1TYEA

Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRAEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 98
structure length 452
sequence length 452
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 1tyeA00
4MMXA 3NIGA 2VDLA 3FCUA 4NENA 5HDBA 3ZE2A 2VDOA 4WK4A 2VDRA 4IRZA 4MMYA 3ZDXA 1JV2A 3ZE1A 1TYEA 4Z7OA 2VDKA 4MMZA 4Z7QA 1L5GA 3ZE0A 5FFOA 3K72A 3IJEA 5E6UA 4G1EA 4G1MA 3NIDA 5FFGA 2VDMA 4O02A 4WJKA 4UM8A 3ZDYA 4Z7NA 4WK0A 3VI4A 3V4PA 3T3PA 2VDQA 2VDPA 3T3MA 3K71A 2VC2A 3ZDZA 2VDNA 3FCSA 3VI3A 3K6SA 1M1XA 5E6RA 5E6SA 1U8CA 4UM9A 4WK2A 3V4VA 3NIFA
chains in the Genus database with same CATH superfamily
4MMXA 4AX4A 4EWRA 4GQ2P 4WK4A 4IRZA 1H2XA 2H9MA 2VDKA 3EI1B 2HJ4A 1FWXA 4L9OA 3OKTA 3BWSA 3DSMA 3EI3B 4JXMA 1A0RB 4FWWA 4A0AB 1N6EA 1OMWB 5EMKB 4PSWB 3SJLD 4UM8A 5EARA 2HKMA 5IJ8E 3I8EA 2J57G 2CE9A 3F3PA 1YFQA 3O4HA 4ERYA 2JKXA 4AEZA 2QZPA 4LGNA 5JWZA 3V4VA 5C2WB 3IUJA 5CXBB 3I7OA 3OW8A 4CY5A 3DXMC 5THAA 5FA5B 2O9KA 1R5MA 5EM2A 1N6FA 1PBYB 1U2VC 4FHLA 4Z7QA 2EICA 3V7DB 5AFU3 4X61B 3IJCA 4ERQA 2BKLA 4NSXA 4E5ZA 2AQ5A 5HQGA 4UI9R 2H9NA 3ZWLB 3T3MA 2I0RA 3SBQA 2WQ8A 4GQBB 2PM9B 5EAMA 3K6SA 1K32A 4JHNA 5GSAA 3P4FA 1JTDB 2VDLA 2G99A 1L0QA 1E5TA 2J55H 3ZE1A 1TYEA 3SCYA 1GP2B 1K3IA 2YB8B 3AH8B 3ZE0A 4CZVA 3JB9L 3JPXA 1A12A 4ZOVA 5TDHB 4AN1A 3I8CA 2VZ3A 4ZOYA 4PBYA 3OKWA 3IKOA 2B5MA 4A2MA 3SBRA 3ZDZA 3DDUA 2UZXB 2VDNA 3FM0A 3MZLA 1MG2A 4JD2C 3IJ0A 1PI6A 4NC4A 2HXCA 2IURA 5A2Qg 1SQ9A 5H14A 1GOGA 4XEIC 5IJ7E 3GREA 3RSEC 2YNNA 1VE7A 5TF2A 3F3FA 4YVDA 4X63B 1L5GA 1SQJA 4D6VA 5TEFA 3ODTA 3JZNA 3RFGA 3UR4A 4JT5C 5KDOB 2IUVA 3NIDA 2EBSA 4WK0A 5M5UA 4LG9A 4D0KA 3I7HA 3K71A 1K8KC 3V5WB 4DNVA 5M5SA 5E6SA 4PC0A 4J82A 3SLED 3J81g 2AGWA 5FLXg 3QI0A 1O6GA 3FCUA 5HDBA 3MKQA 3UKUC 5C86A 3MZKA 4A7JA 4OZUA 5AJAA 2GC7A 3IVMA 2H3XA 4G55A 5EMLB 5E6UA 5GXIA 3OL2B 4GMBA 4BCDA 3EI2A 4QL1A 4D9SA 3JZGA 3BG1A 4A08A 1MG3A 3GC3B 3C99A 3GFCA 4JSPC 3VI4A 3V4PA 1U4CA 3T3PA 3PXSD 3AL8A 3RMZD 3VI3A 5FKQA 3MUOA 4JSNC 3K27A 2H9LA 4PSXB 2Z2PA 4CI3A 4O9DA 4TZ4A 5HE2B 3SN6B 4A2LA 4NENA 4DNUA 3A0FA 3UVMA 2HU8A 3K26A 4A0BA 5FXYA 3MXXA 4X3EA 5FFOA 2BBKH 3KRWB 3NVNA 3EI1A 2W18A 4BCCA 2B5NA 3C9CA 3EI3A 3SWSD 4LG8A 3IUMA 4ZOXA 5CXCB 3OKYB 1JJUB 4JSVC 5HE0B 4A0AA 4J0XA 2VDQA 5E6RA 4GM8A 1JOFA 3N0EA 2IUPA 2HESX 2P9KC 2BCJB 2H13A 2IWKA 3PVUB 2Z2OA 5M5TA 1ERJA 4XYIA 1PGUA 4I79A 4AMZA 1UOOA 3EQ9A 3MKSB 4JT6C 4QQEA 2EIEA 4H5IA 3MUNA 2YNOA 4PXWA 4CI8A 3SMRA 4CY1A 4L1MA 4WJKA 4O3TB 5I5IA 3EWEA 3EU7A 2EIBA 2CO0A 2J56H 3EI4A 4ES0A 5M5RA 5EMMB 2P9IC 5EM2B 1I2MB 3IJ1A 2AH1A 2HU7A 4BP9A 2CO0C 2XDWA 1GOTB 1NR0A 2PM6B 2AGYA 4E5ZB 4RE6A 2YMUA 4A11A 4G1EA 5EALA 1PEVA 4MK0B 5FQDA 3ULEC 3NVXA 2GC4A 3CIKB 4GGAA 5C2VB 3CFVA 4GQ1A 4NBMA 2H14A 4NAAA 2CN3A 1XIPA 1O6FA 3IIWA 2H6KA 4IA9A 2UZYB 2GNQA 1VZ2A 1JMZB 2VDOA 4O1QD 5CYKA 3SXTD 5TEEA 4BUJC 1XHMA 1MDAH 2P9LC 1C9IA 2I3SA 3PSLA 2HYEA 3IJEA 3IULA 2B4EA 5K1CC 5FFGA 5IGOA 2OVQB 2VDMA 2IAAA 1UTCA 5IT9g 4R7AB 4GM9A 4BL0A 1N6DA 4ZOZA 2P9UC 5IC7A 2VZ1A 3I7KA 1U8CA 2P9PC 3ORVD 3IUQA 5I5JA 1H2ZA 2AGZA 2Z2NA 4AOWA 4CY3A 4AN0A 1GOHA 3W15A 3O4JA 2CE8A 1NEXB 3I89A 5IGQA 2H68A 2XL2A 4AMYA 3J80g 4A09A 3RFHA 5EAPA 3IIYA 4BP8A 1H2WA 2XYIA 3SBPA 2VC2A 3KRXB 2H6NA 3UVLA 2XE4A 1M1XA 3RLMD 4G56B 1QNIA 5B4WA 3SFZA 3UVNA 2I3TA 2HU5A 3O4GA 5M5VA 2IUQA 3PVWB 1TYQC 4ZN4A 4QRJA 4O45A 4J86A 3EQ7A 4E54A 4J73A 3I7PA 4U7AA 1VZ3A 3EI2B 2OVRB 4A08B 4CI1A 3FRXA 4L3GD 3F3GA 3IURA 2H9PA 3SHFA 2P9NC 3I7NA 3VA6A 2OK6A 3MVDK 2VDPA 5CXCA 2CN2A 2QC5A 3OKYA 2EIDA 4CI2A 2OIZA 4XYHA 3JZHA 4QT8A 4FAND 1B9XA 1QFMA 5FKTA 2I0TA 4A0BB 2P9SC 5EMJB 2G9AA 1UOQA 2VDRA 5CXBA 2QR5A 4MMYA 1JV2A 4IMMA 4Z8LA 5FKRA 3DWLC 2AH0A 3V9FA 4J77A 2AGLA 1XKSA 4O02A 3VGZA 4Z7NA 3KCIA 4J78A 3I2NA 2OK4A 3B7FA 2TRCB 2XL3A 4J81A 4QAMA 3C75H 3ZE2A 5GMKn 1C9LA 3UVKA 5C92A 3N0DA 4FAVD 2PM9A 3MMYA 3RN0D 2AGXA 2YBAA 1E8MA 4J84A 5C9ZB 1GG2B 2QXVA 3UKRC 4J87A 1TBGA 2MTAH 4GM3A 4K3JB 2PM7B 1VYHC 2YNPA 3EI4B 1VE6A 4GGCA 5H17A 2OJYA 1GXRA 4DNWA 1Q47A 4ESGA 4GZ8A 3FCSA 4X60B 4OWRA 1B9YA 2I0SA 3EMHA 1RI6A 3NIGA 4JHPC 4FA4D 4K3ID 2HKRA 4FA9D 1P22A 3RRMC 4O3UB 4GGDA 4A11B 3DM0A 3PSCB 4BH6A 3NVQA 4L1QD 3UVOA 3ZDYA 3U4YA 4O2WA 4BCBA 5FKSA 4FB1D 4KFMB 2IWFA 4Y7RA 2Q7QA 4L3HD 2HJBA 4WK2A 4UM9A 5M61A 3NIFA 4CC9A 4CZYA 5CYKB 3AL9A 1OLZA 3I7LA 3DXKC 1H2YA 4CZXA 2B5LA 5I5MA 2H47A 2XU7A 1SHYB 4CY2A 2H6QA 2XZGA 3O4IA 4RE5A 3JRPA 3PXTD 4Z7OA 4MMZA 5SXMA 1E8NA 3K72A 4J0WA 2OVPB 1UOPA 3PXWD 4G1MA 1YR2A 5K19A 5HE3B 3EG6A 3OL2A 3L4MD 4FA5D 4H5JA 3VH0A 3IUNA 3SVWD 1JMXB 4PBZA 3C5MA 1QFSA 3CFSB 5HE1B 4JSXC 3E0CA 3GD1I 3OTTA 4N14A 4U1EI 4HDJA 3JROA 4J8GA 3ZDXA 5HYNB 4A09B 3EQ8A 3L4OD 2PBIB 5AMSA 4FA1D 1T2XA 3FGBA 1BPOA 1S4UX 1GOFA 4Y5RD 5GXHA 3HFQA 4J79A 4PNKB 3OF7A 2CNXA 4J8BA 5H1MA 3AL8B 3QHYB 3JAMg 3PE7A 3BG0A 3AFCA 4ERZA 4E54B 3RN1D
chains in the Genus database with same CATH topology
4MMXA 3NIGA 2VDLA 3FCUA 4NENA 5HDBA 3ZE2A 2VDOA 4WK4A 2VDRA 4IRZA 4MMYA 3ZDXA 1JV2A 3ZE1A 1TYEA 4Z7OA 2VDKA 4MMZA 4Z7QA 1L5GA 3ZE0A 5FFOA 3K72A 3IJEA 5E6UA 4G1EA 4G1MA 3NIDA 5FFGA 2VDMA 4O02A 4WJKA 4UM8A 3ZDYA 4Z7NA 4WK0A 3VI4A 3V4PA 3T3PA 2VDQA 2VDPA 3T3MA 3K71A 2VC2A 3ZDZA 2VDNA 3FCSA 3VI3A 3K6SA 1M1XA 5E6RA 5E6SA 1U8CA 4UM9A 4WK2A 3V4VA 3NIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMX A;  3NIG A;  2VDL A;  3FCU A;  4NEN A;  5HDB A;  3ZE2 A;  2VDO A;  4WK4 A;  2VDR A;  4IRZ A;  4MMY A;  3ZDX A;  1JV2 A;  3ZE1 A;  1TYE A;  4Z7O A;  2VDK A;  4MMZ A;  4Z7Q A;  1L5G A;  3ZE0 A;  5FFO A;  3K72 A;  3IJE A;  5E6U A;  4G1E A;  4G1M A;  3NID A;  5FFG A;  2VDM A;  4O02 A;  4WJK A;  4UM8 A;  3ZDY A;  4Z7N A;  4WK0 A;  3VI4 A;  3V4P A;  3T3P A;  2VDQ A;  2VDP A;  3T3M A;  3K71 A;  2VC2 A;  3ZDZ A;  2VDN A;  3FCS A;  3VI3 A;  3K6S A;  1M1X A;  5E6R A;  5E6S A;  1U8C A;  4UM9 A;  4WK2 A;  3V4V A;  3NIF A; 
#chains in the Genus database with same CATH topology
 4MMX A;  4AX4 A;  4EWR A;  4GQ2 P;  4WK4 A;  4IRZ A;  1H2X A;  2H9M A;  2VDK A;  3EI1 B;  2HJ4 A;  1FWX A;  4L9O A;  3OKT A;  3BWS A;  3DSM A;  3EI3 B;  4JXM A;  1A0R B;  4FWW A;  4A0A B;  1N6E A;  1OMW B;  5EMK B;  4PSW B;  3SJL D;  4UM8 A;  5EAR A;  2HKM A;  5IJ8 E;  3I8E A;  2J57 G;  2CE9 A;  3F3P A;  1YFQ A;  3O4H A;  4ERY A;  2JKX A;  4AEZ A;  2QZP A;  4LGN A;  5JWZ A;  3V4V A;  5C2W B;  3IUJ A;  5CXB B;  3I7O A;  3OW8 A;  4CY5 A;  3DXM C;  5THA A;  5FA5 B;  2O9K A;  1R5M A;  5EM2 A;  1N6F A;  1PBY B;  1U2V C;  4FHL A;  4Z7Q A;  2EIC A;  3V7D B;  5AFU 3;  4X61 B;  3IJC A;  4ERQ A;  2BKL A;  4NSX A;  4E5Z A;  2AQ5 A;  5HQG A;  4UI9 R;  2H9N A;  3ZWL B;  3T3M A;  2I0R A;  3SBQ A;  2WQ8 A;  4GQB B;  2PM9 B;  5EAM A;  3K6S A;  1K32 A;  4JHN A;  5GSA A;  3P4F A;  1JTD B;  2VDL A;  2G99 A;  1L0Q A;  1E5T A;  2J55 H;  3ZE1 A;  1TYE A;  3SCY A;  1GP2 B;  1K3I A;  2YB8 B;  3AH8 B;  3ZE0 A;  4CZV A;  3JB9 L;  3JPX A;  1A12 A;  4ZOV A;  5TDH B;  4AN1 A;  3I8C A;  2VZ3 A;  4ZOY A;  4PBY A;  3OKW A;  3IKO A;  2B5M A;  4A2M A;  3SBR A;  3ZDZ A;  3DDU A;  2UZX B;  2VDN A;  3FM0 A;  3MZL A;  1MG2 A;  4JD2 C;  3IJ0 A;  1PI6 A;  4NC4 A;  2HXC A;  2IUR A;  5A2Q g;  1SQ9 A;  5H14 A;  1GOG A;  4XEI C;  5IJ7 E;  3GRE A;  3RSE C;  2YNN A;  1VE7 A;  5TF2 A;  3F3F A;  4YVD A;  4X63 B;  1L5G A;  1SQJ A;  4D6V A;  5TEF A;  3ODT A;  3JZN A;  3RFG A;  3UR4 A;  4JT5 C;  5KDO B;  2IUV A;  3NID A;  2EBS A;  4WK0 A;  5M5U A;  4LG9 A;  4D0K A;  3I7H A;  3K71 A;  1K8K C;  3V5W B;  4DNV A;  5M5S A;  5E6S A;  4PC0 A;  4J82 A;  3SLE D;  3J81 g;  2AGW A;  5FLX g;  3QI0 A;  1O6G A;  3FCU A;  5HDB A;  3MKQ A;  3UKU C;  5C86 A;  3MZK A;  4A7J A;  4OZU A;  5AJA A;  2GC7 A;  3IVM A;  2H3X A;  4G55 A;  5EML B;  5E6U A;  5GXI A;  3OL2 B;  4GMB A;  4BCD A;  3EI2 A;  4QL1 A;  4D9S A;  3JZG A;  3BG1 A;  4A08 A;  1MG3 A;  3GC3 B;  3C99 A;  3GFC A;  4JSP C;  3VI4 A;  3V4P A;  1U4C A;  3T3P A;  3PXS D;  3AL8 A;  3RMZ D;  3VI3 A;  5FKQ A;  3MUO A;  4JSN C;  3K27 A;  2H9L A;  4PSX B;  2Z2P A;  4CI3 A;  4O9D A;  4TZ4 A;  5HE2 B;  3SN6 B;  4A2L A;  4NEN A;  4DNU A;  3A0F A;  3UVM A;  2HU8 A;  3K26 A;  4A0B A;  5FXY A;  3MXX A;  4X3E A;  5FFO A;  2BBK H;  3KRW B;  3NVN A;  3EI1 A;  2W18 A;  4BCC A;  2B5N A;  3C9C A;  3EI3 A;  3SWS D;  4LG8 A;  3IUM A;  4ZOX A;  5CXC B;  3OKY B;  1JJU B;  4JSV C;  5HE0 B;  4A0A A;  4J0X A;  2VDQ A;  5E6R A;  4GM8 A;  1JOF A;  3N0E A;  2IUP A;  2HES X;  2P9K C;  2BCJ B;  2H13 A;  2IWK A;  3PVU B;  2Z2O A;  5M5T A;  1ERJ A;  4XYI A;  1PGU A;  4I79 A;  4AMZ A;  1UOO A;  3EQ9 A;  3MKS B;  4JT6 C;  4QQE A;  2EIE A;  4H5I A;  3MUN A;  2YNO A;  4PXW A;  4CI8 A;  3SMR A;  4CY1 A;  4L1M A;  4WJK A;  4O3T B;  5I5I A;  3EWE A;  3EU7 A;  2EIB A;  2CO0 A;  2J56 H;  3EI4 A;  4ES0 A;  5M5R A;  5EMM B;  2P9I C;  5EM2 B;  1I2M B;  3IJ1 A;  2AH1 A;  2HU7 A;  4BP9 A;  2CO0 C;  2XDW A;  1GOT B;  1NR0 A;  2PM6 B;  2AGY A;  4E5Z B;  4RE6 A;  2YMU A;  4A11 A;  4G1E A;  5EAL A;  1PEV A;  4MK0 B;  5FQD A;  3ULE C;  3NVX A;  2GC4 A;  3CIK B;  4GGA A;  5C2V B;  3CFV A;  4GQ1 A;  4NBM A;  2H14 A;  4NAA A;  2CN3 A;  1XIP A;  1O6F A;  3IIW A;  2H6K A;  4IA9 A;  2UZY B;  2GNQ A;  1VZ2 A;  1JMZ B;  2VDO A;  4O1Q D;  5CYK A;  3SXT D;  5TEE A;  4BUJ C;  1XHM A;  1MDA H;  2P9L C;  1C9I A;  2I3S A;  3PSL A;  2HYE A;  3IJE A;  3IUL A;  2B4E A;  5K1C C;  5FFG A;  5IGO A;  2OVQ B;  2VDM A;  2IAA A;  1UTC A;  5IT9 g;  4R7A B;  4GM9 A;  4BL0 A;  1N6D A;  4ZOZ A;  2P9U C;  5IC7 A;  2VZ1 A;  3I7K A;  1U8C A;  2P9P C;  3ORV D;  3IUQ A;  5I5J A;  1H2Z A;  2AGZ A;  2Z2N A;  4AOW A;  4CY3 A;  4AN0 A;  1GOH A;  3W15 A;  3O4J A;  2CE8 A;  1NEX B;  3I89 A;  5IGQ A;  2H68 A;  2XL2 A;  4AMY A;  3J80 g;  4A09 A;  3RFH A;  5EAP A;  3IIY A;  4BP8 A;  1H2W A;  2XYI A;  3SBP A;  2VC2 A;  3KRX B;  2H6N A;  3UVL A;  2XE4 A;  1M1X A;  3RLM D;  4G56 B;  1QNI A;  5B4W A;  3SFZ A;  3UVN A;  2I3T A;  2HU5 A;  3O4G A;  5M5V A;  2IUQ A;  3PVW B;  1TYQ C;  4ZN4 A;  4QRJ A;  4O45 A;  4J86 A;  3EQ7 A;  4E54 A;  4J73 A;  3I7P A;  4U7A A;  1VZ3 A;  3EI2 B;  2OVR B;  4A08 B;  4CI1 A;  3FRX A;  4L3G D;  3F3G A;  3IUR A;  2H9P A;  3SHF A;  2P9N C;  3I7N A;  3VA6 A;  2OK6 A;  3MVD K;  2VDP A;  5CXC A;  2CN2 A;  2QC5 A;  3OKY A;  2EID A;  4CI2 A;  2OIZ A;  4XYH A;  3JZH A;  4QT8 A;  4FAN D;  1B9X A;  1QFM A;  5FKT A;  2I0T A;  4A0B B;  2P9S C;  5EMJ B;  2G9A A;  1UOQ A;  2VDR A;  5CXB A;  2QR5 A;  4MMY A;  1JV2 A;  4IMM A;  4Z8L A;  5FKR A;  3DWL C;  2AH0 A;  3V9F A;  4J77 A;  2AGL A;  1XKS A;  4O02 A;  3VGZ A;  4Z7N A;  3KCI A;  4J78 A;  3I2N A;  2OK4 A;  3B7F A;  2TRC B;  2XL3 A;  4J81 A;  4QAM A;  3C75 H;  3ZE2 A;  5GMK n;  1C9L A;  3UVK A;  5C92 A;  3N0D A;  4FAV D;  2PM9 A;  3MMY A;  3RN0 D;  2AGX A;  2YBA A;  1E8M A;  4J84 A;  5C9Z B;  1GG2 B;  2QXV A;  3UKR C;  4J87 A;  1TBG A;  2MTA H;  4GM3 A;  4K3J B;  2PM7 B;  1VYH C;  2YNP A;  3EI4 B;  1VE6 A;  4GGC A;  5H17 A;  2OJY A;  1GXR A;  4DNW A;  1Q47 A;  4ESG A;  4GZ8 A;  3FCS A;  4X60 B;  4OWR A;  1B9Y A;  2I0S A;  3EMH A;  1RI6 A;  3NIG A;  4JHP C;  4FA4 D;  4K3I D;  2HKR A;  4FA9 D;  1P22 A;  3RRM C;  4O3U B;  4GGD A;  4A11 B;  3DM0 A;  3PSC B;  4BH6 A;  3NVQ A;  4L1Q D;  3UVO A;  3ZDY A;  3U4Y A;  4O2W A;  4BCB A;  5FKS A;  4FB1 D;  4KFM B;  2IWF A;  4Y7R A;  2Q7Q A;  4L3H D;  2HJB A;  4WK2 A;  4UM9 A;  5M61 A;  3NIF A;  4CC9 A;  4CZY A;  5CYK B;  3AL9 A;  1OLZ A;  3I7L A;  3DXK C;  1H2Y A;  4CZX A;  2B5L A;  5I5M A;  2H47 A;  2XU7 A;  1SHY B;  4CY2 A;  2H6Q A;  2XZG A;  3O4I A;  4RE5 A;  3JRP A;  3PXT D;  4Z7O A;  4MMZ A;  5SXM A;  1E8N A;  3K72 A;  4J0W A;  2OVP B;  1UOP A;  3PXW D;  4G1M A;  1YR2 A;  5K19 A;  5HE3 B;  3EG6 A;  3OL2 A;  3L4M D;  4FA5 D;  4H5J A;  3VH0 A;  3IUN A;  3SVW D;  1JMX B;  4PBZ A;  3C5M A;  1QFS A;  3CFS B;  5HE1 B;  4JSX C;  3E0C A;  3GD1 I;  3OTT A;  4N14 A;  4U1E I;  4HDJ A;  3JRO A;  4J8G A;  3ZDX A;  5HYN B;  4A09 B;  3EQ8 A;  3L4O D;  2PBI B;  5AMS A;  4FA1 D;  1T2X A;  3FGB A;  1BPO A;  1S4U X;  1GOF A;  4Y5R D;  5GXH A;  3HFQ A;  4J79 A;  4PNK B;  3OF7 A;  2CNX A;  4J8B A;  5H1M A;  3AL8 B;  3QHY B;  3JAM g;  3PE7 A;  3BG0 A;  3AFC A;  4ERZ A;  4E54 B;  3RN1 D; 
#chains in the Genus database with same CATH homology
 4MMX A;  3NIG A;  2VDL A;  3FCU A;  4NEN A;  5HDB A;  3ZE2 A;  2VDO A;  4WK4 A;  2VDR A;  4IRZ A;  4MMY A;  3ZDX A;  1JV2 A;  3ZE1 A;  1TYE A;  4Z7O A;  2VDK A;  4MMZ A;  4Z7Q A;  1L5G A;  3ZE0 A;  5FFO A;  3K72 A;  3IJE A;  5E6U A;  4G1E A;  4G1M A;  3NID A;  5FFG A;  2VDM A;  4O02 A;  4WJK A;  4UM8 A;  3ZDY A;  4Z7N A;  4WK0 A;  3VI4 A;  3V4P A;  3T3P A;  2VDQ A;  2VDP A;  3T3M A;  3K71 A;  2VC2 A;  3ZDZ A;  2VDN A;  3FCS A;  3VI3 A;  3K6S A;  1M1X A;  5E6R A;  5E6S A;  1U8C A;  4UM9 A;  4WK2 A;  3V4V A;  3NIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...