1TYEA

Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRAEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
total genus 98
structure length 452
sequence length 452
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 1tyeA00
3IJEA 3FCUA 4IRZA 3NIGA 5E6SA 4UM9A 3ZDZA 3K72A 3FCSA 3V4PA 2VDOA 1U8CA 4G1MA 4WJKA 3K6SA 4UM8A 2VDQA 3ZE2A 4MMZA 2VDKA 3ZE1A 3K71A 4G1EA 2VDRA 4MMXA 1JV2A 2VDMA 4WK0A 4WK2A 5E6RA 1TYEA 3V4VA 4MMYA 5E6UA 4Z7NA 5FFOA 1M1XA 5HDBA 3VI4A 3NIFA 4WK4A 5FFGA 3ZE0A 2VDNA 4O02A 3T3PA 2VDPA 3NIDA 4NENA 3T3MA 3ZDYA 1L5GA 4Z7QA 2VC2A 3VI3A 3ZDXA 4Z7OA 2VDLA
chains in the Genus database with same CATH superfamily
3NVQA 3F3FA 2PM7B 3OL2A 1S4UX 4G1MA 1VE6A 4E5ZB 2IUQA 2HJ4A 2VDMA 3L4OD 5EARA 1Q47A 4FWWA 1RI6A 3JAMg 4JT5C 5FFOA 4J81A 3UVOA 4CY3A 4HDJA 3QI0A 5GXIA 1VZ2A 1L5GA 1UOPA 3VI4A 5EMMB 2XZGA 1TYQC 2AQ5A 2O9KA 1B9XA 4G55A 4J77A 4Y5RD 2Z2PA 4GGCA 5M5SA 3EMHA 4L3GD 3FM0A 4J82A 3ZE1A 4O9DA 2GC7A 3I89A 4J84A 2HJBA 4JT6C 2TRCB 2AGZA 4L9OA 3I7HA 4XYIA 3MZKA 5AMSA 4ERQA 3MMYA 3GD1I 3GC3B 4CI2A 2OVPB 2G9AA 1A0RB 2P9NC 5AJAA 4AN1A 2H3XA 5FXYA 5EM2A 4Z7QA 4UI9R 3AFCA 3FRXA 4NAAA 4ZOXA 4FHLA 4CY2A 1FWXA 4J86A 3CFVA 1GXRA 3EQ8A 2P9PC 2P9SC 4MMXA 2GC4A 5GXHA 2CN2A 4KFMB 4A0AB 5C2WB 4XYHA 4BL0A 4E5ZA 4JSNC 3I2NA 2AGWA 1A12A 2I0SA 3N0EA 3GREA 2HKRA 1GOHA 4CC9A 2UZXB 3ORVD 3N0DA 3SMRA 2H9MA 2IWKA 2J56H 4CZYA 3JZGA 2OK4A 2H6QA 2YBAA 2XE4A 4O1QD 3U4YA 4XEIC 2H6NA 3SCYA 2HU5A 4GGAA 2XDWA 3RFHA 4RE5A 1JJUB 5IGQA 3FGBA 4WK2A 5FKSA 1JMXB 3IUMA 3O4IA 4JHPC 5TEFA 4NC4A 5HDBA 3SN6B 4BP8A 4J87A 3SVWD 3OL2B 3PVWB 2AGLA 2EBSA 4A0AA 3VGZA 3IJCA 3V9FA 4CZVA 3IJEA 1MDAH 1BPOA 4MK0B 4NBMA 3KCIA 4J8BA 1C9LA 4DNVA 2B4EA 4X61B 3K26A 4ZN4A 2B5MA 3W15A 3EI4B 4A2LA 2YMUA 5HE0B 4GQBB 2AGYA 4X3EA 2PM6B 2IURA 1YFQA 1MG2A 3ZDYA 1GOFA 4ES0A 4LG8A 1K32A 3SBRA 1VE7A 2OJYA 3SBPA 5FLXg 2J57G 4BCBA 3EI2A 4OWRA 3RFGA 4J78A 4UM9A 3ODTA 5TDHB 5C9ZB 1U8CA 4WJKA 2IUPA 4G56B 5H14A 4GM8A 1O6FA 1XIPA 4IA9A 3SBQA 4L1QD 4U7AA 5M5RA 1U2VC 3UR4A 3BWSA 3UVNA 4GQ1A 3EI3B 2OVQB 5EAPA 1QFMA 1VZ3A 3NIFA 4CI8A 4RE6A 2AH1A 4O3UB 1E8NA 5I5IA 1GOGA 1XKSA 2VC2A 2QXVA 3AH8B 3L4MD 4FB1D 5THAA 4DNUA 3MKQA 1OMWB 5AFU3 1K8KC 3IVMA 2I3SA 4QAMA 2HESX 1R5MA 4BP9A 3K6SA 3I8EA 2VZ3A 3F3GA 2BKLA 3IJ1A 4G1EA 4K3JB 4ERYA 4QRJA 3DSMA 3UKRC 3IUNA 4MMYA 5B4WA 3RN1D 5CYKA 4PBYA 4O2WA 4JSXC 3T3MA 2XYIA 3DDUA 3VI3A 1GG2B 2IUVA 3ZWLB 3EQ9A 5GMKn 2YNNA 4IRZA 5JWZA 3E0CA 3NVXA 3MXXA 1SQJA 4H5JA 2AGXA 5FQDA 2W18A 2CE9A 4UM8A 4A2MA 1YR2A 3IULA 4L3HD 2VZ1A 4GGDA 2G99A 3C75H 3OKTA 3AL8A 1TYEA 3I8CA 5TF2A 5M5UA 4NSXA 5I5JA 3C9CA 3I7LA 1C9IA 2H14A 1H2XA 4GM3A 3NIDA 4NENA 2EICA 2I0TA 3RMZD 2H13A 5IJ7E 5K1CC 4CY1A 3IJ0A 3FCUA 4K3ID 5HE3B 2EIEA 2P9UC 4BH6A 4A08B 4AMYA 4CI1A 1PGUA 3JROA 1GP2B 3PVUB 4A09B 3OKYA 2I3TA 1B9YA 4R7AB 5H17A 4DNWA 2VDKA 1H2ZA 4FAVD 4D0KA 3OW8A 1MG3A 3EG6A 2OVRB 3MKSB 5E6UA 4Z7NA 5KDOB 4WK4A 3ZE0A 3MZLA 2IAAA 1E5TA 2PM9B 5I5MA 4LGNA 3I7KA 3EWEA 4J73A 2BCJB 1NEXB 4JD2C 4Z7OA 4PXWA 4J79A 4BCDA 3A0FA 1L0QA 3SLED 1N6FA 3V4PA 4TZ4A 5CYKB 1SQ9A 2CO0A 5HQGA 4FA4D 2P9LC 2QC5A 2BBKH 3PSCB 4PSXB 3V4VA 4ZOVA 3O4HA 3PE7A 2B5LA 5FA5B 1UTCA 3VA6A 3IIYA 1TBGA 2QZPA 5EALA 5IT9g 5FKQA 1UOQA 3EI2B 5EMJB 3AL8B 3ZDXA 4X63B 3J80g 4J0WA 3B7FA 5C2VB 5M5VA 5IJ8E 4H5IA 4IMMA 2HXCA 3FCSA 3PXWD 2JKXA 3RLMD 2HYEA 2HU8A 2I0RA 4A08A 2VDRA 4X60B 2YB8B 4N14A 5HE2B 3K27A 2H9PA 5A2Qg 5FKRA 3CIKB 4A11A 3EI1B 4L1MA 5CXCA 3JZNA 2OIZA 3MVDK 3I7PA 4BUJC 3SXTD 4A0BA 1QFSA 2Z2NA 3IUJA 4OZUA 5SXMA 1O6GA 2EIDA 3NIGA 3UVMA 2VDQA 3BG1A 4Y7RA 4ZOZA 3DXKC 1JV2A 4JSPC 3VH0A 4AOWA 4FA9D 2AH0A 1M1XA 3QHYB 3P4FA 5HE1B 3V7DB 1XHMA 2P9KC 4PNKB 1H2WA 3JZHA 3SWSD 5FKTA 1ERJA 3V5WB 4CI3A 3JPXA 1SHYB 4Z8LA 2CO0C 5C86A 5CXCB 1I2MB 4JSVC 5CXBB 3IKOA 3J81g 3EI1A 4JHNA 2VDOA 3SFZA 1QNIA 4I79A 3GFCA 4D6VA 5HYNB 1JMZB 5C92A 4U1EI 1GOTB 1PEVA 3F3PA 4ESGA 3ULEC 2VDNA 1K3IA 2H47A 1P22A 3UKUC 3DXMC 3I7OA 3PSLA 2HKMA 1VYHC 5TEEA 4O45A 1U4CA 4BCCA 2H6KA 3SJLD 3JB9L 5M5TA 4YVDA 4QT8A 2GNQA 4O3TB 3DWLC 4ZOYA 5CXBA 3CFSB 4FA1D 1OLZA 3K71A 5K19A 1UOOA 4PSWB 5IGOA 2IWFA 2CN3A 3RSEC 5EMLB 2H9NA 3HFQA 4J0XA 3IURA 4GZ8A 2Z2OA 2B5NA 2PM9A 3RN0D 3EQ7A 4FAND 3O4GA 2YNPA 2UZYB 3PXTD 2VDPA 3UVKA 3SHFA 2CNXA 1NR0A 3MUOA 2J55H 5IC7A 1H2YA 2HU7A 3MUNA 2VDLA 3I7NA 5H1MA 2PBIB 5EM2B 3OKWA 3PXSD 4AX4A 3ZDZA 3O4JA 3OF7A 5GSAA 3EI3A 3ZE2A 3IIWA 3EI4A 4D9SA 3EU7A 4J8GA 2H68A 1PBYB 2EIBA 4QL1A 1PI6A 2CE8A 4E54B 3KRWB 4GM9A 4A09A 4LG9A 3C5MA 3BG0A 4AN0A 2OK6A 2XL2A 3T3PA 3UVLA 4CZXA 5EMKB 4ERZA 1JOFA 4GMBA 2QR5A 3KRXB 1N6EA 3NVNA 5E6SA 3K72A 1T2XA 4AEZA 2YNOA 1E8MA 2Q7QA 3JRPA 4MMZA 2H9LA 3RRMC 4WK0A 5M61A 3C99A 5E6RA 3AL9A 4QQEA 1JTDB 3DM0A 4PC0A 3OKYB 1N6DA 5FFGA 4JXMA 4A11B 2P9IC 3IUQA 4PBZA 4GQ2P 4FA5D 4O02A 3OTTA 4A7JA 4E54A 2XU7A 2WQ8A 2MTAH 2XL3A 4CY5A 5EAMA 4AMZA 4A0BB 4EWRA
chains in the Genus database with same CATH topology
3IJEA 3FCUA 4IRZA 3NIGA 5E6SA 4UM9A 3ZDZA 3K72A 3FCSA 3V4PA 2VDOA 1U8CA 4G1MA 4WJKA 3K6SA 4UM8A 2VDQA 3ZE2A 4MMZA 2VDKA 3ZE1A 3K71A 4G1EA 2VDRA 4MMXA 1JV2A 2VDMA 4WK0A 4WK2A 5E6RA 1TYEA 3V4VA 4MMYA 5E6UA 4Z7NA 5FFOA 1M1XA 5HDBA 3VI4A 3NIFA 4WK4A 5FFGA 3ZE0A 2VDNA 4O02A 3T3PA 2VDPA 3NIDA 4NENA 3T3MA 3ZDYA 1L5GA 4Z7QA 2VC2A 3VI3A 3ZDXA 4Z7OA 2VDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJE A;  3FCU A;  4IRZ A;  3NIG A;  5E6S A;  4UM9 A;  3ZDZ A;  3K72 A;  3FCS A;  3V4P A;  2VDO A;  1U8C A;  4G1M A;  4WJK A;  3K6S A;  4UM8 A;  2VDQ A;  3ZE2 A;  4MMZ A;  2VDK A;  3ZE1 A;  3K71 A;  4G1E A;  2VDR A;  4MMX A;  1JV2 A;  2VDM A;  4WK0 A;  4WK2 A;  5E6R A;  1TYE A;  3V4V A;  4MMY A;  5E6U A;  4Z7N A;  5FFO A;  1M1X A;  5HDB A;  3VI4 A;  3NIF A;  4WK4 A;  5FFG A;  3ZE0 A;  2VDN A;  4O02 A;  3T3P A;  2VDP A;  3NID A;  4NEN A;  3T3M A;  3ZDY A;  1L5G A;  4Z7Q A;  2VC2 A;  3VI3 A;  3ZDX A;  4Z7O A;  2VDL A; 
#chains in the Genus database with same CATH topology
 3NVQ A;  3F3F A;  2PM7 B;  3OL2 A;  1S4U X;  4G1M A;  1VE6 A;  4E5Z B;  2IUQ A;  2HJ4 A;  2VDM A;  3L4O D;  5EAR A;  1Q47 A;  4FWW A;  1RI6 A;  3JAM g;  4JT5 C;  5FFO A;  4J81 A;  3UVO A;  4CY3 A;  4HDJ A;  3QI0 A;  5GXI A;  1VZ2 A;  1L5G A;  1UOP A;  3VI4 A;  5EMM B;  2XZG A;  1TYQ C;  2AQ5 A;  2O9K A;  1B9X A;  4G55 A;  4J77 A;  4Y5R D;  2Z2P A;  4GGC A;  5M5S A;  3EMH A;  4L3G D;  3FM0 A;  4J82 A;  3ZE1 A;  4O9D A;  2GC7 A;  3I89 A;  4J84 A;  2HJB A;  4JT6 C;  2TRC B;  2AGZ A;  4L9O A;  3I7H A;  4XYI A;  3MZK A;  5AMS A;  4ERQ A;  3MMY A;  3GD1 I;  3GC3 B;  4CI2 A;  2OVP B;  2G9A A;  1A0R B;  2P9N C;  5AJA A;  4AN1 A;  2H3X A;  5FXY A;  5EM2 A;  4Z7Q A;  4UI9 R;  3AFC A;  3FRX A;  4NAA A;  4ZOX A;  4FHL A;  4CY2 A;  1FWX A;  4J86 A;  3CFV A;  1GXR A;  3EQ8 A;  2P9P C;  2P9S C;  4MMX A;  2GC4 A;  5GXH A;  2CN2 A;  4KFM B;  4A0A B;  5C2W B;  4XYH A;  4BL0 A;  4E5Z A;  4JSN C;  3I2N A;  2AGW A;  1A12 A;  2I0S A;  3N0E A;  3GRE A;  2HKR A;  1GOH A;  4CC9 A;  2UZX B;  3ORV D;  3N0D A;  3SMR A;  2H9M A;  2IWK A;  2J56 H;  4CZY A;  3JZG A;  2OK4 A;  2H6Q A;  2YBA A;  2XE4 A;  4O1Q D;  3U4Y A;  4XEI C;  2H6N A;  3SCY A;  2HU5 A;  4GGA A;  2XDW A;  3RFH A;  4RE5 A;  1JJU B;  5IGQ A;  3FGB A;  4WK2 A;  5FKS A;  1JMX B;  3IUM A;  3O4I A;  4JHP C;  5TEF A;  4NC4 A;  5HDB A;  3SN6 B;  4BP8 A;  4J87 A;  3SVW D;  3OL2 B;  3PVW B;  2AGL A;  2EBS A;  4A0A A;  3VGZ A;  3IJC A;  3V9F A;  4CZV A;  3IJE A;  1MDA H;  1BPO A;  4MK0 B;  4NBM A;  3KCI A;  4J8B A;  1C9L A;  4DNV A;  2B4E A;  4X61 B;  3K26 A;  4ZN4 A;  2B5M A;  3W15 A;  3EI4 B;  4A2L A;  2YMU A;  5HE0 B;  4GQB B;  2AGY A;  4X3E A;  2PM6 B;  2IUR A;  1YFQ A;  1MG2 A;  3ZDY A;  1GOF A;  4ES0 A;  4LG8 A;  1K32 A;  3SBR A;  1VE7 A;  2OJY A;  3SBP A;  5FLX g;  2J57 G;  4BCB A;  3EI2 A;  4OWR A;  3RFG A;  4J78 A;  4UM9 A;  3ODT A;  5TDH B;  5C9Z B;  1U8C A;  4WJK A;  2IUP A;  4G56 B;  5H14 A;  4GM8 A;  1O6F A;  1XIP A;  4IA9 A;  3SBQ A;  4L1Q D;  4U7A A;  5M5R A;  1U2V C;  3UR4 A;  3BWS A;  3UVN A;  4GQ1 A;  3EI3 B;  2OVQ B;  5EAP A;  1QFM A;  1VZ3 A;  3NIF A;  4CI8 A;  4RE6 A;  2AH1 A;  4O3U B;  1E8N A;  5I5I A;  1GOG A;  1XKS A;  2VC2 A;  2QXV A;  3AH8 B;  3L4M D;  4FB1 D;  5THA A;  4DNU A;  3MKQ A;  1OMW B;  5AFU 3;  1K8K C;  3IVM A;  2I3S A;  4QAM A;  2HES X;  1R5M A;  4BP9 A;  3K6S A;  3I8E A;  2VZ3 A;  3F3G A;  2BKL A;  3IJ1 A;  4G1E A;  4K3J B;  4ERY A;  4QRJ A;  3DSM A;  3UKR C;  3IUN A;  4MMY A;  5B4W A;  3RN1 D;  5CYK A;  4PBY A;  4O2W A;  4JSX C;  3T3M A;  2XYI A;  3DDU A;  3VI3 A;  1GG2 B;  2IUV A;  3ZWL B;  3EQ9 A;  5GMK n;  2YNN A;  4IRZ A;  5JWZ A;  3E0C A;  3NVX A;  3MXX A;  1SQJ A;  4H5J A;  2AGX A;  5FQD A;  2W18 A;  2CE9 A;  4UM8 A;  4A2M A;  1YR2 A;  3IUL A;  4L3H D;  2VZ1 A;  4GGD A;  2G99 A;  3C75 H;  3OKT A;  3AL8 A;  1TYE A;  3I8C A;  5TF2 A;  5M5U A;  4NSX A;  5I5J A;  3C9C A;  3I7L A;  1C9I A;  2H14 A;  1H2X A;  4GM3 A;  3NID A;  4NEN A;  2EIC A;  2I0T A;  3RMZ D;  2H13 A;  5IJ7 E;  5K1C C;  4CY1 A;  3IJ0 A;  3FCU A;  4K3I D;  5HE3 B;  2EIE A;  2P9U C;  4BH6 A;  4A08 B;  4AMY A;  4CI1 A;  1PGU A;  3JRO A;  1GP2 B;  3PVU B;  4A09 B;  3OKY A;  2I3T A;  1B9Y A;  4R7A B;  5H17 A;  4DNW A;  2VDK A;  1H2Z A;  4FAV D;  4D0K A;  3OW8 A;  1MG3 A;  3EG6 A;  2OVR B;  3MKS B;  5E6U A;  4Z7N A;  5KDO B;  4WK4 A;  3ZE0 A;  3MZL A;  2IAA A;  1E5T A;  2PM9 B;  5I5M A;  4LGN A;  3I7K A;  3EWE A;  4J73 A;  2BCJ B;  1NEX B;  4JD2 C;  4Z7O A;  4PXW A;  4J79 A;  4BCD A;  3A0F A;  1L0Q A;  3SLE D;  1N6F A;  3V4P A;  4TZ4 A;  5CYK B;  1SQ9 A;  2CO0 A;  5HQG A;  4FA4 D;  2P9L C;  2QC5 A;  2BBK H;  3PSC B;  4PSX B;  3V4V A;  4ZOV A;  3O4H A;  3PE7 A;  2B5L A;  5FA5 B;  1UTC A;  3VA6 A;  3IIY A;  1TBG A;  2QZP A;  5EAL A;  5IT9 g;  5FKQ A;  1UOQ A;  3EI2 B;  5EMJ B;  3AL8 B;  3ZDX A;  4X63 B;  3J80 g;  4J0W A;  3B7F A;  5C2V B;  5M5V A;  5IJ8 E;  4H5I A;  4IMM A;  2HXC A;  3FCS A;  3PXW D;  2JKX A;  3RLM D;  2HYE A;  2HU8 A;  2I0R A;  4A08 A;  2VDR A;  4X60 B;  2YB8 B;  4N14 A;  5HE2 B;  3K27 A;  2H9P A;  5A2Q g;  5FKR A;  3CIK B;  4A11 A;  3EI1 B;  4L1M A;  5CXC A;  3JZN A;  2OIZ A;  3MVD K;  3I7P A;  4BUJ C;  3SXT D;  4A0B A;  1QFS A;  2Z2N A;  3IUJ A;  4OZU A;  5SXM A;  1O6G A;  2EID A;  3NIG A;  3UVM A;  2VDQ A;  3BG1 A;  4Y7R A;  4ZOZ A;  3DXK C;  1JV2 A;  4JSP C;  3VH0 A;  4AOW A;  4FA9 D;  2AH0 A;  1M1X A;  3QHY B;  3P4F A;  5HE1 B;  3V7D B;  1XHM A;  2P9K C;  4PNK B;  1H2W A;  3JZH A;  3SWS D;  5FKT A;  1ERJ A;  3V5W B;  4CI3 A;  3JPX A;  1SHY B;  4Z8L A;  2CO0 C;  5C86 A;  5CXC B;  1I2M B;  4JSV C;  5CXB B;  3IKO A;  3J81 g;  3EI1 A;  4JHN A;  2VDO A;  3SFZ A;  1QNI A;  4I79 A;  3GFC A;  4D6V A;  5HYN B;  1JMZ B;  5C92 A;  4U1E I;  1GOT B;  1PEV A;  3F3P A;  4ESG A;  3ULE C;  2VDN A;  1K3I A;  2H47 A;  1P22 A;  3UKU C;  3DXM C;  3I7O A;  3PSL A;  2HKM A;  1VYH C;  5TEE A;  4O45 A;  1U4C A;  4BCC A;  2H6K A;  3SJL D;  3JB9 L;  5M5T A;  4YVD A;  4QT8 A;  2GNQ A;  4O3T B;  3DWL C;  4ZOY A;  5CXB A;  3CFS B;  4FA1 D;  1OLZ A;  3K71 A;  5K19 A;  1UOO A;  4PSW B;  5IGO A;  2IWF A;  2CN3 A;  3RSE C;  5EML B;  2H9N A;  3HFQ A;  4J0X A;  3IUR A;  4GZ8 A;  2Z2O A;  2B5N A;  2PM9 A;  3RN0 D;  3EQ7 A;  4FAN D;  3O4G A;  2YNP A;  2UZY B;  3PXT D;  2VDP A;  3UVK A;  3SHF A;  2CNX A;  1NR0 A;  3MUO A;  2J55 H;  5IC7 A;  1H2Y A;  2HU7 A;  3MUN A;  2VDL A;  3I7N A;  5H1M A;  2PBI B;  5EM2 B;  3OKW A;  3PXS D;  4AX4 A;  3ZDZ A;  3O4J A;  3OF7 A;  5GSA A;  3EI3 A;  3ZE2 A;  3IIW A;  3EI4 A;  4D9S A;  3EU7 A;  4J8G A;  2H68 A;  1PBY B;  2EIB A;  4QL1 A;  1PI6 A;  2CE8 A;  4E54 B;  3KRW B;  4GM9 A;  4A09 A;  4LG9 A;  3C5M A;  3BG0 A;  4AN0 A;  2OK6 A;  2XL2 A;  3T3P A;  3UVL A;  4CZX A;  5EMK B;  4ERZ A;  1JOF A;  4GMB A;  2QR5 A;  3KRX B;  1N6E A;  3NVN A;  5E6S A;  3K72 A;  1T2X A;  4AEZ A;  2YNO A;  1E8M A;  2Q7Q A;  3JRP A;  4MMZ A;  2H9L A;  3RRM C;  4WK0 A;  5M61 A;  3C99 A;  5E6R A;  3AL9 A;  4QQE A;  1JTD B;  3DM0 A;  4PC0 A;  3OKY B;  1N6D A;  5FFG A;  4JXM A;  4A11 B;  2P9I C;  3IUQ A;  4PBZ A;  4GQ2 P;  4FA5 D;  4O02 A;  3OTT A;  4A7J A;  4E54 A;  2XU7 A;  2WQ8 A;  2MTA H;  2XL3 A;  4CY5 A;  5EAM A;  4AMZ A;  4A0B B;  4EWR A; 
#chains in the Genus database with same CATH homology
 3IJE A;  3FCU A;  4IRZ A;  3NIG A;  5E6S A;  4UM9 A;  3ZDZ A;  3K72 A;  3FCS A;  3V4P A;  2VDO A;  1U8C A;  4G1M A;  4WJK A;  3K6S A;  4UM8 A;  2VDQ A;  3ZE2 A;  4MMZ A;  2VDK A;  3ZE1 A;  3K71 A;  4G1E A;  2VDR A;  4MMX A;  1JV2 A;  2VDM A;  4WK0 A;  4WK2 A;  5E6R A;  1TYE A;  3V4V A;  4MMY A;  5E6U A;  4Z7N A;  5FFO A;  1M1X A;  5HDB A;  3VI4 A;  3NIF A;  4WK4 A;  5FFG A;  3ZE0 A;  2VDN A;  4O02 A;  3T3P A;  2VDP A;  3NID A;  4NEN A;  3T3M A;  3ZDY A;  1L5G A;  4Z7Q A;  2VC2 A;  3VI3 A;  3ZDX A;  4Z7O A;  2VDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...