1TYEA

Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
452
structure length
452
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRAEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 98
structure length 452
sequence length 452
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 1tyeA00
3ZDYA 2VDMA 1JV2A 4Z7OA 2VC2A 4NENA 5E6UA 3K6SA 3ZE1A 4WK4A 3NIGA 4G1EA 2VDLA 2VDPA 4MMXA 5FFOA 4MMYA 4UM8A 3V4VA 4Z7NA 4UM9A 3K71A 4G1MA 3ZDXA 3V4PA 5FFGA 3K72A 5E6RA 4Z7QA 4IRZA 3FCUA 3FCSA 1TYEA 2VDQA 3T3PA 1L5GA 3NIFA 3VI3A 2VDOA 3IJEA 3T3MA 3VI4A 1M1XA 2VDNA 5HDBA 3ZE2A 4WK0A 4MMZA 3ZDZA 2VDKA 5E6SA 1U8CA 3NIDA 2VDRA 4WJKA 3ZE0A 4O02A 4WK2A
chains in the Genus database with same CATH superfamily
2CE8A 2IUQA 4JT6C 4Z7OA 2J55H 2QC5A 4J0XA 2B4EA 2VDLA 4A11A 4AX4A 2H68A 4BP9A 4FA9D 1VZ2A 2HKMA 4Z7QA 3QI0A 4JSPC 4A0AA 5EMKB 4X61B 5CYKB 3FM0A 4YVDA 3RFHA 3RFGA 3MUNA 2IUPA 4G55A 4O45A 3ZE2A 4CY1A 2H47A 2P9NC 3AH8B 4GGCA 3SCYA 3IUJA 4FA1D 4FAVD 2B5NA 3PVWB 3J80g 3SBQA 4XEIC 3V7DB 4IMMA 1JV2A 2PM6B 3ORVD 5I5JA 4GMBA 3OL2B 4FA5D 3C75H 4QT8A 2I3TA 4AOWA 3JAMg 2HJBA 1VE7A 3EI1A 5TDHB 4R7AB 1TYEA 3EU7A 3I7LA 3T3PA 3IJEA 4UI9R 4Y7RA 4E5ZA 1H2ZA 3ZDZA 3MKSB 5FKSA 1N6EA 1UOOA 5AJAA 4ZOVA 2CN2A 2UZXB 2VZ1A 4JT5C 4QAMA 1S4UX 5I5IA 4J77A 4DNWA 4ERYA 3F3GA 4PBYA 4BCCA 3K6SA 4X3EA 4LG8A 2EIBA 3ZWLB 3V4PA 3O4HA 5H14A 5IGOA 5E6RA 4CC9A 4CI1A 5GXHA 4A7JA 4Z8LA 2HESX 1E8NA 2Z2OA 3NIFA 1GOTB 3GC3B 3P4FA 2YMUA 2H9LA 3NVXA 4MMZA 2OK4A 2B5MA 3B7FA 3O4GA 3I8EA 1U4CA 4WJKA 3SBRA 3RN0D 3EWEA 4WK2A 4XYHA 2BBKH 3EI4B 2VDMA 1K8KC 3GD1I 4NENA 2GNQA 4MMXA 2VDPA 1JMZB 4MMYA 3K71A 3BG0A 4LGNA 3IIWA 4IRZA 4ZOYA 2J56H 2H14A 3OW8A 1MG2A 4H5JA 4FHLA 3AL8A 4GM3A 2GC7A 3PXSD 4J87A 2OVQB 3IJ1A 1GOFA 4GGDA 4J86A 5E6UA 5TEFA 1YR2A 2PBIB 5M5SA 5FFOA 3PSLA 2XL2A 4D6VA 5AFU3 5EMMB 3RN1D 2IUVA 4A08A 4G1MA 5HE0B 5IJ7E 3EG6A 5IJ8E 2OK6A 1C9IA 1GOGA 2G9AA 3FCUA 1L5GA 3MKQA 3E0CA 3PXTD 4CI2A 4PC0A 4QQEA 2Z2NA 1XIPA 5FKTA 2P9LC 3BWSA 1QFMA 5GSAA 4J79A 5M61A 2P9SC 3EQ9A 4GQ2P 2B5LA 3EI3A 3J81g 2HJ4A 2MTAH 4E54A 1RI6A 3ZE1A 4GM8A 3QHYB 1MG3A 4AN0A 2AGLA 2VZ3A 4J81A 1VZ3A 1Q47A 3IJCA 5EAPA 5H1MA 3EI2B 4A09B 3VI4A 2YB8B 4FWWA 5EMJB 1GG2B 4L3HD 3SXTD 2VDKA 4ZOZA 3SN6B 1K32A 1XHMA 4O02A 4JXMA 2H3XA 3SVWD 3UVNA 2AGZA 2IAAA 3DXMC 3OF7A 4PBZA 2PM7B 1UOPA 1FWXA 1R5MA 3F3FA 3I7PA 1PGUA 3I7HA 5FXYA 3C9CA 3O4JA 4UM9A 3ODTA 4KFMB 3RMZD 2O9KA 3C99A 1JTDB 5EALA 5HE2B 5M5UA 4TZ4A 2VDOA 5A2Qg 2PM9A 5EM2B 1H2YA 4GM9A 5CXBA 1PBYB 3BG1A 3DXKC 3UVLA 4A0AB 3OTTA 3I7KA 3UKUC 4L1QD 3DSMA 4MK0B 5B4WA 4BCDA 3U4YA 3RRMC 1SQJA 2P9IC 1L0QA 4WK4A 2I0SA 4ERQA 2W18A 3K72A 1SQ9A 2EBSA 3CIKB 3PE7A 3PVUB 4CI3A 3EI4A 1QNIA 3OKWA 4BL0A 1GOHA 2OVRB 2XZGA 1A12A 2XDWA 3EI1B 5CXCB 4DNUA 1ERJA 5FLXg 4PXWA 4J84A 2OJYA 1BPOA 3OKTA 2QXVA 4GGAA 3EQ8A 4E5ZB 3F3PA 1UTCA 5HE3B 2Q7QA 3HFQA 2AGWA 2EIDA 3AL9A 5K19A 4J78A 2I3SA 4L3GD 4PSWB 1H2XA 3I8CA 5EMLB 4CZXA 2OIZA 2XYIA 3FCSA 2H6QA 3VI3A 3T3MA 3N0EA 1E5TA 3VH0A 3O4IA 1GXRA 1T2XA 3IUQA 5IGQA 3IUNA 1U8CA 3OKYA 1P22A 4K3ID 3ZE0A 1C9LA 3NVQA 4D0KA 4J8BA 2BCJB 1QFSA 4J0WA 2IWKA 4O3TB 3SMRA 5GMKn 2AH1A 2VC2A 3MMYA 1JJUB 2IURA 4AEZA 5EARA 2OVPB 1YFQA 5SXMA 3MZLA 1JMXB 4DNVA 4GQ1A 4Z7NA 3ZDXA 5C92A 1B9XA 2QR5A 3K26A 1OMWB 2G99A 4U7AA 5M5TA 2VDQA 2XE4A 4L9OA 4NBMA 3JPXA 4ESGA 2UZYB 4BCBA 3UVMA 4IA9A 4CY2A 2H6KA 5C2VB 4XYIA 3KCIA 2AGXA 5TF2A 4EWRA 2AH0A 1NEXB 4JSVC 1TYQC 4JSXC 4O3UB 3K27A 3SHFA 4ES0A 4QRJA 3EI2A 4A0BB 5THAA 4JHNA 5IT9g 2JKXA 5CYKA 5C86A 2WQ8A 3V4VA 4Y5RD 4NSXA 1UOQA 2HXCA 5FKQA 3I89A 5HE1B 4JSNC 3NVNA 4H5IA 2AGYA 4GQBB 4FA4D 2J57G 3SWSD 3W15A 4A08B 2CO0A 3OL2A 4O1QD 1TBGA 3KRWB 3JB9L 5FA5B 3ZDYA 3V9FA 4BUJC 4J73A 4JD2C 4D9SA 4RE6A 2H6NA 4AMZA 3N0DA 2IWFA 5M5RA 4ZOXA 2P9KC 5EM2A 3MXXA 3RLMD 3EI3B 1U2VC 3JZHA 3L4OD 4NC4A 5FFGA 5K1CC 4BH6A 5FKRA 2GC4A 4E54B 2HU8A 4A2LA 4ZN4A 2CO0C 5GXIA 3L4MD 3V5WB 3IURA 4CZVA 4A11B 1M1XA 1PEVA 4L1MA 5E6SA 3NIDA 1E8MA 4NAAA 2XU7A 3IJ0A 1O6GA 3DWLC 4J82A 4GZ8A 3JZNA 3IVMA 4FAND 2I0RA 2BKLA 3DM0A 3NIGA 2HYEA 4FB1D 2CNXA 2EICA 5CXCA 1VE6A 5HYNB 3UVKA 5FQDA 2I0TA 2H9MA 3KRXB 3GREA 5JWZA 3VGZA 3C5MA 1OLZA 2YNPA 2HU7A 1SHYB 2VDNA 2XL3A 3I7OA 3MVDK 3I2NA 2H13A 3IIYA 5AMSA 4N14A 4LG9A 5EAMA 2PM9B 5CXBB 2AQ5A 4O2WA 3JRPA 4G56B 1XKSA 3SBPA 4G1EA 1A0RB 5M5VA 5IC7A 1O6FA 3GFCA 3A0FA 2YBAA 4CZYA 4ERZA 1JOFA 4CI8A 2H9PA 1H2WA 4QL1A 3IULA 3RSEC 5C2WB 2H9NA 2EIEA 5TEEA 1NR0A 3EQ7A 1PI6A 5I5MA 4RE5A 4PSXB 2P9UC 1GP2B 1N6DA 5HQGA 2YNNA 1I2MB 2QZPA 4AN1A 3EMHA 2P9PC 1B9YA 1K3IA 5H17A 3CFSB 4OZUA 4HDJA 5KDOB 3MUOA 4A0BA 4BP8A 5HDBA 4CY5A 3DDUA 3PSCB 4CY3A 2YNOA 1N6FA 3IKOA 4I79A 4JHPC 4X60B 4O9DA 4K3JB 3ULEC 4U1EI 3CFVA 4OWRA 5C9ZB 2TRCB 3JROA 3IUMA 4A09A 4A2MA 3AL8B 3SJLD 3OKYB 4UM8A 3SLED 4PNKB 4AMYA 2CE9A 3PXWD 2Z2PA 3FGBA 1VYHC 1MDAH 3I7NA 3SFZA 3UR4A 4X63B 3MZKA 2CN3A 4WK0A 3VA6A 3FRXA 2VDRA 4J8GA 3AFCA 3UKRC 2HKRA 2HU5A 3UVOA 3JZGA
chains in the Genus database with same CATH topology
3ZDYA 2VDMA 1JV2A 4Z7OA 2VC2A 4NENA 5E6UA 3K6SA 3ZE1A 4WK4A 3NIGA 4G1EA 2VDLA 2VDPA 4MMXA 5FFOA 4MMYA 4UM8A 3V4VA 4Z7NA 4UM9A 3K71A 4G1MA 3ZDXA 3V4PA 5FFGA 3K72A 5E6RA 4Z7QA 4IRZA 3FCUA 3FCSA 1TYEA 2VDQA 3T3PA 1L5GA 3NIFA 3VI3A 2VDOA 3IJEA 3T3MA 3VI4A 1M1XA 2VDNA 5HDBA 3ZE2A 4WK0A 4MMZA 3ZDZA 2VDKA 5E6SA 1U8CA 3NIDA 2VDRA 4WJKA 3ZE0A 4O02A 4WK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDY A;  2VDM A;  1JV2 A;  4Z7O A;  2VC2 A;  4NEN A;  5E6U A;  3K6S A;  3ZE1 A;  4WK4 A;  3NIG A;  4G1E A;  2VDL A;  2VDP A;  4MMX A;  5FFO A;  4MMY A;  4UM8 A;  3V4V A;  4Z7N A;  4UM9 A;  3K71 A;  4G1M A;  3ZDX A;  3V4P A;  5FFG A;  3K72 A;  5E6R A;  4Z7Q A;  4IRZ A;  3FCU A;  3FCS A;  1TYE A;  2VDQ A;  3T3P A;  1L5G A;  3NIF A;  3VI3 A;  2VDO A;  3IJE A;  3T3M A;  3VI4 A;  1M1X A;  2VDN A;  5HDB A;  3ZE2 A;  4WK0 A;  4MMZ A;  3ZDZ A;  2VDK A;  5E6S A;  1U8C A;  3NID A;  2VDR A;  4WJK A;  3ZE0 A;  4O02 A;  4WK2 A; 
#chains in the Genus database with same CATH topology
 2CE8 A;  2IUQ A;  4JT6 C;  4Z7O A;  2J55 H;  2QC5 A;  4J0X A;  2B4E A;  2VDL A;  4A11 A;  4AX4 A;  2H68 A;  4BP9 A;  4FA9 D;  1VZ2 A;  2HKM A;  4Z7Q A;  3QI0 A;  4JSP C;  4A0A A;  5EMK B;  4X61 B;  5CYK B;  3FM0 A;  4YVD A;  3RFH A;  3RFG A;  3MUN A;  2IUP A;  4G55 A;  4O45 A;  3ZE2 A;  4CY1 A;  2H47 A;  2P9N C;  3AH8 B;  4GGC A;  3SCY A;  3IUJ A;  4FA1 D;  4FAV D;  2B5N A;  3PVW B;  3J80 g;  3SBQ A;  4XEI C;  3V7D B;  4IMM A;  1JV2 A;  2PM6 B;  3ORV D;  5I5J A;  4GMB A;  3OL2 B;  4FA5 D;  3C75 H;  4QT8 A;  2I3T A;  4AOW A;  3JAM g;  2HJB A;  1VE7 A;  3EI1 A;  5TDH B;  4R7A B;  1TYE A;  3EU7 A;  3I7L A;  3T3P A;  3IJE A;  4UI9 R;  4Y7R A;  4E5Z A;  1H2Z A;  3ZDZ A;  3MKS B;  5FKS A;  1N6E A;  1UOO A;  5AJA A;  4ZOV A;  2CN2 A;  2UZX B;  2VZ1 A;  4JT5 C;  4QAM A;  1S4U X;  5I5I A;  4J77 A;  4DNW A;  4ERY A;  3F3G A;  4PBY A;  4BCC A;  3K6S A;  4X3E A;  4LG8 A;  2EIB A;  3ZWL B;  3V4P A;  3O4H A;  5H14 A;  5IGO A;  5E6R A;  4CC9 A;  4CI1 A;  5GXH A;  4A7J A;  4Z8L A;  2HES X;  1E8N A;  2Z2O A;  3NIF A;  1GOT B;  3GC3 B;  3P4F A;  2YMU A;  2H9L A;  3NVX A;  4MMZ A;  2OK4 A;  2B5M A;  3B7F A;  3O4G A;  3I8E A;  1U4C A;  4WJK A;  3SBR A;  3RN0 D;  3EWE A;  4WK2 A;  4XYH A;  2BBK H;  3EI4 B;  2VDM A;  1K8K C;  3GD1 I;  4NEN A;  2GNQ A;  4MMX A;  2VDP A;  1JMZ B;  4MMY A;  3K71 A;  3BG0 A;  4LGN A;  3IIW A;  4IRZ A;  4ZOY A;  2J56 H;  2H14 A;  3OW8 A;  1MG2 A;  4H5J A;  4FHL A;  3AL8 A;  4GM3 A;  2GC7 A;  3PXS D;  4J87 A;  2OVQ B;  3IJ1 A;  1GOF A;  4GGD A;  4J86 A;  5E6U A;  5TEF A;  1YR2 A;  2PBI B;  5M5S A;  5FFO A;  3PSL A;  2XL2 A;  4D6V A;  5AFU 3;  5EMM B;  3RN1 D;  2IUV A;  4A08 A;  4G1M A;  5HE0 B;  5IJ7 E;  3EG6 A;  5IJ8 E;  2OK6 A;  1C9I A;  1GOG A;  2G9A A;  3FCU A;  1L5G A;  3MKQ A;  3E0C A;  3PXT D;  4CI2 A;  4PC0 A;  4QQE A;  2Z2N A;  1XIP A;  5FKT A;  2P9L C;  3BWS A;  1QFM A;  5GSA A;  4J79 A;  5M61 A;  2P9S C;  3EQ9 A;  4GQ2 P;  2B5L A;  3EI3 A;  3J81 g;  2HJ4 A;  2MTA H;  4E54 A;  1RI6 A;  3ZE1 A;  4GM8 A;  3QHY B;  1MG3 A;  4AN0 A;  2AGL A;  2VZ3 A;  4J81 A;  1VZ3 A;  1Q47 A;  3IJC A;  5EAP A;  5H1M A;  3EI2 B;  4A09 B;  3VI4 A;  2YB8 B;  4FWW A;  5EMJ B;  1GG2 B;  4L3H D;  3SXT D;  2VDK A;  4ZOZ A;  3SN6 B;  1K32 A;  1XHM A;  4O02 A;  4JXM A;  2H3X A;  3SVW D;  3UVN A;  2AGZ A;  2IAA A;  3DXM C;  3OF7 A;  4PBZ A;  2PM7 B;  1UOP A;  1FWX A;  1R5M A;  3F3F A;  3I7P A;  1PGU A;  3I7H A;  5FXY A;  3C9C A;  3O4J A;  4UM9 A;  3ODT A;  4KFM B;  3RMZ D;  2O9K A;  3C99 A;  1JTD B;  5EAL A;  5HE2 B;  5M5U A;  4TZ4 A;  2VDO A;  5A2Q g;  2PM9 A;  5EM2 B;  1H2Y A;  4GM9 A;  5CXB A;  1PBY B;  3BG1 A;  3DXK C;  3UVL A;  4A0A B;  3OTT A;  3I7K A;  3UKU C;  4L1Q D;  3DSM A;  4MK0 B;  5B4W A;  4BCD A;  3U4Y A;  3RRM C;  1SQJ A;  2P9I C;  1L0Q A;  4WK4 A;  2I0S A;  4ERQ A;  2W18 A;  3K72 A;  1SQ9 A;  2EBS A;  3CIK B;  3PE7 A;  3PVU B;  4CI3 A;  3EI4 A;  1QNI A;  3OKW A;  4BL0 A;  1GOH A;  2OVR B;  2XZG A;  1A12 A;  2XDW A;  3EI1 B;  5CXC B;  4DNU A;  1ERJ A;  5FLX g;  4PXW A;  4J84 A;  2OJY A;  1BPO A;  3OKT A;  2QXV A;  4GGA A;  3EQ8 A;  4E5Z B;  3F3P A;  1UTC A;  5HE3 B;  2Q7Q A;  3HFQ A;  2AGW A;  2EID A;  3AL9 A;  5K19 A;  4J78 A;  2I3S A;  4L3G D;  4PSW B;  1H2X A;  3I8C A;  5EML B;  4CZX A;  2OIZ A;  2XYI A;  3FCS A;  2H6Q A;  3VI3 A;  3T3M A;  3N0E A;  1E5T A;  3VH0 A;  3O4I A;  1GXR A;  1T2X A;  3IUQ A;  5IGQ A;  3IUN A;  1U8C A;  3OKY A;  1P22 A;  4K3I D;  3ZE0 A;  1C9L A;  3NVQ A;  4D0K A;  4J8B A;  2BCJ B;  1QFS A;  4J0W A;  2IWK A;  4O3T B;  3SMR A;  5GMK n;  2AH1 A;  2VC2 A;  3MMY A;  1JJU B;  2IUR A;  4AEZ A;  5EAR A;  2OVP B;  1YFQ A;  5SXM A;  3MZL A;  1JMX B;  4DNV A;  4GQ1 A;  4Z7N A;  3ZDX A;  5C92 A;  1B9X A;  2QR5 A;  3K26 A;  1OMW B;  2G99 A;  4U7A A;  5M5T A;  2VDQ A;  2XE4 A;  4L9O A;  4NBM A;  3JPX A;  4ESG A;  2UZY B;  4BCB A;  3UVM A;  4IA9 A;  4CY2 A;  2H6K A;  5C2V B;  4XYI A;  3KCI A;  2AGX A;  5TF2 A;  4EWR A;  2AH0 A;  1NEX B;  4JSV C;  1TYQ C;  4JSX C;  4O3U B;  3K27 A;  3SHF A;  4ES0 A;  4QRJ A;  3EI2 A;  4A0B B;  5THA A;  4JHN A;  5IT9 g;  2JKX A;  5CYK A;  5C86 A;  2WQ8 A;  3V4V A;  4Y5R D;  4NSX A;  1UOQ A;  2HXC A;  5FKQ A;  3I89 A;  5HE1 B;  4JSN C;  3NVN A;  4H5I A;  2AGY A;  4GQB B;  4FA4 D;  2J57 G;  3SWS D;  3W15 A;  4A08 B;  2CO0 A;  3OL2 A;  4O1Q D;  1TBG A;  3KRW B;  3JB9 L;  5FA5 B;  3ZDY A;  3V9F A;  4BUJ C;  4J73 A;  4JD2 C;  4D9S A;  4RE6 A;  2H6N A;  4AMZ A;  3N0D A;  2IWF A;  5M5R A;  4ZOX A;  2P9K C;  5EM2 A;  3MXX A;  3RLM D;  3EI3 B;  1U2V C;  3JZH A;  3L4O D;  4NC4 A;  5FFG A;  5K1C C;  4BH6 A;  5FKR A;  2GC4 A;  4E54 B;  2HU8 A;  4A2L A;  4ZN4 A;  2CO0 C;  5GXI A;  3L4M D;  3V5W B;  3IUR A;  4CZV A;  4A11 B;  1M1X A;  1PEV A;  4L1M A;  5E6S A;  3NID A;  1E8M A;  4NAA A;  2XU7 A;  3IJ0 A;  1O6G A;  3DWL C;  4J82 A;  4GZ8 A;  3JZN A;  3IVM A;  4FAN D;  2I0R A;  2BKL A;  3DM0 A;  3NIG A;  2HYE A;  4FB1 D;  2CNX A;  2EIC A;  5CXC A;  1VE6 A;  5HYN B;  3UVK A;  5FQD A;  2I0T A;  2H9M A;  3KRX B;  3GRE A;  5JWZ A;  3VGZ A;  3C5M A;  1OLZ A;  2YNP A;  2HU7 A;  1SHY B;  2VDN A;  2XL3 A;  3I7O A;  3MVD K;  3I2N A;  2H13 A;  3IIY A;  5AMS A;  4N14 A;  4LG9 A;  5EAM A;  2PM9 B;  5CXB B;  2AQ5 A;  4O2W A;  3JRP A;  4G56 B;  1XKS A;  3SBP A;  4G1E A;  1A0R B;  5M5V A;  5IC7 A;  1O6F A;  3GFC A;  3A0F A;  2YBA A;  4CZY A;  4ERZ A;  1JOF A;  4CI8 A;  2H9P A;  1H2W A;  4QL1 A;  3IUL A;  3RSE C;  5C2W B;  2H9N A;  2EIE A;  5TEE A;  1NR0 A;  3EQ7 A;  1PI6 A;  5I5M A;  4RE5 A;  4PSX B;  2P9U C;  1GP2 B;  1N6D A;  5HQG A;  2YNN A;  1I2M B;  2QZP A;  4AN1 A;  3EMH A;  2P9P C;  1B9Y A;  1K3I A;  5H17 A;  3CFS B;  4OZU A;  4HDJ A;  5KDO B;  3MUO A;  4A0B A;  4BP8 A;  5HDB A;  4CY5 A;  3DDU A;  3PSC B;  4CY3 A;  2YNO A;  1N6F A;  3IKO A;  4I79 A;  4JHP C;  4X60 B;  4O9D A;  4K3J B;  3ULE C;  4U1E I;  3CFV A;  4OWR A;  5C9Z B;  2TRC B;  3JRO A;  3IUM A;  4A09 A;  4A2M A;  3AL8 B;  3SJL D;  3OKY B;  4UM8 A;  3SLE D;  4PNK B;  4AMY A;  2CE9 A;  3PXW D;  2Z2P A;  3FGB A;  1VYH C;  1MDA H;  3I7N A;  3SFZ A;  3UR4 A;  4X63 B;  3MZK A;  2CN3 A;  4WK0 A;  3VA6 A;  3FRX A;  2VDR A;  4J8G A;  3AFC A;  3UKR C;  2HKR A;  2HU5 A;  3UVO A;  3JZG A; 
#chains in the Genus database with same CATH homology
 3ZDY A;  2VDM A;  1JV2 A;  4Z7O A;  2VC2 A;  4NEN A;  5E6U A;  3K6S A;  3ZE1 A;  4WK4 A;  3NIG A;  4G1E A;  2VDL A;  2VDP A;  4MMX A;  5FFO A;  4MMY A;  4UM8 A;  3V4V A;  4Z7N A;  4UM9 A;  3K71 A;  4G1M A;  3ZDX A;  3V4P A;  5FFG A;  3K72 A;  5E6R A;  4Z7Q A;  4IRZ A;  3FCU A;  3FCS A;  1TYE A;  2VDQ A;  3T3P A;  1L5G A;  3NIF A;  3VI3 A;  2VDO A;  3IJE A;  3T3M A;  3VI4 A;  1M1X A;  2VDN A;  5HDB A;  3ZE2 A;  4WK0 A;  4MMZ A;  3ZDZ A;  2VDK A;  5E6S A;  1U8C A;  3NID A;  2VDR A;  4WJK A;  3ZE0 A;  4O02 A;  4WK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...