2VDRA

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, lggakqrgdv
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 108
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdrA00
5E6UA 5FFOA 5E6RA 3K71A 5E6SA 3ZE2A 3ZE1A 2VDMA 3T3PA 4MMXA 3FCUA 3ZE0A 1JV2A 2VDPA 4MMZA 4WK0A 4WK2A 3V4PA 4G1EA 1L5GA 4WK4A 3T3MA 3NIFA 3K72A 4UM9A 1TYEA 3ZDZA 3NIGA 3IJEA 2VDQA 4MMYA 5FFGA 3NIDA 4Z7OA 5HDBA 4Z7QA 3ZDXA 3VI3A 4IRZA 1M1XA 2VDKA 4O02A 1U8CA 3VI4A 3K6SA 2VDLA 4UM8A 4WJKA 3FCSA 2VC2A 3V4VA 3ZDYA 4Z7NA 2VDRA 4G1MA 2VDOA 4NENA 2VDNA
chains in the Genus database with same CATH superfamily
2XU7A 3BWSA 3V7DB 5FKQA 1B9XA 4ESGA 2J57G 3ZE2A 5EMMB 3EMHA 2P9IC 4CI2A 2VDPA 2OJYA 2HKMA 3KRWB 1S4UX 1T2XA 4X61B 3QI0A 5KDOB 3ZDZA 5GXHA 4J77A 3MXXA 4X3EA 3N0DA 3J81g 3RMZD 2H9LA 2HXCA 4QRJA 4BH6A 1XHMA 1RI6A 5FKSA 3I8CA 2VZ3A 5TDHB 3SVWD 2PM9B 5EMLB 3ZDYA 1BPOA 3FM0A 4D0KA 1I2MB 3OF7A 4OZUA 2AH0A 2P9SC 3MZLA 2HESX 3KRXB 5H1MA 1N6DA 4GMBA 5IJ8E 2B5LA 4WK0A 3SHFA 3K27A 3V4PA 4GQ1A 3L4OD 3BG1A 1UOQA 1OMWB 3OKYA 3IUMA 1NEXB 2AGYA 3DXMC 3EI3A 4E54B 1GOTB 4A08A 3SXTD 1VE6A 4U7AA 3RN0D 3UKUC 4BP8A 4PSWB 4JXMA 4O3UB 2EBSA 2IWFA 3O4HA 3F3FA 3ZE1A 5I5MA 1GOFA 4O2WA 2OVRB 3RLMD 2I3TA 2HU8A 4GGAA 1VZ3A 2CN2A 3I7HA 5IJ7E 1R5MA 1TYEA 3SBQA 4G56B 4BP9A 2IURA 1MDAH 3MVDK 1GXRA 2AH1A 2I0SA 4X60B 5FQDA 5EMKB 2YNPA 4I79A 4WJKA 2IUQA 2VC2A 3IKOA 4OWRA 1GOGA 3I8EA 4LGNA 3EQ9A 4G1MA 4X63B 3IJCA 5CXCA 2H68A 3BG0A 4O3TB 1C9LA 3F3PA 3P4FA 2XYIA 5A2Qg 4A09A 3MUOA 2OVQB 3F3GA 1VZ2A 4MMZA 2P9NC 4BUJC 3EI1A 2IAAA 1XIPA 2B4EA 3AH8B 3UVNA 1SHYB 2Z2OA 1C9IA 3IUQA 3SWSD 5TEEA 4H5IA 3EI4B 4MMYA 4RE6A 3I7OA 5I5IA 2BCJB 4Z7QA 4O02A 3SBRA 4ZOYA 2EIBA 4UI9R 1GOHA 4FAVD 2CO0C 3I2NA 3EU7A 5IC7A 2AQ5A 4Z8LA 3JROA 5CXBB 4NBMA 2OIZA 4MMXA 4O1QD 3I7NA 4L9OA 5M61A 1PGUA 3GC3B 3PXWD 3NVQA 3CIKB 1MG2A 2IUVA 4KFMB 2VDLA 2VZ1A 3CFVA 3IULA 3FCSA 5FKTA 3SMRA 4DNUA 4FA1D 4Y5RD 4XYIA 2H9MA 1VE7A 3JZGA 5HE0B 3C99A 4XEIC 5EM2B 2XE4A 5GXIA 2AGWA 2PM7B 2H6KA 5HQGA 4GM9A 1L5GA 1JOFA 1GG2B 1QFMA 2QC5A 4J82A 2H13A 4UM9A 5IGOA 3AL8A 4N14A 2H14A 2H47A 3C75H 3QHYB 2UZYB 3SN6B 3VGZA 5TF2A 4Z7OA 4E5ZA 1P22A 4JT6C 4QAMA 5K1CC 4LG8A 4A09B 4GGCA 3VI4A 2H3XA 3JB9L 4CI3A 2J56H 4ERYA 5FFOA 1K8KC 2CNXA 5GMKn 4GZ8A 2P9UC 3I7KA 3T3PA 3DSMA 2XL3A 1JV2A 4AN1A 2H9NA 4JHNA 2OK6A 3DWLC 1PI6A 2BBKH 4A7JA 3NIGA 4CY3A 5TEFA 5CXBA 3EQ7A 1TYQC 4FA9D 3GFCA 2PM9A 4CZXA 4MK0B 2HU7A 3UVOA 5IGQA 1TBGA 4LG9A 3MKSB 4Z7NA 4JSNC 2QXVA 4NSXA 4CY5A 3L4MD 1PBYB 4FHLA 4CC9A 4O9DA 2JKXA 3HFQA 4QQEA 3SCYA 4ERQA 2I0TA 2PM6B 5CYKB 3PE7A 1SQ9A 2GC4A 1JMZB 1FWXA 3EI4A 4JHPC 2BKLA 1XKSA 3PVWB 2MTAH 3IJ1A 1E8MA 2UZXB 4WK4A 5M5RA 2HJ4A 4AOWA 5FFGA 3JRPA 2YNNA 2CE9A 3AL9A 2CO0A 3NIDA 4PBYA 2P9LC 2W18A 5HE3B 3ZWLB 5EAMA 2G99A 5H17A 2QZPA 1E8NA 5M5UA 4E5ZB 5B4WA 3I7LA 4TZ4A 4AN0A 1U4CA 1ERJA 5EARA 4J0WA 1A0RB 3PXTD 2EICA 2CE8A 4GM3A 4J79A 3NVNA 3RSEC 4JSVC 1UTCA 5HE1B 4A2MA 2P9KC 4PSXB 2VDQA 1U2VC 2YNOA 3PSLA 5AJAA 3VA6A 3VH0A 3DDUA 4BCBA 4J87A 5CXCB 3SLED 5JWZA 2EIEA 3OKYB 4FWWA 3W15A 4AEZA 3O4GA 1K3IA 5E6RA 4RE5A 2CN3A 2I3SA 5E6SA 4GQBB 3O4JA 5EAPA 4PXWA 4IMMA 1YFQA 2Z2PA 5I5JA 1O6GA 3DXKC 4L3HD 2Q7QA 4PNKB 3NVXA 3UVMA 3E0CA 2GC7A 3NIFA 3PVUB 3UVLA 2J55H 2HU5A 4J81A 3SBPA 4GGDA 3MMYA 5C2VB 4AMYA 5EMJB 1JMXB 4CI1A 3OTTA 5M5TA 5H14A 2XDWA 3IUNA 3KCIA 2YB8B 4JT5C 2XZGA 4U1EI 4PC0A 1UOPA 3PSCB 3SJLD 1B9YA 4G55A 4Y7RA 4XYHA 4FA4D 5C86A 2P9PC 4GM8A 2H9PA 4ZOXA 4DNWA 4NAAA 1N6FA 3FGBA 1M1XA 1U8CA 4NC4A 4UM8A 3I7PA 2I0RA 4J78A 1SQJA 2HJBA 1NR0A 2HKRA 3GD1I 4L1QD 3EQ8A 3O4IA 4JSXC 3AL8B 3OKTA 3DM0A 1JJUB 3JZNA 4A11B 4FA5D 3EI2B 4BCDA 5THAA 5FLXg 4H5JA 3RFGA 3CFSB 1A12A 4IRZA 3U4YA 4J8GA 1JTDB 4AMZA 2HYEA 3K26A 3UKRC 1H2XA 3IIYA 1VYHC 2B5MA 4K3JB 5HYNB 4DNVA 3JZHA 4CI8A 2PBIB 2WQ8A 5K19A 3C5MA 4J0XA 4WK2A 1QNIA 2G9AA 4J84A 4J86A 1PEVA 4QL1A 4FB1D 5GSAA 4ERZA 3IURA 3IJEA 2Z2NA 5SXMA 2AGZA 1L0QA 5HDBA 3I89A 4D6VA 4CY2A 2AGLA 5M5VA 3V4VA 1H2YA 3RRMC 3OL2B 4HDJA 2YMUA 5E6UA 3ORVD 3MZKA 2IWKA 3RFHA 5FA5B 1YR2A 3GREA 5AMSA 2VDMA 3IVMA 4A0BB 3ZE0A 4ES0A 4G1EA 2OK4A 4FAND 4A0BA 1O6FA 4K3ID 5CYKA 3FRXA 3IIWA 4O45A 4AX4A 3UR4A 5FXYA 2TRCB 3EWEA 4ZOZA 4CZVA 2XL2A 4L1MA 2H6NA 3AFCA 2VDRA 5EALA 3PXSD 2OVPB 3VI3A 2VDNA 2B5NA 4A11A 3K71A 3MKQA 1QFSA 4D9SA 3IUJA 5C9ZB 5AFU3 5HE2B 2O9KA 3FCUA 4BL0A 3V5WB 3OW8A 3OKWA 3IJ0A 4A0AA 4L3GD 3SFZA 3T3MA 3J80g 3V9FA 1E5TA 4YVDA 1OLZA 4JSPC 1Q47A 4PBZA 4GQ2P 3A0FA 2VDKA 3K6SA 1K32A 2EIDA 4QT8A 1H2WA 1MG3A 2H6QA 3UVKA 2GNQA 3MUNA 2VDOA 5M5SA 2YBAA 3EG6A 5C2WB 4ZN4A 5FKRA 4A08B 3EI3B 4E54A 2IUPA 3EI1B 3RN1D 3EI2A 1H2ZA 2AGXA 4ZOVA 1GP2B 4IA9A 4EWRA 5C92A 5IT9g 4A0AB 3JPXA 5EM2A 4R7AB 4J73A 1UOOA 3K72A 3ODTA 3C9CA 3JAMg 3B7FA 3OL2A 4CZYA 1N6EA 3ULEC 4J8BA 4A2LA 3ZDXA 4CY1A 4JD2C 2QR5A 4NENA 4BCCA 3N0EA
chains in the Genus database with same CATH topology
5E6UA 5FFOA 5E6RA 3K71A 5E6SA 3ZE2A 3ZE1A 2VDMA 3T3PA 4MMXA 3FCUA 3ZE0A 1JV2A 2VDPA 4MMZA 4WK0A 4WK2A 3V4PA 4G1EA 1L5GA 4WK4A 3T3MA 3NIFA 3K72A 4UM9A 1TYEA 3ZDZA 3NIGA 3IJEA 2VDQA 4MMYA 5FFGA 3NIDA 4Z7OA 5HDBA 4Z7QA 3ZDXA 3VI3A 4IRZA 1M1XA 2VDKA 4O02A 1U8CA 3VI4A 3K6SA 2VDLA 4UM8A 4WJKA 3FCSA 2VC2A 3V4VA 3ZDYA 4Z7NA 2VDRA 4G1MA 2VDOA 4NENA 2VDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6U A;  5FFO A;  5E6R A;  3K71 A;  5E6S A;  3ZE2 A;  3ZE1 A;  2VDM A;  3T3P A;  4MMX A;  3FCU A;  3ZE0 A;  1JV2 A;  2VDP A;  4MMZ A;  4WK0 A;  4WK2 A;  3V4P A;  4G1E A;  1L5G A;  4WK4 A;  3T3M A;  3NIF A;  3K72 A;  4UM9 A;  1TYE A;  3ZDZ A;  3NIG A;  3IJE A;  2VDQ A;  4MMY A;  5FFG A;  3NID A;  4Z7O A;  5HDB A;  4Z7Q A;  3ZDX A;  3VI3 A;  4IRZ A;  1M1X A;  2VDK A;  4O02 A;  1U8C A;  3VI4 A;  3K6S A;  2VDL A;  4UM8 A;  4WJK A;  3FCS A;  2VC2 A;  3V4V A;  3ZDY A;  4Z7N A;  2VDR A;  4G1M A;  2VDO A;  4NEN A;  2VDN A; 
#chains in the Genus database with same CATH topology
 2XU7 A;  3BWS A;  3V7D B;  5FKQ A;  1B9X A;  4ESG A;  2J57 G;  3ZE2 A;  5EMM B;  3EMH A;  2P9I C;  4CI2 A;  2VDP A;  2OJY A;  2HKM A;  3KRW B;  1S4U X;  1T2X A;  4X61 B;  3QI0 A;  5KDO B;  3ZDZ A;  5GXH A;  4J77 A;  3MXX A;  4X3E A;  3N0D A;  3J81 g;  3RMZ D;  2H9L A;  2HXC A;  4QRJ A;  4BH6 A;  1XHM A;  1RI6 A;  5FKS A;  3I8C A;  2VZ3 A;  5TDH B;  3SVW D;  2PM9 B;  5EML B;  3ZDY A;  1BPO A;  3FM0 A;  4D0K A;  1I2M B;  3OF7 A;  4OZU A;  2AH0 A;  2P9S C;  3MZL A;  2HES X;  3KRX B;  5H1M A;  1N6D A;  4GMB A;  5IJ8 E;  2B5L A;  4WK0 A;  3SHF A;  3K27 A;  3V4P A;  4GQ1 A;  3L4O D;  3BG1 A;  1UOQ A;  1OMW B;  3OKY A;  3IUM A;  1NEX B;  2AGY A;  3DXM C;  3EI3 A;  4E54 B;  1GOT B;  4A08 A;  3SXT D;  1VE6 A;  4U7A A;  3RN0 D;  3UKU C;  4BP8 A;  4PSW B;  4JXM A;  4O3U B;  2EBS A;  2IWF A;  3O4H A;  3F3F A;  3ZE1 A;  5I5M A;  1GOF A;  4O2W A;  2OVR B;  3RLM D;  2I3T A;  2HU8 A;  4GGA A;  1VZ3 A;  2CN2 A;  3I7H A;  5IJ7 E;  1R5M A;  1TYE A;  3SBQ A;  4G56 B;  4BP9 A;  2IUR A;  1MDA H;  3MVD K;  1GXR A;  2AH1 A;  2I0S A;  4X60 B;  5FQD A;  5EMK B;  2YNP A;  4I79 A;  4WJK A;  2IUQ A;  2VC2 A;  3IKO A;  4OWR A;  1GOG A;  3I8E A;  4LGN A;  3EQ9 A;  4G1M A;  4X63 B;  3IJC A;  5CXC A;  2H68 A;  3BG0 A;  4O3T B;  1C9L A;  3F3P A;  3P4F A;  2XYI A;  5A2Q g;  4A09 A;  3MUO A;  2OVQ B;  3F3G A;  1VZ2 A;  4MMZ A;  2P9N C;  4BUJ C;  3EI1 A;  2IAA A;  1XIP A;  2B4E A;  3AH8 B;  3UVN A;  1SHY B;  2Z2O A;  1C9I A;  3IUQ A;  3SWS D;  5TEE A;  4H5I A;  3EI4 B;  4MMY A;  4RE6 A;  3I7O A;  5I5I A;  2BCJ B;  4Z7Q A;  4O02 A;  3SBR A;  4ZOY A;  2EIB A;  4UI9 R;  1GOH A;  4FAV D;  2CO0 C;  3I2N A;  3EU7 A;  5IC7 A;  2AQ5 A;  4Z8L A;  3JRO A;  5CXB B;  4NBM A;  2OIZ A;  4MMX A;  4O1Q D;  3I7N A;  4L9O A;  5M61 A;  1PGU A;  3GC3 B;  3PXW D;  3NVQ A;  3CIK B;  1MG2 A;  2IUV A;  4KFM B;  2VDL A;  2VZ1 A;  3CFV A;  3IUL A;  3FCS A;  5FKT A;  3SMR A;  4DNU A;  4FA1 D;  4Y5R D;  4XYI A;  2H9M A;  1VE7 A;  3JZG A;  5HE0 B;  3C99 A;  4XEI C;  5EM2 B;  2XE4 A;  5GXI A;  2AGW A;  2PM7 B;  2H6K A;  5HQG A;  4GM9 A;  1L5G A;  1JOF A;  1GG2 B;  1QFM A;  2QC5 A;  4J82 A;  2H13 A;  4UM9 A;  5IGO A;  3AL8 A;  4N14 A;  2H14 A;  2H47 A;  3C75 H;  3QHY B;  2UZY B;  3SN6 B;  3VGZ A;  5TF2 A;  4Z7O A;  4E5Z A;  1P22 A;  4JT6 C;  4QAM A;  5K1C C;  4LG8 A;  4A09 B;  4GGC A;  3VI4 A;  2H3X A;  3JB9 L;  4CI3 A;  2J56 H;  4ERY A;  5FFO A;  1K8K C;  2CNX A;  5GMK n;  4GZ8 A;  2P9U C;  3I7K A;  3T3P A;  3DSM A;  2XL3 A;  1JV2 A;  4AN1 A;  2H9N A;  4JHN A;  2OK6 A;  3DWL C;  1PI6 A;  2BBK H;  4A7J A;  3NIG A;  4CY3 A;  5TEF A;  5CXB A;  3EQ7 A;  1TYQ C;  4FA9 D;  3GFC A;  2PM9 A;  4CZX A;  4MK0 B;  2HU7 A;  3UVO A;  5IGQ A;  1TBG A;  4LG9 A;  3MKS B;  4Z7N A;  4JSN C;  2QXV A;  4NSX A;  4CY5 A;  3L4M D;  1PBY B;  4FHL A;  4CC9 A;  4O9D A;  2JKX A;  3HFQ A;  4QQE A;  3SCY A;  4ERQ A;  2I0T A;  2PM6 B;  5CYK B;  3PE7 A;  1SQ9 A;  2GC4 A;  1JMZ B;  1FWX A;  3EI4 A;  4JHP C;  2BKL A;  1XKS A;  3PVW B;  2MTA H;  3IJ1 A;  1E8M A;  2UZX B;  4WK4 A;  5M5R A;  2HJ4 A;  4AOW A;  5FFG A;  3JRP A;  2YNN A;  2CE9 A;  3AL9 A;  2CO0 A;  3NID A;  4PBY A;  2P9L C;  2W18 A;  5HE3 B;  3ZWL B;  5EAM A;  2G99 A;  5H17 A;  2QZP A;  1E8N A;  5M5U A;  4E5Z B;  5B4W A;  3I7L A;  4TZ4 A;  4AN0 A;  1U4C A;  1ERJ A;  5EAR A;  4J0W A;  1A0R B;  3PXT D;  2EIC A;  2CE8 A;  4GM3 A;  4J79 A;  3NVN A;  3RSE C;  4JSV C;  1UTC A;  5HE1 B;  4A2M A;  2P9K C;  4PSX B;  2VDQ A;  1U2V C;  2YNO A;  3PSL A;  5AJA A;  3VA6 A;  3VH0 A;  3DDU A;  4BCB A;  4J87 A;  5CXC B;  3SLE D;  5JWZ A;  2EIE A;  3OKY B;  4FWW A;  3W15 A;  4AEZ A;  3O4G A;  1K3I A;  5E6R A;  4RE5 A;  2CN3 A;  2I3S A;  5E6S A;  4GQB B;  3O4J A;  5EAP A;  4PXW A;  4IMM A;  1YFQ A;  2Z2P A;  5I5J A;  1O6G A;  3DXK C;  4L3H D;  2Q7Q A;  4PNK B;  3NVX A;  3UVM A;  3E0C A;  2GC7 A;  3NIF A;  3PVU B;  3UVL A;  2J55 H;  2HU5 A;  4J81 A;  3SBP A;  4GGD A;  3MMY A;  5C2V B;  4AMY A;  5EMJ B;  1JMX B;  4CI1 A;  3OTT A;  5M5T A;  5H14 A;  2XDW A;  3IUN A;  3KCI A;  2YB8 B;  4JT5 C;  2XZG A;  4U1E I;  4PC0 A;  1UOP A;  3PSC B;  3SJL D;  1B9Y A;  4G55 A;  4Y7R A;  4XYH A;  4FA4 D;  5C86 A;  2P9P C;  4GM8 A;  2H9P A;  4ZOX A;  4DNW A;  4NAA A;  1N6F A;  3FGB A;  1M1X A;  1U8C A;  4NC4 A;  4UM8 A;  3I7P A;  2I0R A;  4J78 A;  1SQJ A;  2HJB A;  1NR0 A;  2HKR A;  3GD1 I;  4L1Q D;  3EQ8 A;  3O4I A;  4JSX C;  3AL8 B;  3OKT A;  3DM0 A;  1JJU B;  3JZN A;  4A11 B;  4FA5 D;  3EI2 B;  4BCD A;  5THA A;  5FLX g;  4H5J A;  3RFG A;  3CFS B;  1A12 A;  4IRZ A;  3U4Y A;  4J8G A;  1JTD B;  4AMZ A;  2HYE A;  3K26 A;  3UKR C;  1H2X A;  3IIY A;  1VYH C;  2B5M A;  4K3J B;  5HYN B;  4DNV A;  3JZH A;  4CI8 A;  2PBI B;  2WQ8 A;  5K19 A;  3C5M A;  4J0X A;  4WK2 A;  1QNI A;  2G9A A;  4J84 A;  4J86 A;  1PEV A;  4QL1 A;  4FB1 D;  5GSA A;  4ERZ A;  3IUR A;  3IJE A;  2Z2N A;  5SXM A;  2AGZ A;  1L0Q A;  5HDB A;  3I89 A;  4D6V A;  4CY2 A;  2AGL A;  5M5V A;  3V4V A;  1H2Y A;  3RRM C;  3OL2 B;  4HDJ A;  2YMU A;  5E6U A;  3ORV D;  3MZK A;  2IWK A;  3RFH A;  5FA5 B;  1YR2 A;  3GRE A;  5AMS A;  2VDM A;  3IVM A;  4A0B B;  3ZE0 A;  4ES0 A;  4G1E A;  2OK4 A;  4FAN D;  4A0B A;  1O6F A;  4K3I D;  5CYK A;  3FRX A;  3IIW A;  4O45 A;  4AX4 A;  3UR4 A;  5FXY A;  2TRC B;  3EWE A;  4ZOZ A;  4CZV A;  2XL2 A;  4L1M A;  2H6N A;  3AFC A;  2VDR A;  5EAL A;  3PXS D;  2OVP B;  3VI3 A;  2VDN A;  2B5N A;  4A11 A;  3K71 A;  3MKQ A;  1QFS A;  4D9S A;  3IUJ A;  5C9Z B;  5AFU 3;  5HE2 B;  2O9K A;  3FCU A;  4BL0 A;  3V5W B;  3OW8 A;  3OKW A;  3IJ0 A;  4A0A A;  4L3G D;  3SFZ A;  3T3M A;  3J80 g;  3V9F A;  1E5T A;  4YVD A;  1OLZ A;  4JSP C;  1Q47 A;  4PBZ A;  4GQ2 P;  3A0F A;  2VDK A;  3K6S A;  1K32 A;  2EID A;  4QT8 A;  1H2W A;  1MG3 A;  2H6Q A;  3UVK A;  2GNQ A;  3MUN A;  2VDO A;  5M5S A;  2YBA A;  3EG6 A;  5C2W B;  4ZN4 A;  5FKR A;  4A08 B;  3EI3 B;  4E54 A;  2IUP A;  3EI1 B;  3RN1 D;  3EI2 A;  1H2Z A;  2AGX A;  4ZOV A;  1GP2 B;  4IA9 A;  4EWR A;  5C92 A;  5IT9 g;  4A0A B;  3JPX A;  5EM2 A;  4R7A B;  4J73 A;  1UOO A;  3K72 A;  3ODT A;  3C9C A;  3JAM g;  3B7F A;  3OL2 A;  4CZY A;  1N6E A;  3ULE C;  4J8B A;  4A2L A;  3ZDX A;  4CY1 A;  4JD2 C;  2QR5 A;  4NEN A;  4BCC A;  3N0E A; 
#chains in the Genus database with same CATH homology
 5E6U A;  5FFO A;  5E6R A;  3K71 A;  5E6S A;  3ZE2 A;  3ZE1 A;  2VDM A;  3T3P A;  4MMX A;  3FCU A;  3ZE0 A;  1JV2 A;  2VDP A;  4MMZ A;  4WK0 A;  4WK2 A;  3V4P A;  4G1E A;  1L5G A;  4WK4 A;  3T3M A;  3NIF A;  3K72 A;  4UM9 A;  1TYE A;  3ZDZ A;  3NIG A;  3IJE A;  2VDQ A;  4MMY A;  5FFG A;  3NID A;  4Z7O A;  5HDB A;  4Z7Q A;  3ZDX A;  3VI3 A;  4IRZ A;  1M1X A;  2VDK A;  4O02 A;  1U8C A;  3VI4 A;  3K6S A;  2VDL A;  4UM8 A;  4WJK A;  3FCS A;  2VC2 A;  3V4V A;  3ZDY A;  4Z7N A;  2VDR A;  4G1M A;  2VDO A;  4NEN A;  2VDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...