1TYEA

Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRAEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
publication title Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 452
sequence length 452
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 1tyeA00
4MMZA 3IJEA 2VDLA 5FFGA 4MMXA 1U8CA 4UM9A 4Z7QA 3FCUA 5E6RA 4Z7OA 3VI4A 4WJKA 4UM8A 2VDKA 3T3MA 4WK2A 3NIGA 5FFOA 3ZDYA 1M1XA 2VDQA 4IRZA 1JV2A 3V4PA 3ZE1A 3K71A 2VDMA 4WK4A 3ZE2A 3FCSA 3K72A 4G1EA 3ZDXA 2VDPA 2VDNA 4MMYA 4NENA 2VDRA 3T3PA 3K6SA 2VDOA 3NIDA 5HDBA 3NIFA 1TYEA 3ZE0A 5E6SA 4O02A 5E6UA 4G1MA 3V4VA 3ZDZA 4Z7NA 3VI3A 1L5GA 2VC2A 4WK0A
chains in the Genus database with same CATH superfamily
1FWXA 3IJEA 3HFQA 3JRPA 4A08A 2AGWA 2QZPA 2HKMA 4O3UB 3BWSA 5CYKA 2Z2OA 3UVOA 3DXMC 3IULA 5HQGA 1N6EA 4PBYA 3AL8B 3IJ1A 3OKYB 5TDHB 5EM2A 5GXHA 2B4EA 2PM9B 1GP2B 2I0RA 3AH8B 1JMZB 3MZLA 5M5VA 3EWEA 3UVKA 4G1MA 4NSXA 4U7AA 1E5TA 3UR4A 5M5RA 2IUPA 3MUNA 3EMHA 3DSMA 2P9NC 3QHYB 4A2MA 5FQDA 4E54B 2VDQA 3KRWB 4U1EI 2PM6B 3ZE2A 5I5MA 5IJ8E 1UOPA 5FLXg 4XEIC 1R5MA 2IUQA 1K32A 2OK4A 5EMJB 5I5IA 2XL3A 4X63B 4UM8A 4RE5A 4J77A 4J86A 4MMXA 4A11B 4ZOXA 2TRCB 3FCUA 5E6RA 5CXCB 3FRXA 2HU5A 4DNVA 1NEXB 3I89A 3K72A 5C86A 1XHMA 4O9DA 3T3PA 4O45A 3RMZD 2PM7B 5CXBB 2H6KA 3AFCA 1GOFA 2H9LA 1MDAH 5IGQA 3ZE0A 5TF2A 1UOQA 4O02A 3U4YA 3V4VA 4NC4A 4J8BA 3C9CA 4DNWA 3I2NA 1Q47A 5HE3B 1TYQC 5GXIA 3RLMD 1E8NA 1OMWB 3L4OD 1E8MA 2H6QA 4GM9A 4QL1A 4J0WA 3IJCA 4AX4A 3BG1A 4BH6A 1TBGA 3SBQA 4CY1A 5M5SA 4QAMA 4AOWA 4IRZA 5B4WA 4UI9R 3I7KA 5KDOB 2HJ4A 4YVDA 3MUOA 3CIKB 3VGZA 4FA1D 2XU7A 4CZYA 5H17A 3DM0A 2HJBA 2HU7A 1VE7A 1H2XA 1U8CA 4CC9A 5EMMB 3EI3A 3JZNA 4Z7OA 1JMXB 2YBAA 2OJYA 3EU7A 4G55A 2EIBA 4AMYA 2P9LC 5FKQA 3O4GA 3SXTD 2HKRA 3V5WB 2OK6A 4J84A 4J78A 1VZ2A 2CNXA 2J55H 3ZWLB 1MG2A 1N6FA 5M5UA 2I0TA 5CYKB 3ZDXA 4BP8A 3K6SA 2YMUA 4A09A 3IIWA 2EIEA 3MMYA 4OZUA 4A2LA 2GC7A 5K1CC 2IWKA 2GC4A 1GXRA 2H3XA 4ERYA 4Z7NA 1GOTB 2AGXA 3I8EA 4MMZA 1U4CA 2VDLA 2I0SA 4Z8LA 4A0BA 4UM9A 4Z7QA 5TEFA 3JB9L 1T2XA 3EI4A 3ODTA 2H68A 2CO0C 4PSWB 4FA4D 2CE9A 2OIZA 3O4JA 3AL9A 2P9KC 2H47A 4K3ID 4D9SA 1JOFA 4FWWA 1JV2A 3VA6A 4CI8A 4L1QD 4WK4A 4IMMA 3SVWD 5K19A 3NVXA 4MMYA 4AN0A 4QRJA 2H9NA 3PE7A 3IKOA 2AH1A 1YFQA 4GGAA 1K3IA 4J81A 1YR2A 3PVUB 5IC7A 2HYEA 1VE6A 3E0CA 2OVQB 3JROA 4LG9A 2IAAA 2AGZA 4JSPC 4FAND 2EIDA 3DDUA 3I7HA 3EQ8A 4JT5C 4WK2A 2AQ5A 4TZ4A 3UKRC 2EICA 2Z2PA 5JWZA 2QC5A 2BBKH 1B9YA 5HDBA 1TYEA 4BL0A 5E6SA 5M5TA 4JHPC 5E6UA 3ULEC 4J79A 3IIYA 2VC2A 4FB1D 1PBYB 1PI6A 2AGYA 4L3HD 5EAPA 3OTTA 3F3FA 2YNPA 4LG8A 4WJKA 4ZOZA 4IA9A 5GSAA 3V9FA 2P9SC 2VZ3A 3ZDYA 3L4MD 1M1XA 5H14A 1QNIA 2VDNA 5FKSA 4BCCA 4ESGA 3W15A 3I7OA 4J73A 4RE6A 4JXMA 1L0QA 3ZDZA 3EG6A 4AEZA 1UTCA 1BPOA 3F3GA 3SJLD 4CI3A 1OLZA 4JSVC 1A0RB 5EMKB 1C9LA 4BP9A 4GGCA 4D0KA 4E54A 3JZGA 2UZXB 4FA5D 4JT6C 3SMRA 3EI3B 3OKWA 5H1MA 5FKRA 4NBMA 4EWRA 3C5MA 5HYNB 5AMSA 2VDMA 3FCSA 2OVRB 3SCYA 3MKQA 2IURA 4OWRA 2VDRA 1MG3A 3OL2A 2PBIB 2H14A 2O9KA 3RFGA 4PC0A 5IJ7E 2P9UC 4A09B 5C9ZB 3EI1A 2QR5A 5CXCA 2WQ8A 5C2VB 1XIPA 4A0AB 2AH0A 5C92A 2VZ1A 4GQ2P 1A12A 2HU8A 3EI2A 5AJAA 1B9XA 4J87A 3I8CA 2H9MA 4E5ZA 2EBSA 4R7AB 3EI4B 5EMLB 4J8GA 4A08B 3JPXA 2XE4A 2P9IC 4GM8A 2VDPA 2J56H 1P22A 1SHYB 2UZYB 4O3TB 3K27A 4Y5RD 3PXTD 1JTDB 4JSNC 5EM2B 4L3GD 4PSXB 2XZGA 3SWSD 3IURA 3BG0A 3OKTA 4H5JA 3SBRA 4CZXA 4PBZA 4GGDA 4FAVD 3FM0A 5AFU3 4ES0A 3RSEC 4L1MA 5M61A 5HE0B 2CO0A 3GC3B 2J57G 3KRXB 2CN3A 3K71A 2I3TA 4AMZA 4NENA 3O4HA 4GZ8A 3RRMC 2QXVA 4JD2C 3J80g 4BCDA 1XKSA 4GM3A 3CFSB 4ERZA 3P4FA 3GREA 3RFHA 2Q7QA 3JZHA 3SFZA 2B5MA 1GOHA 3IUMA 5SXMA 3SBPA 1NR0A 2YNNA 2IUVA 3IUQA 3N0EA 2XYIA 3PSCB 4QT8A 2W18A 3NIGA 3N0DA 4GQ1A 1PGUA 2B5NA 2G9AA 5EAMA 1N6DA 2H6NA 1SQJA 2YNOA 2H13A 1O6GA 1C9IA 3J81g 2OVPB 5C2WB 4X60B 5EALA 3NIFA 4X3EA 1K8KC 4CY3A 4CI2A 2XL2A 4JSXC 3RN0D 2HESX 4HDJA 3C75H 3UVLA 3I7LA 3AL8A 4MK0B 3OKYA 1QFMA 3SHFA 4QQEA 2PM9A 3GFCA 2H9PA 3UVMA 1PEVA 3VH0A 3EQ7A 3PVWB 2CN2A 3PXSD 1U2VC 5FKTA 3IUNA 2CE8A 4JHNA 4XYHA 4L9OA 5FXYA 4ZOYA 1H2WA 5IGOA 2BCJB 4D6VA 3MVDK 3DXKC 1SQ9A 2XDWA 2Z2NA 5THAA 3OF7A 1UOOA 3OL2B 5HE1B 4WK0A 1VZ3A 1QFSA 3PXWD 4ERQA 4CY5A 2G99A 3PSLA 3EI1B 4BUJC 4BCBA 4Y7RA 4O2WA 3EI2B 3QI0A 3V4PA 4PNKB 2GNQA 2I3SA 3O4IA 4E5ZB 2JKXA 3RN1D 2IWFA 1H2YA 2VDOA 3CFVA 1ERJA 5I5JA 4GMBA 4K3JB 5HE2B 4FHLA 3SN6B 4A7JA 4A11A 4N14A 4G56B 1L5GA 4XYIA 3MKSB 3K26A 1VYHC 3MZKA 5FFGA 3B7FA 1S4UX 5EARA 3F3PA 4X61B 3A0FA 4J0XA 3T3MA 3IUJA 4A0BB 2HXCA 5FFOA 5CXBA 4KFMB 3UKUC 2YB8B 3IVMA 3C99A 3V7DB 4CY2A 1GOGA 4ZN4A 2AGLA 4DNUA 3NIDA 3EQ9A 4FA9D 3NVQA 2B5LA 4CI1A 4J82A 4I79A 5GMKn 3UVNA 4LGNA 3JAMg 2MTAH 3SLED 3KCIA 2P9PC 3IJ0A 5FA5B 1JJUB 3DWLC 3FGBA 4GQBB 3VI4A 2VDKA 4H5IA 1H2ZA 4CZVA 1GG2B 3ORVD 1I2MB 3I7PA 3MXXA 4O1QD 4ZOVA 3ZE1A 4AN1A 4G1EA 5A2Qg 3I7NA 2BKLA 4NAAA 4A0AA 5TEEA 1RI6A 3GD1I 5IT9g 4PXWA 3OW8A 3VI3A 1O6FA 3NVNA
chains in the Genus database with same CATH topology
4MMZA 3IJEA 2VDLA 5FFGA 4MMXA 1U8CA 4UM9A 4Z7QA 3FCUA 5E6RA 4Z7OA 3VI4A 4WJKA 4UM8A 2VDKA 3T3MA 4WK2A 3NIGA 5FFOA 3ZDYA 1M1XA 2VDQA 4IRZA 1JV2A 3V4PA 3ZE1A 3K71A 2VDMA 4WK4A 3ZE2A 3FCSA 3K72A 4G1EA 3ZDXA 2VDPA 2VDNA 4MMYA 4NENA 2VDRA 3T3PA 3K6SA 2VDOA 3NIDA 5HDBA 3NIFA 1TYEA 3ZE0A 5E6SA 4O02A 5E6UA 4G1MA 3V4VA 3ZDZA 4Z7NA 3VI3A 1L5GA 2VC2A 4WK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMZ A;  3IJE A;  2VDL A;  5FFG A;  4MMX A;  1U8C A;  4UM9 A;  4Z7Q A;  3FCU A;  5E6R A;  4Z7O A;  3VI4 A;  4WJK A;  4UM8 A;  2VDK A;  3T3M A;  4WK2 A;  3NIG A;  5FFO A;  3ZDY A;  1M1X A;  2VDQ A;  4IRZ A;  1JV2 A;  3V4P A;  3ZE1 A;  3K71 A;  2VDM A;  4WK4 A;  3ZE2 A;  3FCS A;  3K72 A;  4G1E A;  3ZDX A;  2VDP A;  2VDN A;  4MMY A;  4NEN A;  2VDR A;  3T3P A;  3K6S A;  2VDO A;  3NID A;  5HDB A;  3NIF A;  1TYE A;  3ZE0 A;  5E6S A;  4O02 A;  5E6U A;  4G1M A;  3V4V A;  3ZDZ A;  4Z7N A;  3VI3 A;  1L5G A;  2VC2 A;  4WK0 A; 
#chains in the Genus database with same CATH topology
 1FWX A;  3IJE A;  3HFQ A;  3JRP A;  4A08 A;  2AGW A;  2QZP A;  2HKM A;  4O3U B;  3BWS A;  5CYK A;  2Z2O A;  3UVO A;  3DXM C;  3IUL A;  5HQG A;  1N6E A;  4PBY A;  3AL8 B;  3IJ1 A;  3OKY B;  5TDH B;  5EM2 A;  5GXH A;  2B4E A;  2PM9 B;  1GP2 B;  2I0R A;  3AH8 B;  1JMZ B;  3MZL A;  5M5V A;  3EWE A;  3UVK A;  4G1M A;  4NSX A;  4U7A A;  1E5T A;  3UR4 A;  5M5R A;  2IUP A;  3MUN A;  3EMH A;  3DSM A;  2P9N C;  3QHY B;  4A2M A;  5FQD A;  4E54 B;  2VDQ A;  3KRW B;  4U1E I;  2PM6 B;  3ZE2 A;  5I5M A;  5IJ8 E;  1UOP A;  5FLX g;  4XEI C;  1R5M A;  2IUQ A;  1K32 A;  2OK4 A;  5EMJ B;  5I5I A;  2XL3 A;  4X63 B;  4UM8 A;  4RE5 A;  4J77 A;  4J86 A;  4MMX A;  4A11 B;  4ZOX A;  2TRC B;  3FCU A;  5E6R A;  5CXC B;  3FRX A;  2HU5 A;  4DNV A;  1NEX B;  3I89 A;  3K72 A;  5C86 A;  1XHM A;  4O9D A;  3T3P A;  4O45 A;  3RMZ D;  2PM7 B;  5CXB B;  2H6K A;  3AFC A;  1GOF A;  2H9L A;  1MDA H;  5IGQ A;  3ZE0 A;  5TF2 A;  1UOQ A;  4O02 A;  3U4Y A;  3V4V A;  4NC4 A;  4J8B A;  3C9C A;  4DNW A;  3I2N A;  1Q47 A;  5HE3 B;  1TYQ C;  5GXI A;  3RLM D;  1E8N A;  1OMW B;  3L4O D;  1E8M A;  2H6Q A;  4GM9 A;  4QL1 A;  4J0W A;  3IJC A;  4AX4 A;  3BG1 A;  4BH6 A;  1TBG A;  3SBQ A;  4CY1 A;  5M5S A;  4QAM A;  4AOW A;  4IRZ A;  5B4W A;  4UI9 R;  3I7K A;  5KDO B;  2HJ4 A;  4YVD A;  3MUO A;  3CIK B;  3VGZ A;  4FA1 D;  2XU7 A;  4CZY A;  5H17 A;  3DM0 A;  2HJB A;  2HU7 A;  1VE7 A;  1H2X A;  1U8C A;  4CC9 A;  5EMM B;  3EI3 A;  3JZN A;  4Z7O A;  1JMX B;  2YBA A;  2OJY A;  3EU7 A;  4G55 A;  2EIB A;  4AMY A;  2P9L C;  5FKQ A;  3O4G A;  3SXT D;  2HKR A;  3V5W B;  2OK6 A;  4J84 A;  4J78 A;  1VZ2 A;  2CNX A;  2J55 H;  3ZWL B;  1MG2 A;  1N6F A;  5M5U A;  2I0T A;  5CYK B;  3ZDX A;  4BP8 A;  3K6S A;  2YMU A;  4A09 A;  3IIW A;  2EIE A;  3MMY A;  4OZU A;  4A2L A;  2GC7 A;  5K1C C;  2IWK A;  2GC4 A;  1GXR A;  2H3X A;  4ERY A;  4Z7N A;  1GOT B;  2AGX A;  3I8E A;  4MMZ A;  1U4C A;  2VDL A;  2I0S A;  4Z8L A;  4A0B A;  4UM9 A;  4Z7Q A;  5TEF A;  3JB9 L;  1T2X A;  3EI4 A;  3ODT A;  2H68 A;  2CO0 C;  4PSW B;  4FA4 D;  2CE9 A;  2OIZ A;  3O4J A;  3AL9 A;  2P9K C;  2H47 A;  4K3I D;  4D9S A;  1JOF A;  4FWW A;  1JV2 A;  3VA6 A;  4CI8 A;  4L1Q D;  4WK4 A;  4IMM A;  3SVW D;  5K19 A;  3NVX A;  4MMY A;  4AN0 A;  4QRJ A;  2H9N A;  3PE7 A;  3IKO A;  2AH1 A;  1YFQ A;  4GGA A;  1K3I A;  4J81 A;  1YR2 A;  3PVU B;  5IC7 A;  2HYE A;  1VE6 A;  3E0C A;  2OVQ B;  3JRO A;  4LG9 A;  2IAA A;  2AGZ A;  4JSP C;  4FAN D;  2EID A;  3DDU A;  3I7H A;  3EQ8 A;  4JT5 C;  4WK2 A;  2AQ5 A;  4TZ4 A;  3UKR C;  2EIC A;  2Z2P A;  5JWZ A;  2QC5 A;  2BBK H;  1B9Y A;  5HDB A;  1TYE A;  4BL0 A;  5E6S A;  5M5T A;  4JHP C;  5E6U A;  3ULE C;  4J79 A;  3IIY A;  2VC2 A;  4FB1 D;  1PBY B;  1PI6 A;  2AGY A;  4L3H D;  5EAP A;  3OTT A;  3F3F A;  2YNP A;  4LG8 A;  4WJK A;  4ZOZ A;  4IA9 A;  5GSA A;  3V9F A;  2P9S C;  2VZ3 A;  3ZDY A;  3L4M D;  1M1X A;  5H14 A;  1QNI A;  2VDN A;  5FKS A;  4BCC A;  4ESG A;  3W15 A;  3I7O A;  4J73 A;  4RE6 A;  4JXM A;  1L0Q A;  3ZDZ A;  3EG6 A;  4AEZ A;  1UTC A;  1BPO A;  3F3G A;  3SJL D;  4CI3 A;  1OLZ A;  4JSV C;  1A0R B;  5EMK B;  1C9L A;  4BP9 A;  4GGC A;  4D0K A;  4E54 A;  3JZG A;  2UZX B;  4FA5 D;  4JT6 C;  3SMR A;  3EI3 B;  3OKW A;  5H1M A;  5FKR A;  4NBM A;  4EWR A;  3C5M A;  5HYN B;  5AMS A;  2VDM A;  3FCS A;  2OVR B;  3SCY A;  3MKQ A;  2IUR A;  4OWR A;  2VDR A;  1MG3 A;  3OL2 A;  2PBI B;  2H14 A;  2O9K A;  3RFG A;  4PC0 A;  5IJ7 E;  2P9U C;  4A09 B;  5C9Z B;  3EI1 A;  2QR5 A;  5CXC A;  2WQ8 A;  5C2V B;  1XIP A;  4A0A B;  2AH0 A;  5C92 A;  2VZ1 A;  4GQ2 P;  1A12 A;  2HU8 A;  3EI2 A;  5AJA A;  1B9X A;  4J87 A;  3I8C A;  2H9M A;  4E5Z A;  2EBS A;  4R7A B;  3EI4 B;  5EML B;  4J8G A;  4A08 B;  3JPX A;  2XE4 A;  2P9I C;  4GM8 A;  2VDP A;  2J56 H;  1P22 A;  1SHY B;  2UZY B;  4O3T B;  3K27 A;  4Y5R D;  3PXT D;  1JTD B;  4JSN C;  5EM2 B;  4L3G D;  4PSX B;  2XZG A;  3SWS D;  3IUR A;  3BG0 A;  3OKT A;  4H5J A;  3SBR A;  4CZX A;  4PBZ A;  4GGD A;  4FAV D;  3FM0 A;  5AFU 3;  4ES0 A;  3RSE C;  4L1M A;  5M61 A;  5HE0 B;  2CO0 A;  3GC3 B;  2J57 G;  3KRX B;  2CN3 A;  3K71 A;  2I3T A;  4AMZ A;  4NEN A;  3O4H A;  4GZ8 A;  3RRM C;  2QXV A;  4JD2 C;  3J80 g;  4BCD A;  1XKS A;  4GM3 A;  3CFS B;  4ERZ A;  3P4F A;  3GRE A;  3RFH A;  2Q7Q A;  3JZH A;  3SFZ A;  2B5M A;  1GOH A;  3IUM A;  5SXM A;  3SBP A;  1NR0 A;  2YNN A;  2IUV A;  3IUQ A;  3N0E A;  2XYI A;  3PSC B;  4QT8 A;  2W18 A;  3NIG A;  3N0D A;  4GQ1 A;  1PGU A;  2B5N A;  2G9A A;  5EAM A;  1N6D A;  2H6N A;  1SQJ A;  2YNO A;  2H13 A;  1O6G A;  1C9I A;  3J81 g;  2OVP B;  5C2W B;  4X60 B;  5EAL A;  3NIF A;  4X3E A;  1K8K C;  4CY3 A;  4CI2 A;  2XL2 A;  4JSX C;  3RN0 D;  2HES X;  4HDJ A;  3C75 H;  3UVL A;  3I7L A;  3AL8 A;  4MK0 B;  3OKY A;  1QFM A;  3SHF A;  4QQE A;  2PM9 A;  3GFC A;  2H9P A;  3UVM A;  1PEV A;  3VH0 A;  3EQ7 A;  3PVW B;  2CN2 A;  3PXS D;  1U2V C;  5FKT A;  3IUN A;  2CE8 A;  4JHN A;  4XYH A;  4L9O A;  5FXY A;  4ZOY A;  1H2W A;  5IGO A;  2BCJ B;  4D6V A;  3MVD K;  3DXK C;  1SQ9 A;  2XDW A;  2Z2N A;  5THA A;  3OF7 A;  1UOO A;  3OL2 B;  5HE1 B;  4WK0 A;  1VZ3 A;  1QFS A;  3PXW D;  4ERQ A;  4CY5 A;  2G99 A;  3PSL A;  3EI1 B;  4BUJ C;  4BCB A;  4Y7R A;  4O2W A;  3EI2 B;  3QI0 A;  3V4P A;  4PNK B;  2GNQ A;  2I3S A;  3O4I A;  4E5Z B;  2JKX A;  3RN1 D;  2IWF A;  1H2Y A;  2VDO A;  3CFV A;  1ERJ A;  5I5J A;  4GMB A;  4K3J B;  5HE2 B;  4FHL A;  3SN6 B;  4A7J A;  4A11 A;  4N14 A;  4G56 B;  1L5G A;  4XYI A;  3MKS B;  3K26 A;  1VYH C;  3MZK A;  5FFG A;  3B7F A;  1S4U X;  5EAR A;  3F3P A;  4X61 B;  3A0F A;  4J0X A;  3T3M A;  3IUJ A;  4A0B B;  2HXC A;  5FFO A;  5CXB A;  4KFM B;  3UKU C;  2YB8 B;  3IVM A;  3C99 A;  3V7D B;  4CY2 A;  1GOG A;  4ZN4 A;  2AGL A;  4DNU A;  3NID A;  3EQ9 A;  4FA9 D;  3NVQ A;  2B5L A;  4CI1 A;  4J82 A;  4I79 A;  5GMK n;  3UVN A;  4LGN A;  3JAM g;  2MTA H;  3SLE D;  3KCI A;  2P9P C;  3IJ0 A;  5FA5 B;  1JJU B;  3DWL C;  3FGB A;  4GQB B;  3VI4 A;  2VDK A;  4H5I A;  1H2Z A;  4CZV A;  1GG2 B;  3ORV D;  1I2M B;  3I7P A;  3MXX A;  4O1Q D;  4ZOV A;  3ZE1 A;  4AN1 A;  4G1E A;  5A2Q g;  3I7N A;  2BKL A;  4NAA A;  4A0A A;  5TEE A;  1RI6 A;  3GD1 I;  5IT9 g;  4PXW A;  3OW8 A;  3VI3 A;  1O6F A;  3NVN A; 
#chains in the Genus database with same CATH homology
 4MMZ A;  3IJE A;  2VDL A;  5FFG A;  4MMX A;  1U8C A;  4UM9 A;  4Z7Q A;  3FCU A;  5E6R A;  4Z7O A;  3VI4 A;  4WJK A;  4UM8 A;  2VDK A;  3T3M A;  4WK2 A;  3NIG A;  5FFO A;  3ZDY A;  1M1X A;  2VDQ A;  4IRZ A;  1JV2 A;  3V4P A;  3ZE1 A;  3K71 A;  2VDM A;  4WK4 A;  3ZE2 A;  3FCS A;  3K72 A;  4G1E A;  3ZDX A;  2VDP A;  2VDN A;  4MMY A;  4NEN A;  2VDR A;  3T3P A;  3K6S A;  2VDO A;  3NID A;  5HDB A;  3NIF A;  1TYE A;  3ZE0 A;  5E6S A;  4O02 A;  5E6U A;  4G1M A;  3V4V A;  3ZDZ A;  4Z7N A;  3VI3 A;  1L5G A;  2VC2 A;  4WK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...