 4ERZA 4ZOYA 3V4PA 2AGLA 4FWWA 4D9SA 3FCSA 3I7KA 1SQ9A 2I0RA 3IUNA 4L1QD 2HU5A 4LGNA 2VC2A 5EM2B 3BG1A 4XYHA 5IGQA 2J56H 4CY2A 1JOFA 4NAAA 4QL1A 2CN3A 4D0KA 3OTTA 5IJ8E 3QI0A 3EI1B 3NVXA 3ODTA 4N14A 4E5ZA 3DM0A 4CI2A 3HFQA 3I7HA 2PBIB 4CI8A 1H2ZA 5GSAA 3O4HA 3IUMA 4IMMA 3OL2A 2G9AA 4BCBA 4J86A 3DXKC 1I2MB 4U1EI 2VZ3A 2I0TA 1QFMA 3P4FA 1FWXA 2EICA 2IUPA 2XL2A 4XYIA 3BWSA 3GREA 4JSVC 3UVNA 5HDBA 4CC9A 4GMBA 5JWZA 1QFSA 5M5RA 4PBYA 4A08B 2QR5A 1K32A 3OKYB 4TZ4A 4A2LA 4A11A 4J82A 3OKTA 5C9ZB 3I8EA 5EMMB 3JZGA 5HE1B 3JZHA 5EM2A 2P9UC 2XZGA 3FCUA 3PXWD 4CI3A 4GZ8A 1VYHC 1XIPA 4O2WA 3RSEC 4J81A 5H17A 3A0FA 3K72A 5C2VB 3IURA 2H9MA 3NIFA 5AFU3 5EALA 2G99A 2H6NA 4BCCA 4FA1D 1UOQA 4JSPC 4J0WA 4Y7RA 5FKRA 3SJLD 2B5NA 4WJKA 5GXHA 5CYKB 4FAND 3K27A 4J8GA 2J57G 3O4IA 2P9IC 2VDLA 4H5JA 3IIYA 4G55A 1U4CA 3PSCB 3RFHA 3ZDZA 3ZDXA 4PSXB 5FXYA 3CFSB 2BKLA 4J78A 4ZOVA 4JD2C 3OKYA 5C92A 4Z8LA 2CN2A 3MUNA 2CE9A 2OIZA 1MG2A 5M5VA 5C2WB 3N0DA 1H2WA 1GXRA 1JMXB 4E54A 4QAMA 1JV2A 4DNVA 1L0QA 5EAPA 3I8CA 4J87A 3DWLC 1XKSA 3SWSD 3MZLA 1N6DA 2UZYB 3JROA 3E0CA 1N6EA 2H9NA 3SN6B 4CY1A 3ZE2A 3K26A 1GOHA 1BPOA 3SBQA 3EI4B 4GGDA 5FKSA 2B5MA 1PGUA 3OW8A 4HDJA 4D6VA 4ZN4A 2VDPA 4FHLA 3N0EA 5I5IA 4QRJA 4EWRA 4H5IA 4IRZA 3IIWA 1GG2B 1OLZA 1VE6A 2Z2NA 3RRMC 4DNWA 4CZVA 3J81g 1A12A 4MK0B 2VDRA 4FA5D 3V4VA 1MG3A 4BUJC 4CY5A 4ESGA 5E6SA 3T3MA 2P9SC 3IJ0A 4BH6A 3PSLA 2H68A 1QNIA 2YB8B 4PBZA 2CO0A 3UKUC 3VA6A 3RMZD 4A0AA 5THAA 5FLXg 4AN1A 5M5SA 3EQ7A 3AL8B 3EI2B 1GOFA 4BP9A 3W15A 2H14A 5KDOB 3NVNA 1Q47A 1U8CA 2TRCB 3CIKB 4UI9R 3SCYA 2J55H 4I79A 5CXBA 3KCIA 4FA4D 5M61A 3EMHA 2UZXB 3NIDA 3I7PA 3ZWLB 5EMLB 5FKTA 2AGYA 3ZE1A 4BL0A 1UTCA 2YMUA 4ERYA 3I2NA 3I7LA 4Z7OA 5HE3B 5TF2A 4L3GD 4O3TB 4G1EA 5I5MA 2OVPB 3FGBA 3IJEA 1ERJA 2VDQA 4JSXC 1A0RB 1NEXB 3F3FA 3NVQA 2PM6B 4O1QD 2OJYA 3VGZA 3C99A 3IVMA 2HESX 3IULA 2BBKH 4J79A 1T2XA 2GNQA 1O6GA 3GD1I 2Z2OA 4A09B 2H6KA 5B4WA 1XHMA 5HE0B 4X61B 4UM9A 5CXCB 3EI1A 2I0SA 5FFOA 4ES0A 3UKRC 5FA5B 4NENA 2HU8A 3FM0A 3EQ9A 2AGZA 3KRXB 4LG9A 3SFZA 4WK2A 4OWRA 4Z7NA 4XEIC 5M5UA 5EARA 3OKWA 1UOPA 4X63B 3ORVD 3EWEA 1M1XA 4J73A 4ZOZA 3OF7A 2XE4A 1TYQC 3C75H 3SXTD 4J77A 3O4JA 3SLED 4NC4A 3SMRA 1YFQA 2HXCA 4CZYA 4JT5C 5E6UA 1VZ2A 5IJ7E 2GC7A 3MUOA 3EI3B 4GQ1A 4A08A 4NBMA 1VZ3A 5IGOA 1R5MA 5SXMA 3MMYA 5HQGA 3IJCA 4A09A 4FA9D 3L4MD 1PI6A 4AMZA 3JAMg 4GM9A 2CO0C 5HE2B 1P22A 3L4OD 3VI4A 2VDMA 2P9PC 1K3IA 4MMXA 5FFGA 4X3EA 2AGXA 2HKRA 2VDNA 2YNNA 3AL9A 4J84A 2H6QA 4MMZA 1H2YA 4JXMA 1GOGA 1U2VC 4LG8A 5CYKA 5I5JA 4GQ2P 5H14A 1C9LA 1VE7A 4E5ZB 3JRPA 4AOWA 5FQDA 3DDUA 5FKQA 2HKMA 3AFCA 3K6SA 3MZKA 5K19A 2H3XA 3V9FA 3JPXA 2IUVA 4X60B 2HYEA 2XL3A 2IWFA 4QT8A 3VI3A 2EIEA 5AJAA 3QHYB 3I7NA 3GC3B 3EI3A 3PVWB 4A0BB 2AH0A 3V7DB 3IKOA 4PC0A 2XDWA 3UVKA 3MKQA 1H2XA 2Z2PA 3B7FA 2P9KC 3KRWB 3ZE0A 1UOOA 5IT9g 1S4UX 2O9KA 4CY3A 5C86A 5TEFA 2YNOA 1TYEA 4A11B 3EU7A 3SBRA 2VZ1A 4BP8A 4DNUA 2XYIA 3FRXA 4IA9A 3EI4A 2H47A 3PXSD 3V5WB 3PVUB 3EQ8A 4AX4A 4CI1A 4KFMB 4NSXA 1E8NA 2QXVA 4L3HD 4A2MA 4GGAA 3T3PA 2I3TA 3ULEC 5GXIA 1JMZB 2WQ8A 4AN0A 3MVDK 4JHPC 4BCDA 4OZUA 3K71A 3RN0D 2P9LC 4O45A 4J0XA 2PM9B 4JSNC 3JB9L 2GC4A 3SBPA 4MMYA 2BCJB 1MDAH 2JKXA 3EG6A 5HYNB 4Y5RD 1SQJA 4ZOXA 3DSMA 5TDHB 4A0BA 2EBSA 3IUJA 5EMKB 1RI6A 4K3ID 4UM8A 2IUQA 2CE8A 3NIGA 4GQBB 3JZNA 1JJUB 2W18A 3UVOA 3AL8A 1E5TA 4J8BA 2IWKA 3RN1D 5M5TA 3EI2A 3IUQA 3UR4A 2B5LA 3GFCA 2P9NC 2QC5A 3VH0A 5TEEA 3SHFA 2OK4A 5E6RA 3J80g 2YBAA 3MKSB 4YVDA 4O9DA 4JHNA 1NR0A 4E54B 1PBYB 2Q7QA 4WK4A 2HU7A 5A2Qg 1JTDB 3RLMD 4G1MA 2PM7B 4AMYA 2AGWA 2HJBA 3F3PA 3U4YA 2IAAA 2AH1A 1N6FA 4RE6A 4ERQA 1YR2A 2OVRB 3PXTD 4G56B 2PM9A 4GGCA 2AQ5A 3PE7A 4A7JA 2B4EA 2EIDA 4RE5A 3I89A 2IURA 4GM8A 3BG0A 1B9XA 2VDOA 3MXXA 5GMKn 2QZPA 4WK0A 1L5GA 4PXWA 4CZXA 4R7AB 2CNXA 3UVLA 3UVMA 3CFVA 4PSWB 5CXCA 3C5MA 3RFGA 5H1MA 1GP2B 2H13A 3C9CA 5EAMA 4Z7QA 4FAVD 3DXMC 3O4GA 5IC7A 4JT6C 4A0AB 5AMSA 4L9OA 3I7OA 5K1CC 4AEZA 4O3UB
chains in the Genus database with same CATH topology
1JV2A 4MMYA 3K6SA 1U8CA 1TYEA 2VDOA 3FCSA 2VDRA 1M1XA 3FCUA 4WK4A 3NIDA 1L5GA 4WK0A 3V4VA 2VDLA 5E6SA 3T3MA 3VI3A 2VC2A 4G1MA 3ZE1A 3ZE2A 3ZDZA 3VI4A 2VDMA 4UM8A 3ZDXA 3NIGA 3K72A 4Z7OA 5E6UA 4UM9A 4Z7QA 4O02A 3NIFA 4MMXA 5FFGA 2VDKA 5HDBA 4G1EA 3T3PA 2VDNA 5FFOA 3IJEA 4MMZA 4NENA 2VDPA 3ZDYA 2VDQA 3ZE0A 4IRZA 4WJKA 4WK2A 3K71A 5E6RA 4Z7NA 3V4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JV2 A;  4MMY A;  3K6S A;  1U8C A;  1TYE A;  2VDO A;  3FCS A;  2VDR A;  1M1X A;  3FCU A;  4WK4 A;  3NID A;  1L5G A;  4WK0 A;  3V4V A;  2VDL A;  5E6S A;  3T3M A;  3VI3 A;  2VC2 A;  4G1M A;  3ZE1 A;  3ZE2 A;  3ZDZ A;  3VI4 A;  2VDM A;  4UM8 A;  3ZDX A;  3NIG A;  3K72 A;  4Z7O A;  5E6U A;  4UM9 A;  4Z7Q A;  4O02 A;  3NIF A;  4MMX A;  5FFG A;  2VDK A;  5HDB A;  4G1E A;  3T3P A;  2VDN A;  5FFO A;  3IJE A;  4MMZ A;  4NEN A;  2VDP A;  3ZDY A;  2VDQ A;  3ZE0 A;  4IRZ A;  4WJK A;  4WK2 A;  3K71 A;  5E6R A;  4Z7N A;  3V4P A; 
#chains in the Genus database with same CATH topology
 1B9Y A;  3IJ1 A;  2OVQ B;  5CXB B;  3OL2 B;  2YNP A;  4QQE A;  5EMJ B;  3AH8 B;  1SHY B;  1TBG A;  2MTA H;  2XU7 A;  4U7A A;  1GOT B;  4FB1 D;  1E8M A;  2H9P A;  1C9I A;  4PNK B;  4O02 A;  2H9L A;  2VDK A;  3SVW D;  2OK6 A;  4GM3 A;  1PEV A;  2EIB A;  4L1M A;  3ZDY A;  1K8K C;  2HJ4 A;  3F3G A;  1OMW B;  1O6F A;  2I3S A;  4K3J B;  4ERZ A;  4ZOY A;  3V4P A;  2AGL A;  4FWW A;  4D9S A;  3FCS A;  3I7K A;  1SQ9 A;  2I0R A;  3IUN A;  4L1Q D;  2HU5 A;  4LGN A;  2VC2 A;  5EM2 B;  3BG1 A;  4XYH A;  5IGQ A;  2J56 H;  4CY2 A;  1JOF A;  4NAA A;  4QL1 A;  2CN3 A;  4D0K A;  3OTT A;  5IJ8 E;  3QI0 A;  3EI1 B;  3NVX A;  3ODT A;  4N14 A;  4E5Z A;  3DM0 A;  4CI2 A;  3HFQ A;  3I7H A;  2PBI B;  4CI8 A;  1H2Z A;  5GSA A;  3O4H A;  3IUM A;  4IMM A;  3OL2 A;  2G9A A;  4BCB A;  4J86 A;  3DXK C;  1I2M B;  4U1E I;  2VZ3 A;  2I0T A;  1QFM A;  3P4F A;  1FWX A;  2EIC A;  2IUP A;  2XL2 A;  4XYI A;  3BWS A;  3GRE A;  4JSV C;  3UVN A;  5HDB A;  4CC9 A;  4GMB A;  5JWZ A;  1QFS A;  5M5R A;  4PBY A;  4A08 B;  2QR5 A;  1K32 A;  3OKY B;  4TZ4 A;  4A2L A;  4A11 A;  4J82 A;  3OKT A;  5C9Z B;  3I8E A;  5EMM B;  3JZG A;  5HE1 B;  3JZH A;  5EM2 A;  2P9U C;  2XZG A;  3FCU A;  3PXW D;  4CI3 A;  4GZ8 A;  1VYH C;  1XIP A;  4O2W A;  3RSE C;  4J81 A;  5H17 A;  3A0F A;  3K72 A;  5C2V B;  3IUR A;  2H9M A;  3NIF A;  5AFU 3;  5EAL A;  2G99 A;  2H6N A;  4BCC A;  4FA1 D;  1UOQ A;  4JSP C;  4J0W A;  4Y7R A;  5FKR A;  3SJL D;  2B5N A;  4WJK A;  5GXH A;  5CYK B;  4FAN D;  3K27 A;  4J8G A;  2J57 G;  3O4I A;  2P9I C;  2VDL A;  4H5J A;  3IIY A;  4G55 A;  1U4C A;  3PSC B;  3RFH A;  3ZDZ A;  3ZDX A;  4PSX B;  5FXY A;  3CFS B;  2BKL A;  4J78 A;  4ZOV A;  4JD2 C;  3OKY A;  5C92 A;  4Z8L A;  2CN2 A;  3MUN A;  2CE9 A;  2OIZ A;  1MG2 A;  5M5V A;  5C2W B;  3N0D A;  1H2W A;  1GXR A;  1JMX B;  4E54 A;  4QAM A;  1JV2 A;  4DNV A;  1L0Q A;  5EAP A;  3I8C A;  4J87 A;  3DWL C;  1XKS A;  3SWS D;  3MZL A;  1N6D A;  2UZY B;  3JRO A;  3E0C A;  1N6E A;  2H9N A;  3SN6 B;  4CY1 A;  3ZE2 A;  3K26 A;  1GOH A;  1BPO A;  3SBQ A;  3EI4 B;  4GGD A;  5FKS A;  2B5M A;  1PGU A;  3OW8 A;  4HDJ A;  4D6V A;  4ZN4 A;  2VDP A;  4FHL A;  3N0E A;  5I5I A;  4QRJ A;  4EWR A;  4H5I A;  4IRZ A;  3IIW A;  1GG2 B;  1OLZ A;  1VE6 A;  2Z2N A;  3RRM C;  4DNW A;  4CZV A;  3J81 g;  1A12 A;  4MK0 B;  2VDR A;  4FA5 D;  3V4V A;  1MG3 A;  4BUJ C;  4CY5 A;  4ESG A;  5E6S A;  3T3M A;  2P9S C;  3IJ0 A;  4BH6 A;  3PSL A;  2H68 A;  1QNI A;  2YB8 B;  4PBZ A;  2CO0 A;  3UKU C;  3VA6 A;  3RMZ D;  4A0A A;  5THA A;  5FLX g;  4AN1 A;  5M5S A;  3EQ7 A;  3AL8 B;  3EI2 B;  1GOF A;  4BP9 A;  3W15 A;  2H14 A;  5KDO B;  3NVN A;  1Q47 A;  1U8C A;  2TRC B;  3CIK B;  4UI9 R;  3SCY A;  2J55 H;  4I79 A;  5CXB A;  3KCI A;  4FA4 D;  5M61 A;  3EMH A;  2UZX B;  3NID A;  3I7P A;  3ZWL B;  5EML B;  5FKT A;  2AGY A;  3ZE1 A;  4BL0 A;  1UTC A;  2YMU A;  4ERY A;  3I2N A;  3I7L A;  4Z7O A;  5HE3 B;  5TF2 A;  4L3G D;  4O3T B;  4G1E A;  5I5M A;  2OVP B;  3FGB A;  3IJE A;  1ERJ A;  2VDQ A;  4JSX C;  1A0R B;  1NEX B;  3F3F A;  3NVQ A;  2PM6 B;  4O1Q D;  2OJY A;  3VGZ A;  3C99 A;  3IVM A;  2HES X;  3IUL A;  2BBK H;  4J79 A;  1T2X A;  2GNQ A;  1O6G A;  3GD1 I;  2Z2O A;  4A09 B;  2H6K A;  5B4W A;  1XHM A;  5HE0 B;  4X61 B;  4UM9 A;  5CXC B;  3EI1 A;  2I0S A;  5FFO A;  4ES0 A;  3UKR C;  5FA5 B;  4NEN A;  2HU8 A;  3FM0 A;  3EQ9 A;  2AGZ A;  3KRX B;  4LG9 A;  3SFZ A;  4WK2 A;  4OWR A;  4Z7N A;  4XEI C;  5M5U A;  5EAR A;  3OKW A;  1UOP A;  4X63 B;  3ORV D;  3EWE A;  1M1X A;  4J73 A;  4ZOZ A;  3OF7 A;  2XE4 A;  1TYQ C;  3C75 H;  3SXT D;  4J77 A;  3O4J A;  3SLE D;  4NC4 A;  3SMR A;  1YFQ A;  2HXC A;  4CZY A;  4JT5 C;  5E6U A;  1VZ2 A;  5IJ7 E;  2GC7 A;  3MUO A;  3EI3 B;  4GQ1 A;  4A08 A;  4NBM A;  1VZ3 A;  5IGO A;  1R5M A;  5SXM A;  3MMY A;  5HQG A;  3IJC A;  4A09 A;  4FA9 D;  3L4M D;  1PI6 A;  4AMZ A;  3JAM g;  4GM9 A;  2CO0 C;  5HE2 B;  1P22 A;  3L4O D;  3VI4 A;  2VDM A;  2P9P C;  1K3I A;  4MMX A;  5FFG A;  4X3E A;  2AGX A;  2HKR A;  2VDN A;  2YNN A;  3AL9 A;  4J84 A;  2H6Q A;  4MMZ A;  1H2Y A;  4JXM A;  1GOG A;  1U2V C;  4LG8 A;  5CYK A;  5I5J A;  4GQ2 P;  5H14 A;  1C9L A;  1VE7 A;  4E5Z B;  3JRP A;  4AOW A;  5FQD A;  3DDU A;  5FKQ A;  2HKM A;  3AFC A;  3K6S A;  3MZK A;  5K19 A;  2H3X A;  3V9F A;  3JPX A;  2IUV A;  4X60 B;  2HYE A;  2XL3 A;  2IWF A;  4QT8 A;  3VI3 A;  2EIE A;  5AJA A;  3QHY B;  3I7N A;  3GC3 B;  3EI3 A;  3PVW B;  4A0B B;  2AH0 A;  3V7D B;  3IKO A;  4PC0 A;  2XDW A;  3UVK A;  3MKQ A;  1H2X A;  2Z2P A;  3B7F A;  2P9K C;  3KRW B;  3ZE0 A;  1UOO A;  5IT9 g;  1S4U X;  2O9K A;  4CY3 A;  5C86 A;  5TEF A;  2YNO A;  1TYE A;  4A11 B;  3EU7 A;  3SBR A;  2VZ1 A;  4BP8 A;  4DNU A;  2XYI A;  3FRX A;  4IA9 A;  3EI4 A;  2H47 A;  3PXS D;  3V5W B;  3PVU B;  3EQ8 A;  4AX4 A;  4CI1 A;  4KFM B;  4NSX A;  1E8N A;  2QXV A;  4L3H D;  4A2M A;  4GGA A;  3T3P A;  2I3T A;  3ULE C;  5GXI A;  1JMZ B;  2WQ8 A;  4AN0 A;  3MVD K;  4JHP C;  4BCD A;  4OZU A;  3K71 A;  3RN0 D;  2P9L C;  4O45 A;  4J0X A;  2PM9 B;  4JSN C;  3JB9 L;  2GC4 A;  3SBP A;  4MMY A;  2BCJ B;  1MDA H;  2JKX A;  3EG6 A;  5HYN B;  4Y5R D;  1SQJ A;  4ZOX A;  3DSM A;  5TDH B;  4A0B A;  2EBS A;  3IUJ A;  5EMK B;  1RI6 A;  4K3I D;  4UM8 A;  2IUQ A;  2CE8 A;  3NIG A;  4GQB B;  3JZN A;  1JJU B;  2W18 A;  3UVO A;  3AL8 A;  1E5T A;  4J8B A;  2IWK A;  3RN1 D;  5M5T A;  3EI2 A;  3IUQ A;  3UR4 A;  2B5L A;  3GFC A;  2P9N C;  2QC5 A;  3VH0 A;  5TEE A;  3SHF A;  2OK4 A;  5E6R A;  3J80 g;  2YBA A;  3MKS B;  4YVD A;  4O9D A;  4JHN A;  1NR0 A;  4E54 B;  1PBY B;  2Q7Q A;  4WK4 A;  2HU7 A;  5A2Q g;  1JTD B;  3RLM D;  4G1M A;  2PM7 B;  4AMY A;  2AGW A;  2HJB A;  3F3P A;  3U4Y A;  2IAA A;  2AH1 A;  1N6F A;  4RE6 A;  4ERQ A;  1YR2 A;  2OVR B;  3PXT D;  4G56 B;  2PM9 A;  4GGC A;  2AQ5 A;  3PE7 A;  4A7J A;  2B4E A;  2EID A;  4RE5 A;  3I89 A;  2IUR A;  4GM8 A;  3BG0 A;  1B9X A;  2VDO A;  3MXX A;  5GMK n;  2QZP A;  4WK0 A;  1L5G A;  4PXW A;  4CZX A;  4R7A B;  2CNX A;  3UVL A;  3UVM A;  3CFV A;  4PSW B;  5CXC A;  3C5M A;  3RFG A;  5H1M A;  1GP2 B;  2H13 A;  3C9C A;  5EAM A;  4Z7Q A;  4FAV D;  3DXM C;  3O4G A;  5IC7 A;  4JT6 C;  4A0A B;  5AMS A;  4L9O A;  3I7O A;  5K1C C;  4AEZ A;  4O3U B; 
#chains in the Genus database with same CATH homology
 1JV2 A;  4MMY A;  3K6S A;  1U8C A;  1TYE A;  2VDO A;  3FCS A;  2VDR A;  1M1X A;  3FCU A;  4WK4 A;  3NID A;  1L5G A;  4WK0 A;  3V4V A;  2VDL A;  5E6S A;  3T3M A;  3VI3 A;  2VC2 A;  4G1M A;  3ZE1 A;  3ZE2 A;  3ZDZ A;  3VI4 A;  2VDM A;  4UM8 A;  3ZDX A;  3NIG A;  3K72 A;  4Z7O A;  5E6U A;  4UM9 A;  4Z7Q A;  4O02 A;  3NIF A;  4MMX A;  5FFG A;  2VDK A;  5HDB A;  4G1E A;  3T3P A;  2VDN A;  5FFO A;  3IJE A;  4MMZ A;  4NEN A;  2VDP A;  3ZDY A;  2VDQ A;  3ZE0 A;  4IRZ A;  4WJK A;  4WK2 A;  3K71 A;  5E6R A;  4Z7N A;  3V4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...