2VDRA

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, lggakqrgdv
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdrA00
4UM8A 2VDMA 5E6UA 5FFGA 3ZDZA 4Z7OA 5E6SA 2VDRA 3K71A 3K6SA 4WK0A 1TYEA 1M1XA 2VDLA 3ZDYA 3ZE1A 3IJEA 5E6RA 3K72A 3VI4A 3V4PA 3ZE2A 4Z7NA 4MMZA 4Z7QA 1JV2A 3T3MA 3ZDXA 1L5GA 2VDQA 4WK4A 4WK2A 3FCSA 3V4VA 4MMYA 4G1EA 3NIFA 1U8CA 4G1MA 4O02A 3T3PA 5HDBA 4UM9A 3VI3A 4NENA 4MMXA 5FFOA 4IRZA 3ZE0A 3NIGA 4WJKA 2VDPA 3FCUA 2VDNA 2VDKA 3NIDA 2VC2A 2VDOA
chains in the Genus database with same CATH superfamily
3EWEA 5M5TA 4DNWA 1MG3A 2J55H 4AX4A 1M1XA 4K3JB 3ZDYA 2OVQB 3GREA 5FA5B 1P22A 2AGXA 4BCCA 4Y7RA 4AEZA 4AMZA 4JHPC 2AGLA 3EMHA 5HDBA 1N6DA 4FA9D 4NBMA 3U4YA 1VZ2A 3KRXB 4FAND 2EIDA 3PXSD 4GMBA 4CI8A 5EMJB 5EM2B 2HJ4A 3PVWB 2Z2OA 4A11A 3ZDZA 1B9YA 5EMLB 2Q7QA 3OKYA 3I7KA 5FLXg 1YFQA 4NAAA 2YMUA 4L1QD 2H9LA 5CXCA 4O2WA 3JAMg 4J84A 2I3SA 2YNOA 2P9KC 3SMRA 5HQGA 4N14A 4G1MA 4H5JA 5C9ZB 2IUQA 4ZOXA 3SN6B 2PM9B 1S4UX 4A7JA 3EQ7A 4O45A 2VDOA 3IURA 2OK4A 3P4FA 3PXWD 3K6SA 5HE1B 3KRWB 2H3XA 3W15A 3IIYA 1JTDB 3MUOA 3DWLC 3RRMC 3JROA 4Z7NA 3IVMA 4G1EA 3QHYB 5I5JA 3F3FA 5FXYA 5HE0B 3CFVA 3IUJA 3NVQA 4AMYA 3EI1B 4GGDA 1H2YA 5KDOB 1T2XA 3FCUA 5IGOA 3K26A 5A2Qg 1FWXA 3SCYA 2AGWA 2PM6B 2HJBA 4X61B 4RE6A 5M5RA 1I2MB 2XDWA 3RMZD 1NR0A 1C9IA 1VE7A 4JSVC 1MG2A 4E54B 2IURA 1XIPA 5M5UA 4A0AB 2XL2A 2OIZA 4X63B 5EARA 3RN1D 1BPOA 3UVMA 5C2VB 3IULA 2IUPA 2CN2A 4WK2A 4U7AA 5HE2B 4PSWB 3BG1A 3UVOA 4FWWA 3DXMC 4CY3A 3MUNA 4FB1D 3V9FA 3PSCB 4NENA 3SVWD 1VE6A 4PBYA 2QC5A 2EIEA 2Z2NA 4IRZA 4X3EA 2AGYA 3AL8B 2I0TA 2PBIB 3B7FA 1GOHA 3VA6A 4ZOVA 2EICA 5SXMA 5IJ7E 1PBYB 4GQ2P 4E5ZB 4GZ8A 2CO0C 4JHNA 5K19A 4DNVA 3V4PA 4A0BA 4O3TB 3RN0D 3EI4A 3T3MA 4BUJC 1UOOA 3IUNA 4Y5RD 3NVNA 3OL2B 4CY2A 3HFQA 2IWKA 3JB9L 4R7AB 1R5MA 4LG9A 2H9NA 1QFSA 4CZYA 3MKQA 1UTCA 4QQEA 3SJLD 1B9XA 1NEXB 4O9DA 5FFGA 1OLZA 4PSXB 1JJUB 1GXRA 4CI1A 2I3TA 3SXTD 1TYEA 2XZGA 3I7LA 2B5NA 3JZNA 3MZLA 2TRCB 3ORVD 4MMZA 1UOQA 2H13A 2HYEA 3AH8B 4AN1A 5AJAA 3E0CA 3I8EA 2P9IC 3F3GA 4XYHA 1MDAH 5GXIA 4JSPC 4ZOZA 1PEVA 5FKSA 5TEEA 3EU7A 4UI9R 3NIDA 3GFCA 2VC2A 2CE8A 2I0RA 2OJYA 3O4IA 3EI3B 3UR4A 1K8KC 4CY5A 3CIKB 4XYIA 3SFZA 5EM2A 2CO0A 3BWSA 2BCJB 2J57G 4YVDA 1H2XA 1JV2A 1L5GA 4KFMB 5IGQA 5B4WA 1SQ9A 4CZVA 4FA4D 5IT9g 2XL3A 3MKSB 4J77A 2H9MA 2WQ8A 5TEFA 3F3PA 1Q47A 3OTTA 4J87A 3IJCA 3OW8A 3OF7A 4LGNA 2P9SC 1A0RB 2PM9A 2EIBA 1GOFA 5CXBB 1L0QA 3BG0A 2IWFA 4QT8A 4ERYA 4PC0A 4GM8A 3EQ9A 4PXWA 2BBKH 3UVNA 2H6NA 4ERQA 2H14A 2AQ5A 1XKSA 3IJ0A 1U8CA 3ULEC 4H5IA 3IUMA 3A0FA 1U4CA 4PNKB 4GM3A 3C5MA 5THAA 2YB8B 3FM0A 2AGZA 2GC7A 4PBZA 5IC7A 2HXCA 3EI1A 5IJ8E 2XYIA 4GGCA 5EMMB 3ZE1A 2H68A 2CNXA 3IJEA 3JPXA 4J81A 4ZOYA 4X60B 3DM0A 3ZDXA 4D0KA 3J81g 3IUQA 4E54A 4CZXA 4A0AA 1A12A 2YBAA 4OWRA 4O3UB 3VH0A 2XE4A 3N0DA 2HU7A 4BP8A 2VDMA 2B5MA 4ES0A 4HDJA 4UM8A 4IA9A 4FA1D 5C92A 1N6FA 4Z7OA 5H14A 3K27A 1JOFA 3EI2B 3AL8A 2QR5A 1PGUA 3SLED 5FKRA 3VGZA 1GP2B 5E6RA 4E5ZA 4L1MA 3FCSA 3QI0A 2QXVA 5FKTA 2B5LA 3NVXA 5JWZA 2OVRB 3NIFA 2B4EA 5AFU3 1XHMA 4NSXA 4O1QD 3OL2A 4BP9A 4J73A 3MZKA 4A09B 1K3IA 1E5TA 3C75H 5TF2A 4JD2C 4FA5D 4D9SA 2G9AA 2HESX 3ZWLB 3J80g 2H9PA 1E8NA 1GOGA 3I7OA 5FKQA 4J79A 3OKTA 2MTAH 3KCIA 5EMKB 4Z7QA 2EBSA 4MK0B 4JT6C 3DDUA 4WK4A 2UZXB 4TZ4A 5CYKB 3FRXA 4A08B 3AL9A 5CYKA 3OKWA 1C9LA 3ZE0A 2BKLA 3NIGA 4GM9A 5I5IA 4NC4A 5EAPA 2HKRA 1GG2B 5AMSA 5HYNB 2VDRA 4A2LA 4CI3A 2JKXA 4LG8A 4G56B 1E8MA 1SQJA 3EI3A 3VI4A 2IUVA 1UOPA 2OK6A 4IMMA 2GC4A 1JMZB 2HKMA 3AFCA 2H6QA 3I7NA 4U1EI 1VYHC 4A11B 2CE9A 3EG6A 3O4JA 1O6FA 2VDPA 2QZPA 5TDHB 3ODTA 3OKYB 2P9NC 5HE3B 2YNNA 4J8BA 5CXCB 5E6UA 5I5MA 2G99A 3JZGA 1SHYB 2VZ1A 2PM7B 3SWSD 3PSLA 3DSMA 2XU7A 2IAAA 4D6VA 2VDLA 5C86A 3C99A 1OMWB 4ERZA 4JSNC 5CXBA 1K32A 2CN3A 1ERJA 2VDQA 3V7DB 3UKRC 3I7HA 4I79A 4AN0A 5GSAA 2YNPA 3RFGA 3CFSB 2VZ3A 4BH6A 5M61A 4CC9A 1H2ZA 3UVKA 4Z8LA 3I2NA 4MMXA 4G55A 5EAMA 3O4HA 2VDKA 1RI6A 2J56H 3RSEC 4QAMA 3RFHA 3PXTD 4AOWA 1YR2A 4EWRA 3I7PA 3K71A 3GC3B 3L4OD 4BCDA 2HU5A 3UKUC 3K72A 4J82A 4J8GA 5M5VA 2P9PC 3N0EA 3IJ1A 4L9OA 3SBRA 1O6GA 2O9KA 5C2WB 4QL1A 4O02A 2GNQA 3EQ8A 3MXXA 4UM9A 4K3ID 2Z2PA 4J86A 5H1MA 3L4MD 1JMXB 2VDNA 5K1CC 2UZYB 4CI2A 4JSXC 4FAVD 3IIWA 1TYQC 3PE7A 2AH1A 4XEIC 2I0SA 3V5WB 3MVDK 1U2VC 4L3GD 2H6KA 2AH0A 4BCBA 4RE5A 3ZE2A 2P9LC 3MMYA 3SHFA 3EI2A 2W18A 3IKOA 3GD1I 3O4GA 4L3HD 1N6EA 2OVPB 3T3PA 3VI3A 4J0WA 4QRJA 5FFOA 4JXMA 2HU8A 4FHLA 5H17A 4GQ1A 4WJKA 1H2WA 5EALA 4OZUA 4J0XA 3C9CA 4BL0A 4CY1A 3PVUB 2P9UC 4A2MA 3JRPA 5E6SA 4DNUA 3DXKC 4A0BB 3EI4B 1QNIA 4WK0A 5GMKn 4A09A 5FQDA 4ESGA 3RLMD 1GOTB 3SBPA 2H47A 1TBGA 4ZN4A 3V4VA 3I89A 4GQBB 1PI6A 3FGBA 3JZHA 5M5SA 4MMYA 5GXHA 3SBQA 1QFMA 4JT5C 4J78A 3UVLA 1VZ3A 4A08A 3I8CA 4GGAA
chains in the Genus database with same CATH topology
4UM8A 2VDMA 5E6UA 5FFGA 3ZDZA 4Z7OA 5E6SA 2VDRA 3K71A 3K6SA 4WK0A 1TYEA 1M1XA 2VDLA 3ZDYA 3ZE1A 3IJEA 5E6RA 3K72A 3VI4A 3V4PA 3ZE2A 4Z7NA 4MMZA 4Z7QA 1JV2A 3T3MA 3ZDXA 1L5GA 2VDQA 4WK4A 4WK2A 3FCSA 3V4VA 4MMYA 4G1EA 3NIFA 1U8CA 4G1MA 4O02A 3T3PA 5HDBA 4UM9A 3VI3A 4NENA 4MMXA 5FFOA 4IRZA 3ZE0A 3NIGA 4WJKA 2VDPA 3FCUA 2VDNA 2VDKA 3NIDA 2VC2A 2VDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM8 A;  2VDM A;  5E6U A;  5FFG A;  3ZDZ A;  4Z7O A;  5E6S A;  2VDR A;  3K71 A;  3K6S A;  4WK0 A;  1TYE A;  1M1X A;  2VDL A;  3ZDY A;  3ZE1 A;  3IJE A;  5E6R A;  3K72 A;  3VI4 A;  3V4P A;  3ZE2 A;  4Z7N A;  4MMZ A;  4Z7Q A;  1JV2 A;  3T3M A;  3ZDX A;  1L5G A;  2VDQ A;  4WK4 A;  4WK2 A;  3FCS A;  3V4V A;  4MMY A;  4G1E A;  3NIF A;  1U8C A;  4G1M A;  4O02 A;  3T3P A;  5HDB A;  4UM9 A;  3VI3 A;  4NEN A;  4MMX A;  5FFO A;  4IRZ A;  3ZE0 A;  3NIG A;  4WJK A;  2VDP A;  3FCU A;  2VDN A;  2VDK A;  3NID A;  2VC2 A;  2VDO A; 
#chains in the Genus database with same CATH topology
 3EWE A;  5M5T A;  4DNW A;  1MG3 A;  2J55 H;  4AX4 A;  1M1X A;  4K3J B;  3ZDY A;  2OVQ B;  3GRE A;  5FA5 B;  1P22 A;  2AGX A;  4BCC A;  4Y7R A;  4AEZ A;  4AMZ A;  4JHP C;  2AGL A;  3EMH A;  5HDB A;  1N6D A;  4FA9 D;  4NBM A;  3U4Y A;  1VZ2 A;  3KRX B;  4FAN D;  2EID A;  3PXS D;  4GMB A;  4CI8 A;  5EMJ B;  5EM2 B;  2HJ4 A;  3PVW B;  2Z2O A;  4A11 A;  3ZDZ A;  1B9Y A;  5EML B;  2Q7Q A;  3OKY A;  3I7K A;  5FLX g;  1YFQ A;  4NAA A;  2YMU A;  4L1Q D;  2H9L A;  5CXC A;  4O2W A;  3JAM g;  4J84 A;  2I3S A;  2YNO A;  2P9K C;  3SMR A;  5HQG A;  4N14 A;  4G1M A;  4H5J A;  5C9Z B;  2IUQ A;  4ZOX A;  3SN6 B;  2PM9 B;  1S4U X;  4A7J A;  3EQ7 A;  4O45 A;  2VDO A;  3IUR A;  2OK4 A;  3P4F A;  3PXW D;  3K6S A;  5HE1 B;  3KRW B;  2H3X A;  3W15 A;  3IIY A;  1JTD B;  3MUO A;  3DWL C;  3RRM C;  3JRO A;  4Z7N A;  3IVM A;  4G1E A;  3QHY B;  5I5J A;  3F3F A;  5FXY A;  5HE0 B;  3CFV A;  3IUJ A;  3NVQ A;  4AMY A;  3EI1 B;  4GGD A;  1H2Y A;  5KDO B;  1T2X A;  3FCU A;  5IGO A;  3K26 A;  5A2Q g;  1FWX A;  3SCY A;  2AGW A;  2PM6 B;  2HJB A;  4X61 B;  4RE6 A;  5M5R A;  1I2M B;  2XDW A;  3RMZ D;  1NR0 A;  1C9I A;  1VE7 A;  4JSV C;  1MG2 A;  4E54 B;  2IUR A;  1XIP A;  5M5U A;  4A0A B;  2XL2 A;  2OIZ A;  4X63 B;  5EAR A;  3RN1 D;  1BPO A;  3UVM A;  5C2V B;  3IUL A;  2IUP A;  2CN2 A;  4WK2 A;  4U7A A;  5HE2 B;  4PSW B;  3BG1 A;  3UVO A;  4FWW A;  3DXM C;  4CY3 A;  3MUN A;  4FB1 D;  3V9F A;  3PSC B;  4NEN A;  3SVW D;  1VE6 A;  4PBY A;  2QC5 A;  2EIE A;  2Z2N A;  4IRZ A;  4X3E A;  2AGY A;  3AL8 B;  2I0T A;  2PBI B;  3B7F A;  1GOH A;  3VA6 A;  4ZOV A;  2EIC A;  5SXM A;  5IJ7 E;  1PBY B;  4GQ2 P;  4E5Z B;  4GZ8 A;  2CO0 C;  4JHN A;  5K19 A;  4DNV A;  3V4P A;  4A0B A;  4O3T B;  3RN0 D;  3EI4 A;  3T3M A;  4BUJ C;  1UOO A;  3IUN A;  4Y5R D;  3NVN A;  3OL2 B;  4CY2 A;  3HFQ A;  2IWK A;  3JB9 L;  4R7A B;  1R5M A;  4LG9 A;  2H9N A;  1QFS A;  4CZY A;  3MKQ A;  1UTC A;  4QQE A;  3SJL D;  1B9X A;  1NEX B;  4O9D A;  5FFG A;  1OLZ A;  4PSX B;  1JJU B;  1GXR A;  4CI1 A;  2I3T A;  3SXT D;  1TYE A;  2XZG A;  3I7L A;  2B5N A;  3JZN A;  3MZL A;  2TRC B;  3ORV D;  4MMZ A;  1UOQ A;  2H13 A;  2HYE A;  3AH8 B;  4AN1 A;  5AJA A;  3E0C A;  3I8E A;  2P9I C;  3F3G A;  4XYH A;  1MDA H;  5GXI A;  4JSP C;  4ZOZ A;  1PEV A;  5FKS A;  5TEE A;  3EU7 A;  4UI9 R;  3NID A;  3GFC A;  2VC2 A;  2CE8 A;  2I0R A;  2OJY A;  3O4I A;  3EI3 B;  3UR4 A;  1K8K C;  4CY5 A;  3CIK B;  4XYI A;  3SFZ A;  5EM2 A;  2CO0 A;  3BWS A;  2BCJ B;  2J57 G;  4YVD A;  1H2X A;  1JV2 A;  1L5G A;  4KFM B;  5IGQ A;  5B4W A;  1SQ9 A;  4CZV A;  4FA4 D;  5IT9 g;  2XL3 A;  3MKS B;  4J77 A;  2H9M A;  2WQ8 A;  5TEF A;  3F3P A;  1Q47 A;  3OTT A;  4J87 A;  3IJC A;  3OW8 A;  3OF7 A;  4LGN A;  2P9S C;  1A0R B;  2PM9 A;  2EIB A;  1GOF A;  5CXB B;  1L0Q A;  3BG0 A;  2IWF A;  4QT8 A;  4ERY A;  4PC0 A;  4GM8 A;  3EQ9 A;  4PXW A;  2BBK H;  3UVN A;  2H6N A;  4ERQ A;  2H14 A;  2AQ5 A;  1XKS A;  3IJ0 A;  1U8C A;  3ULE C;  4H5I A;  3IUM A;  3A0F A;  1U4C A;  4PNK B;  4GM3 A;  3C5M A;  5THA A;  2YB8 B;  3FM0 A;  2AGZ A;  2GC7 A;  4PBZ A;  5IC7 A;  2HXC A;  3EI1 A;  5IJ8 E;  2XYI A;  4GGC A;  5EMM B;  3ZE1 A;  2H68 A;  2CNX A;  3IJE A;  3JPX A;  4J81 A;  4ZOY A;  4X60 B;  3DM0 A;  3ZDX A;  4D0K A;  3J81 g;  3IUQ A;  4E54 A;  4CZX A;  4A0A A;  1A12 A;  2YBA A;  4OWR A;  4O3U B;  3VH0 A;  2XE4 A;  3N0D A;  2HU7 A;  4BP8 A;  2VDM A;  2B5M A;  4ES0 A;  4HDJ A;  4UM8 A;  4IA9 A;  4FA1 D;  5C92 A;  1N6F A;  4Z7O A;  5H14 A;  3K27 A;  1JOF A;  3EI2 B;  3AL8 A;  2QR5 A;  1PGU A;  3SLE D;  5FKR A;  3VGZ A;  1GP2 B;  5E6R A;  4E5Z A;  4L1M A;  3FCS A;  3QI0 A;  2QXV A;  5FKT A;  2B5L A;  3NVX A;  5JWZ A;  2OVR B;  3NIF A;  2B4E A;  5AFU 3;  1XHM A;  4NSX A;  4O1Q D;  3OL2 A;  4BP9 A;  4J73 A;  3MZK A;  4A09 B;  1K3I A;  1E5T A;  3C75 H;  5TF2 A;  4JD2 C;  4FA5 D;  4D9S A;  2G9A A;  2HES X;  3ZWL B;  3J80 g;  2H9P A;  1E8N A;  1GOG A;  3I7O A;  5FKQ A;  4J79 A;  3OKT A;  2MTA H;  3KCI A;  5EMK B;  4Z7Q A;  2EBS A;  4MK0 B;  4JT6 C;  3DDU A;  4WK4 A;  2UZX B;  4TZ4 A;  5CYK B;  3FRX A;  4A08 B;  3AL9 A;  5CYK A;  3OKW A;  1C9L A;  3ZE0 A;  2BKL A;  3NIG A;  4GM9 A;  5I5I A;  4NC4 A;  5EAP A;  2HKR A;  1GG2 B;  5AMS A;  5HYN B;  2VDR A;  4A2L A;  4CI3 A;  2JKX A;  4LG8 A;  4G56 B;  1E8M A;  1SQJ A;  3EI3 A;  3VI4 A;  2IUV A;  1UOP A;  2OK6 A;  4IMM A;  2GC4 A;  1JMZ B;  2HKM A;  3AFC A;  2H6Q A;  3I7N A;  4U1E I;  1VYH C;  4A11 B;  2CE9 A;  3EG6 A;  3O4J A;  1O6F A;  2VDP A;  2QZP A;  5TDH B;  3ODT A;  3OKY B;  2P9N C;  5HE3 B;  2YNN A;  4J8B A;  5CXC B;  5E6U A;  5I5M A;  2G99 A;  3JZG A;  1SHY B;  2VZ1 A;  2PM7 B;  3SWS D;  3PSL A;  3DSM A;  2XU7 A;  2IAA A;  4D6V A;  2VDL A;  5C86 A;  3C99 A;  1OMW B;  4ERZ A;  4JSN C;  5CXB A;  1K32 A;  2CN3 A;  1ERJ A;  2VDQ A;  3V7D B;  3UKR C;  3I7H A;  4I79 A;  4AN0 A;  5GSA A;  2YNP A;  3RFG A;  3CFS B;  2VZ3 A;  4BH6 A;  5M61 A;  4CC9 A;  1H2Z A;  3UVK A;  4Z8L A;  3I2N A;  4MMX A;  4G55 A;  5EAM A;  3O4H A;  2VDK A;  1RI6 A;  2J56 H;  3RSE C;  4QAM A;  3RFH A;  3PXT D;  4AOW A;  1YR2 A;  4EWR A;  3I7P A;  3K71 A;  3GC3 B;  3L4O D;  4BCD A;  2HU5 A;  3UKU C;  3K72 A;  4J82 A;  4J8G A;  5M5V A;  2P9P C;  3N0E A;  3IJ1 A;  4L9O A;  3SBR A;  1O6G A;  2O9K A;  5C2W B;  4QL1 A;  4O02 A;  2GNQ A;  3EQ8 A;  3MXX A;  4UM9 A;  4K3I D;  2Z2P A;  4J86 A;  5H1M A;  3L4M D;  1JMX B;  2VDN A;  5K1C C;  2UZY B;  4CI2 A;  4JSX C;  4FAV D;  3IIW A;  1TYQ C;  3PE7 A;  2AH1 A;  4XEI C;  2I0S A;  3V5W B;  3MVD K;  1U2V C;  4L3G D;  2H6K A;  2AH0 A;  4BCB A;  4RE5 A;  3ZE2 A;  2P9L C;  3MMY A;  3SHF A;  3EI2 A;  2W18 A;  3IKO A;  3GD1 I;  3O4G A;  4L3H D;  1N6E A;  2OVP B;  3T3P A;  3VI3 A;  4J0W A;  4QRJ A;  5FFO A;  4JXM A;  2HU8 A;  4FHL A;  5H17 A;  4GQ1 A;  4WJK A;  1H2W A;  5EAL A;  4OZU A;  4J0X A;  3C9C A;  4BL0 A;  4CY1 A;  3PVU B;  2P9U C;  4A2M A;  3JRP A;  5E6S A;  4DNU A;  3DXK C;  4A0B B;  3EI4 B;  1QNI A;  4WK0 A;  5GMK n;  4A09 A;  5FQD A;  4ESG A;  3RLM D;  1GOT B;  3SBP A;  2H47 A;  1TBG A;  4ZN4 A;  3V4V A;  3I89 A;  4GQB B;  1PI6 A;  3FGB A;  3JZH A;  5M5S A;  4MMY A;  5GXH A;  3SBQ A;  1QFM A;  4JT5 C;  4J78 A;  3UVL A;  1VZ3 A;  4A08 A;  3I8C A;  4GGA A; 
#chains in the Genus database with same CATH homology
 4UM8 A;  2VDM A;  5E6U A;  5FFG A;  3ZDZ A;  4Z7O A;  5E6S A;  2VDR A;  3K71 A;  3K6S A;  4WK0 A;  1TYE A;  1M1X A;  2VDL A;  3ZDY A;  3ZE1 A;  3IJE A;  5E6R A;  3K72 A;  3VI4 A;  3V4P A;  3ZE2 A;  4Z7N A;  4MMZ A;  4Z7Q A;  1JV2 A;  3T3M A;  3ZDX A;  1L5G A;  2VDQ A;  4WK4 A;  4WK2 A;  3FCS A;  3V4V A;  4MMY A;  4G1E A;  3NIF A;  1U8C A;  4G1M A;  4O02 A;  3T3P A;  5HDB A;  4UM9 A;  3VI3 A;  4NEN A;  4MMX A;  5FFO A;  4IRZ A;  3ZE0 A;  3NIG A;  4WJK A;  2VDP A;  3FCU A;  2VDN A;  2VDK A;  3NID A;  2VC2 A;  2VDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...