3SCYA

Crystal structure of a putative 6-phosphogluconolactonase (bf1038) from bacteroides fragilis nctc 9343 at 1.50 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
356
structure length
356
Chain Sequence
DPSTTDSELTMLVGTYTSGNSKGIYTFRFNEETGESLPLSDAEVANPSYLIPSADGKFVYSVNEFSKDQAAVSAFAFDKEKGTLHLLNTQKTMGADPCYLTTNGKNIVTANYSGGSITVFPIGQDGALLPASDVIEFKGSGPDKERQTMPHLHCVRITPDGKYLLADDLGTDQIHKFNINPNANADNKEKFLTKGTPEAFKVAPGSGPRHLIFNSDGKFAYLINEIGGTVIAFRYADGMLDEIQTVAADTVNAQGSGDIHLSPDGKYLYASNRLKADGVAIFKVDETNGTLTKVGYQLTGIHPRNFIITPNGKYLLVACRDTNVIQIFERDQATGLLTDIKKDIKVDKPVCLKFVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hypothetical bacterial 6-phosphogluconolactonase
publication title Crystal structure of a Hypothetical bacterial 6-phosphogluconolactonase (BF1038) from Bacteroides fragilis NCTC 9343 at 1.50 A resolution
rcsb
source organism Bacteroides fragilis
total genus 100
structure length 356
sequence length 356
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10282 Lactonase Lactonase, 7-bladed beta-propeller
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3scyA00
3SFZA 5EAPA 1TYQC 1U4CA 2B5MA 2HKMA 4A08A 5I5JA 5EMJB 3NVQA 5IGOA 4GGCA 2H14A 3MMYA 4CZXA 2HKRA 4Y5RD 2H3XA 2CO0A 3U4YA 2OIZA 2I3SA 4GMBA 2IWFA 3UVLA 2PM7B 2OVPB 3HFQA 3EU7A 3I7NA 3N0DA 2PM9A 2YMUA 2QC5A 4ZOVA 1FWXA 5IGQA 3F3GA 3OL2B 4XYIA 1U2VC 2HXCA 3JPXA 2CN2A 3SMRA 2XL2A 4CZVA 3I7OA 3MZLA 4FA9D 2CE9A 2YNPA 5K1CC 3I7KA 1B9XA 3J80g 4J8GA 3C9CA 2H47A 1P22A 5KDOB 3EG6A 2PM9B 4NSXA 3RRMC 2I0SA 3VA6A 3SXTD 3A0FA 3RFHA 3OKTA 4CY5A 3OTTA 5EMMB 2I0RA 4R7AB 4QRJA 4OZUA 5IT9g 4O9DA 1SQJA 3SWSD 2H9PA 2YBAA 5EAMA 1A0RB 4LGNA 3EI3B 4J84A 2XL3A 2H6QA 5AMSA 3MKSB 3MKQA 3B7FA 3PXSD 3IJ0A 4JSXC 3GFCA 2AH1A 2H6KA 4QQEA 2BCJB 4A09A 1JOFA 5GSAA 4O45A 5SXMA 4E5ZB 2QXVA 4JSPC 4L9OA 4AOWA 3IJCA 3JZNA 3RN1D 5HYNB 1K8KC 2Z2NA 4L3HD 2B4EA 2OVQB 2BBKH 2AH0A 5EM2B 5H1MA 4J0XA 3PXWD 5HE1B 2IUQA 4CI1A 2IAAA 1MG2A 3UVKA 4A09B 4J79A 3P4FA 2PM6B 2OK6A 5FKRA 1XIPA 1MDAH 4ZOYA 3SHFA 3BG0A 5TF2A 2J56H 2CN3A 3F3FA 4FAVD 1S4UX 4AEZA 2H68A 3MZKA 1R5MA 2XYIA 4ERQA 5EARA 1GXRA 5EMLB 5I5MA 3DM0A 4CY2A 2GC4A 4YVDA 3EI1A 4L3GD 4O1QD 4JSVC 4U7AA 4OWRA 2B5LA 3AFCA 3I7PA 3KRWB 4ZN4A 3VH0A 5H17A 4PSWB 3IJ1A 4MK0B 2J55H 2AGZA 4CI8A 3SVWD 5K19A 3RN0D 4PBZA 4FA1D 1NR0A 2YNOA 5C2WB 3VGZA 1PEVA 4JSNC 3SN6B 2HYEA 3OKWA 1GG2B 3OKYB 4PBYA 5FKSA 4ES0A 4PC0A 4J78A 1JJUB 2IUVA 4D0KA 3I8EA 4O3TB 3EI1B 2H9NA 4J82A 1VYHC 4K3JB 5HQGA 2P9KC 4Y7RA 4A08B 2O9KA 4LG8A 3BWSA 3UVOA 4L1QD 5AJAA 4HDJA 4TZ4A 4BUJC 4QT8A 4I79A 4GQ2P 4D6VA 1OLZA 4FA5D 3I7LA 5CXBA 3EI4A 1Q47A 3K27A 4J81A 4J86A 3AL8A 4E54A 2IUPA 3UVNA 3KRXB 4GQBB 4G56B 5HE0B 4CI2A 5C2VB 1B9YA 2P9IC 3CFVA 3SJLD 4PSXB 2YNNA 3SBPA 3ODTA 3PSCB 3EMHA 4IA9A 5IC7A 2GC7A 3IKOA 2HJ4A 2W18A 3JZHA 2I0TA 4E54B 1RI6A 3UKUC 2P9SC 2IWKA 4X61B 3W15A 2AGWA 3FRXA 4FB1D 2J57G 4CY3A 5H14A 3JAMg 1SHYB 1YFQA 4ERYA 5C9ZB 4IMMA 1QNIA 1MG3A 2YB8B 3FGBA 4JXMA 4A0AA 5FQDA 4A2LA 4A11A 3PSLA 1PI6A 3ORVD 4J77A 4FA4D 3UKRC 4XYHA 2OJYA 1K32A 4XEIC 2H13A 2UZXB 3C5MA 4ESGA 2AGYA 4GZ8A 3DXKC 3MXXA 5EMKB 3IIWA 3C99A 5CYKA 4N14A 5IJ7E 3L4OD 4PNKB 4A2MA 2IURA 2PBIB 1NEXB 3CFSB 2EBSA 5FKQA 4A0BA 4A11B 5GXHA 4JT6C 2H9MA 3ULEC 3EI2A 3JROA 3JB9L 5AFU3 2Z2PA 3RSEC 3SLED 5GMKn 4CI3A 3I89A 5THAA 1JMXB 1ERJA 5CYKB 4H5IA 1OMWB 5FKTA 4LG9A 5IJ8E 4A0BB 2H6NA 5FA5B 5TEEA 2I3TA 2MTAH 3OL2A 3EI2B 2Q7QA 5EALA 3N0EA 1N6EA 1TBGA 2AGXA 1GOTB 4CZYA 3CIKB 1L0QA 4FWWA 1XKSA 4BH6A 3JRPA 4KFMB 3I7HA 3F3PA 2P9PC 2CO0C 5I5IA 4ERZA 2P9LC 4PXWA 4UI9R 4A7JA 3DSMA 4X60B 3L4MD 4U1EI 3RMZD 2UZYB 3E0CA 3OW8A 2G99A 4J0WA 4H5JA 2G9AA 4CC9A 3RLMD 5TEFA 3I8CA 5B4WA 3EI3A 5CXBB 3EI4B 4FHLA 3PE7A 2HJBA 3IIYA 4J8BA 4X63B 3SBRA 3AL8B 4J73A 1XHMA 3V7DB 4E5ZA 3UR4A 5HE3B 3PXTD 3ZWLB 2OVRB 5HE2B 3SCYA 5GXIA 3JZGA 2GNQA 3BG1A 5EM2A 5FLXg 3AL9A 3GREA 2AGLA 2CE8A 4K3ID 2OK4A 3V9FA 5TDHB 4QL1A 3UVMA 2HESX 4JD2C 2XU7A 3I2NA 5JWZA 4JT5C 1GP2B 3PVWB 4CY1A 5CXCA 4J87A 4EWRA 4GM3A 3DWLC 4Z8LA 2Z2OA 3K26A 4GM9A 2B5NA 2TRCB 2P9NC 4O3UB 4ZOXA 3NVXA 4GGAA 1PGUA 4BL0A 4GQ1A 2CNXA 1N6DA 3DXMC 4A0AB 3FM0A 5FXYA 1SQ9A 3EWEA 4X3EA 1PBYB 3AH8B 3PVUB 3C75H 3V5WB 5A2Qg 3SBQA 3RFGA 5CXCB 3NVNA 4ZOZA 2AQ5A 2H9LA 4GM8A 3J81g 4FAND 1JMZB 2P9UC 4GGDA 3OKYA 1N6FA
chains in the Genus database with same CATH superfamily
3SFZA 4WK4A 5EAPA 1UOOA 1TYQC 1YR2A 1U4CA 2B5MA 3FCSA 2HKMA 2VDLA 4MMXA 4DNUA 4A08A 5I5JA 5EMJB 1I2MB 3NVQA 5IGOA 4GGCA 3EQ7A 2H14A 3MMYA 4CZXA 2HKRA 4Y5RD 2H3XA 2CO0A 4NAAA 3U4YA 2OIZA 2QZPA 2I3SA 3IUJA 4GMBA 2EIBA 2IWFA 3UVLA 2PM7B 3IJEA 2OVPB 3HFQA 2VDQA 4NENA 1H2YA 3EU7A 3I7NA 3K72A 3N0DA 2PM9A 2HU7A 3GD1I 2YMUA 2QC5A 4ZOVA 1FWXA 5IGQA 1UOQA 3F3GA 3OL2B 4XYIA 1U2VC 3NIGA 2HXCA 3JPXA 4AN1A 2CN2A 3SMRA 2XL2A 4CZVA 2WQ8A 3I7OA 3V4VA 3O4GA 3MZLA 4FA9D 2CE9A 5HDBA 2YNPA 5E6UA 5K1CC 3I7KA 1B9XA 3J80g 4UM9A 4J8GA 3C9CA 1VE6A 2H47A 1P22A 3MUOA 5KDOB 3EG6A 2PM9B 4NSXA 3RRMC 2I0SA 1GOFA 3VA6A 5FFOA 3SXTD 1L5GA 3A0FA 3MVDK 4WK2A 3RFHA 3OKTA 4CY5A 3O4HA 3OTTA 5EMMB 2I0RA 4R7AB 4QRJA 4OZUA 5IT9g 1QFSA 4O9DA 1SQJA 3SWSD 2H9PA 3IULA 2YBAA 5EAMA 1A0RB 2VC2A 4LGNA 3EI3B 4J84A 2XL3A 2H6QA 3T3PA 5AMSA 3MKSB 1VE7A 4Z7NA 3MKQA 3B7FA 1K3IA 3PXSD 3IJ0A 4JSXC 3GFCA 2AH1A 2H6KA 4QQEA 2BCJB 4A09A 1JOFA 5GSAA 3K71A 4O45A 5SXMA 4BCBA 4E5ZB 2QXVA 4JSPC 4L9OA 4AOWA 3IJCA 3JZNA 3RN1D 5HYNB 1K8KC 2Z2NA 4L3HD 4D9SA 2B4EA 2OVQB 2BBKH 1T2XA 2AH0A 2VDPA 5EM2B 5H1MA 1U8CA 3O4JA 4J0XA 3PXWD 5HE1B 2IUQA 4CI1A 1A12A 2IAAA 1MG2A 4WJKA 3UVKA 4A09B 4G55A 4J79A 3P4FA 2PM6B 2OK6A 5FKRA 1XIPA 1MDAH 4ZOYA 3SHFA 3BG0A 5TF2A 2J56H 1H2XA 5C92A 4AMZA 2CN3A 3F3FA 4FAVD 1S4UX 4AEZA 2H68A 3ZE0A 3MZKA 1R5MA 3OF7A 2XYIA 4O02A 4ERQA 5EARA 1GXRA 5EMLB 3FCUA 3DM0A 5I5MA 4CY2A 2GC4A 4YVDA 3ZE2A 3EI1A 4L3GD 4O1QD 1QFMA 4JSVC 4U7AA 4OWRA 2B5LA 3AFCA 3I7PA 3KRWB 4ZN4A 3VH0A 5H17A 4PSWB 3IJ1A 3NIFA 3QHYB 3QI0A 1GOGA 4MK0B 2J55H 2AGZA 4CI8A 3SVWD 4BCDA 5K19A 3RN0D 3KCIA 4UM8A 4PBZA 4FA1D 1NR0A 2YNOA 5C2WB 3VGZA 5M5SA 1PEVA 4JSNC 3SN6B 2HYEA 3OKWA 1GG2B 1JTDB 3OKYB 4PBYA 5FKSA 4ES0A 3IUQA 4PC0A 4J78A 1JJUB 2IUVA 4D0KA 3I8EA 4QAMA 4O3TB 3EI1B 2H9NA 4J82A 1VYHC 4K3JB 4L1MA 1H2WA 2P9KC 4RE6A 5HQGA 4AX4A 4Y7RA 4A08B 2O9KA 4LG8A 3BWSA 3UVOA 4L1QD 5AJAA 4HDJA 4TZ4A 4BUJC 5M5VA 4QT8A 4I79A 3EQ8A 4GQ2P 3ZDYA 4D6VA 1OLZA 4BP9A 4FA5D 3I7LA 5CXBA 3EI4A 1Q47A 3K27A 3VI3A 3T3MA 4J81A 2VZ1A 4J86A 4RE5A 3ZDZA 3AL8A 4E54A 2IUPA 3UVNA 3KRXB 4GQBB 5E6SA 4G56B 5HE0B 1M1XA 4Z7QA 4CI2A 5M5TA 5C2VB 1B9YA 2P9IC 3CFVA 3SJLD 4PSXB 2YNNA 4JHPC 3SBPA 3ODTA 3PSCB 3EMHA 4IA9A 5IC7A 2GC7A 3IUNA 1O6FA 4AMYA 3IKOA 1VZ2A 2HJ4A 2W18A 3JZHA 3DDUA 2I0TA 4E54B 1RI6A 3UKUC 2P9SC 2IWKA 3ZDXA 4X61B 3VI4A 3W15A 2AGWA 2JKXA 3FRXA 4FB1D 5C86A 2J57G 4CY3A 5H14A 4G1EA 3JAMg 4NBMA 1SHYB 3IVMA 1YFQA 4ERYA 5C9ZB 4IMMA 3ZE1A 1QNIA 1C9IA 1MG3A 1UOPA 2YB8B 3FGBA 4JXMA 4A0AA 5FQDA 4A2LA 4A11A 3PSLA 1PI6A 3ORVD 4J77A 4FA4D 3UKRC 4XYHA 2OJYA 1K32A 4XEIC 2H13A 2UZXB 2VDMA 3C5MA 4ESGA 2AGYA 3V4PA 4GZ8A 3EQ9A 3DXKC 3MXXA 5EMKB 3IIWA 3C99A 5CYKA 4N14A 5IJ7E 3L4OD 4PNKB 2BKLA 2VDOA 4A2MA 2IURA 2PBIB 1NEXB 3CFSB 2EBSA 5FKQA 3K6SA 4A0BA 4A11B 2VDKA 5GXHA 4JT6C 1GOHA 1TYEA 2H9MA 3ULEC 3EI2A 4JHNA 3JROA 3JB9L 5AFU3 2Z2PA 3RSEC 3SLED 5GMKn 4CI3A 3I89A 5THAA 3GC3B 1JMXB 1ERJA 4BCCA 2VDRA 5CYKB 4H5IA 1OMWB 4MMYA 4BP8A 5FKTA 4LG9A 2VZ3A 5IJ8E 4A0BB 5FFGA 1E5TA 2H6NA 5FA5B 5TEEA 2I3TA 2MTAH 3OL2A 4WK0A 3EI2B 5E6RA 2Q7QA 4NC4A 5EALA 3N0EA 1N6EA 1TBGA 2AGXA 4O2WA 1GOTB 4CZYA 3CIKB 1L0QA 4FWWA 1XKSA 4BH6A 3JRPA 4KFMB 4AN0A 3I7HA 3F3PA 4IRZA 2EIDA 2P9PC 4G1MA 4DNVA 2CO0C 5I5IA 4ERZA 2P9LC 4PXWA 4UI9R 5M61A 4A7JA 1E8NA 3DSMA 4X60B 3L4MD 5M5RA 4U1EI 3RMZD 1UTCA 2UZYB 3E0CA 3NIDA 3OW8A 2G99A 4J0WA 4H5JA 2G9AA 4CC9A 2XE4A 3RLMD 5TEFA 2QR5A 3I8CA 5B4WA 3EI3A 5CXBB 3EI4B 2HU8A 4FHLA 3PE7A 2HJBA 3IIYA 4J8BA 1VZ3A 4X63B 3SBRA 2EIEA 3AL8B 4J73A 1XHMA 3V7DB 4E5ZA 2XDWA 3UR4A 5HE3B 3PXTD 3ZWLB 2OVRB 1E8MA 5HE2B 3SCYA 1H2ZA 5GXIA 5M5UA 3JZGA 3MUNA 2GNQA 3BG1A 5EM2A 3IUMA 5FLXg 3AL9A 3GREA 2AGLA 2CE8A 4K3ID 2OK4A 1O6GA 4MMZA 3V9FA 5TDHB 3IURA 4QL1A 3UVMA 2HESX 4JD2C 2XU7A 3I2NA 5JWZA 4JT5C 1GP2B 3PVWB 4CY1A 5CXCA 4J87A 4EWRA 4GM3A 3DWLC 4Z8LA 2Z2OA 3K26A 4GM9A 2B5NA 2TRCB 2HU5A 2P9NC 4O3UB 4ZOXA 3NVXA 4GGAA 1PGUA 4BL0A 4GQ1A 2CNXA 1N6DA 1JV2A 3DXMC 4A0AB 3FM0A 5FXYA 1SQ9A 3EWEA 4X3EA 1PBYB 2VDNA 3AH8B 4Z7OA 3PVUB 3C75H 3V5WB 5A2Qg 3SBQA 3RFGA 1BPOA 5CXCB 3NVNA 4ZOZA 2EICA 2AQ5A 2H9LA 4GM8A 3J81g 4FAND 3O4IA 1JMZB 2P9UC 4GGDA 1C9LA 3OKYA 1N6FA 2XZGA 4DNWA
chains in the Genus database with same CATH topology
3SFZA 5EAPA 1TYQC 1U4CA 2B5MA 2HKMA 4A08A 5I5JA 5EMJB 3NVQA 5IGOA 4GGCA 2H14A 3MMYA 4CZXA 2HKRA 4Y5RD 2H3XA 2CO0A 3U4YA 2OIZA 2I3SA 4GMBA 2IWFA 3UVLA 2PM7B 2OVPB 3HFQA 3EU7A 3I7NA 3N0DA 2PM9A 2YMUA 2QC5A 4ZOVA 1FWXA 5IGQA 3F3GA 3OL2B 4XYIA 1U2VC 2HXCA 3JPXA 2CN2A 3SMRA 2XL2A 4CZVA 3I7OA 3MZLA 4FA9D 2CE9A 2YNPA 5K1CC 3I7KA 1B9XA 3J80g 4J8GA 3C9CA 2H47A 1P22A 5KDOB 3EG6A 2PM9B 4NSXA 3RRMC 2I0SA 3VA6A 3SXTD 3A0FA 3RFHA 3OKTA 4CY5A 3OTTA 5EMMB 2I0RA 4R7AB 4QRJA 4OZUA 5IT9g 4O9DA 1SQJA 3SWSD 2H9PA 2YBAA 5EAMA 1A0RB 4LGNA 3EI3B 4J84A 2XL3A 2H6QA 5AMSA 3MKSB 3MKQA 3B7FA 3PXSD 3IJ0A 4JSXC 3GFCA 2AH1A 2H6KA 4QQEA 2BCJB 4A09A 1JOFA 5GSAA 4O45A 5SXMA 4E5ZB 2QXVA 4JSPC 4L9OA 4AOWA 3IJCA 3JZNA 3RN1D 5HYNB 1K8KC 2Z2NA 4L3HD 2B4EA 2OVQB 2BBKH 2AH0A 5EM2B 5H1MA 4J0XA 3PXWD 5HE1B 2IUQA 4CI1A 2IAAA 1MG2A 3UVKA 4A09B 4J79A 3P4FA 2PM6B 2OK6A 5FKRA 1XIPA 1MDAH 4ZOYA 3SHFA 3BG0A 5TF2A 2J56H 2CN3A 3F3FA 4FAVD 1S4UX 4AEZA 2H68A 3MZKA 1R5MA 2XYIA 4ERQA 5EARA 1GXRA 5EMLB 5I5MA 3DM0A 4CY2A 2GC4A 4YVDA 3EI1A 4L3GD 4O1QD 4JSVC 4U7AA 4OWRA 2B5LA 3AFCA 3I7PA 3KRWB 4ZN4A 3VH0A 5H17A 4PSWB 3IJ1A 4MK0B 2J55H 2AGZA 4CI8A 3SVWD 5K19A 3RN0D 4PBZA 4FA1D 1NR0A 2YNOA 5C2WB 3VGZA 1PEVA 4JSNC 3SN6B 2HYEA 3OKWA 1GG2B 3OKYB 4PBYA 5FKSA 4ES0A 4PC0A 4J78A 1JJUB 2IUVA 4D0KA 3I8EA 4O3TB 3EI1B 2H9NA 4J82A 1VYHC 4K3JB 5HQGA 2P9KC 4Y7RA 4A08B 2O9KA 4LG8A 3BWSA 3UVOA 4L1QD 5AJAA 4HDJA 4TZ4A 4BUJC 4QT8A 4I79A 4GQ2P 4D6VA 1OLZA 4FA5D 3I7LA 5CXBA 3EI4A 1Q47A 3K27A 4J81A 4J86A 3AL8A 4E54A 2IUPA 3UVNA 3KRXB 4GQBB 4G56B 5HE0B 4CI2A 5C2VB 1B9YA 2P9IC 3CFVA 3SJLD 4PSXB 2YNNA 3SBPA 3ODTA 3PSCB 3EMHA 4IA9A 5IC7A 2GC7A 3IKOA 2HJ4A 2W18A 3JZHA 2I0TA 4E54B 1RI6A 3UKUC 2P9SC 2IWKA 4X61B 3W15A 2AGWA 3FRXA 4FB1D 2J57G 4CY3A 5H14A 3JAMg 1SHYB 1YFQA 4ERYA 5C9ZB 4IMMA 1QNIA 1MG3A 2YB8B 3FGBA 4JXMA 4A0AA 5FQDA 4A2LA 4A11A 3PSLA 1PI6A 3ORVD 4J77A 4FA4D 3UKRC 4XYHA 2OJYA 1K32A 4XEIC 2H13A 2UZXB 3C5MA 4ESGA 2AGYA 4GZ8A 3DXKC 3MXXA 5EMKB 3IIWA 3C99A 5CYKA 4N14A 5IJ7E 3L4OD 4PNKB 4A2MA 2IURA 2PBIB 1NEXB 3CFSB 2EBSA 5FKQA 4A0BA 4A11B 5GXHA 4JT6C 2H9MA 3ULEC 3EI2A 3JROA 3JB9L 5AFU3 2Z2PA 3RSEC 3SLED 5GMKn 4CI3A 3I89A 5THAA 1JMXB 1ERJA 5CYKB 4H5IA 1OMWB 5FKTA 4LG9A 5IJ8E 4A0BB 2H6NA 5FA5B 5TEEA 2I3TA 2MTAH 3OL2A 3EI2B 2Q7QA 5EALA 3N0EA 1N6EA 1TBGA 2AGXA 1GOTB 4CZYA 3CIKB 1L0QA 4FWWA 1XKSA 4BH6A 3JRPA 4KFMB 3I7HA 3F3PA 2P9PC 2CO0C 5I5IA 4ERZA 2P9LC 4PXWA 4UI9R 4A7JA 3DSMA 4X60B 3L4MD 4U1EI 3RMZD 2UZYB 3E0CA 3OW8A 2G99A 4J0WA 4H5JA 2G9AA 4CC9A 3RLMD 5TEFA 3I8CA 5B4WA 3EI3A 5CXBB 3EI4B 4FHLA 3PE7A 2HJBA 3IIYA 4J8BA 4X63B 3SBRA 3AL8B 4J73A 1XHMA 3V7DB 4E5ZA 3UR4A 5HE3B 3PXTD 3ZWLB 2OVRB 5HE2B 3SCYA 5GXIA 3JZGA 2GNQA 3BG1A 5EM2A 5FLXg 3AL9A 3GREA 2AGLA 2CE8A 4K3ID 2OK4A 3V9FA 5TDHB 4QL1A 3UVMA 2HESX 4JD2C 2XU7A 3I2NA 5JWZA 4JT5C 1GP2B 3PVWB 4CY1A 5CXCA 4J87A 4EWRA 4GM3A 3DWLC 4Z8LA 2Z2OA 3K26A 4GM9A 2B5NA 2TRCB 2P9NC 4O3UB 4ZOXA 3NVXA 4GGAA 1PGUA 4BL0A 4GQ1A 2CNXA 1N6DA 3DXMC 4A0AB 3FM0A 5FXYA 1SQ9A 3EWEA 4X3EA 1PBYB 3AH8B 3PVUB 3C75H 3V5WB 5A2Qg 3SBQA 3RFGA 5CXCB 3NVNA 4ZOZA 2AQ5A 2H9LA 4GM8A 3J81g 4FAND 1JMZB 2P9UC 4GGDA 3OKYA 1N6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFZ A;  5EAP A;  1TYQ C;  1U4C A;  2B5M A;  2HKM A;  4A08 A;  5I5J A;  5EMJ B;  3NVQ A;  5IGO A;  4GGC A;  2H14 A;  3MMY A;  4CZX A;  2HKR A;  4Y5R D;  2H3X A;  2CO0 A;  3U4Y A;  2OIZ A;  2I3S A;  4GMB A;  2IWF A;  3UVL A;  2PM7 B;  2OVP B;  3HFQ A;  3EU7 A;  3I7N A;  3N0D A;  2PM9 A;  2YMU A;  2QC5 A;  4ZOV A;  1FWX A;  5IGQ A;  3F3G A;  3OL2 B;  4XYI A;  1U2V C;  2HXC A;  3JPX A;  2CN2 A;  3SMR A;  2XL2 A;  4CZV A;  3I7O A;  3MZL A;  4FA9 D;  2CE9 A;  2YNP A;  5K1C C;  3I7K A;  1B9X A;  3J80 g;  4J8G A;  3C9C A;  2H47 A;  1P22 A;  5KDO B;  3EG6 A;  2PM9 B;  4NSX A;  3RRM C;  2I0S A;  3VA6 A;  3SXT D;  3A0F A;  3RFH A;  3OKT A;  4CY5 A;  3OTT A;  5EMM B;  2I0R A;  4R7A B;  4QRJ A;  4OZU A;  5IT9 g;  4O9D A;  1SQJ A;  3SWS D;  2H9P A;  2YBA A;  5EAM A;  1A0R B;  4LGN A;  3EI3 B;  4J84 A;  2XL3 A;  2H6Q A;  5AMS A;  3MKS B;  3MKQ A;  3B7F A;  3PXS D;  3IJ0 A;  4JSX C;  3GFC A;  2AH1 A;  2H6K A;  4QQE A;  2BCJ B;  4A09 A;  1JOF A;  5GSA A;  4O45 A;  5SXM A;  4E5Z B;  2QXV A;  4JSP C;  4L9O A;  4AOW A;  3IJC A;  3JZN A;  3RN1 D;  5HYN B;  1K8K C;  2Z2N A;  4L3H D;  2B4E A;  2OVQ B;  2BBK H;  2AH0 A;  5EM2 B;  5H1M A;  4J0X A;  3PXW D;  5HE1 B;  2IUQ A;  4CI1 A;  2IAA A;  1MG2 A;  3UVK A;  4A09 B;  4J79 A;  3P4F A;  2PM6 B;  2OK6 A;  5FKR A;  1XIP A;  1MDA H;  4ZOY A;  3SHF A;  3BG0 A;  5TF2 A;  2J56 H;  2CN3 A;  3F3F A;  4FAV D;  1S4U X;  4AEZ A;  2H68 A;  3MZK A;  1R5M A;  2XYI A;  4ERQ A;  5EAR A;  1GXR A;  5EML B;  5I5M A;  3DM0 A;  4CY2 A;  2GC4 A;  4YVD A;  3EI1 A;  4L3G D;  4O1Q D;  4JSV C;  4U7A A;  4OWR A;  2B5L A;  3AFC A;  3I7P A;  3KRW B;  4ZN4 A;  3VH0 A;  5H17 A;  4PSW B;  3IJ1 A;  4MK0 B;  2J55 H;  2AGZ A;  4CI8 A;  3SVW D;  5K19 A;  3RN0 D;  4PBZ A;  4FA1 D;  1NR0 A;  2YNO A;  5C2W B;  3VGZ A;  1PEV A;  4JSN C;  3SN6 B;  2HYE A;  3OKW A;  1GG2 B;  3OKY B;  4PBY A;  5FKS A;  4ES0 A;  4PC0 A;  4J78 A;  1JJU B;  2IUV A;  4D0K A;  3I8E A;  4O3T B;  3EI1 B;  2H9N A;  4J82 A;  1VYH C;  4K3J B;  5HQG A;  2P9K C;  4Y7R A;  4A08 B;  2O9K A;  4LG8 A;  3BWS A;  3UVO A;  4L1Q D;  5AJA A;  4HDJ A;  4TZ4 A;  4BUJ C;  4QT8 A;  4I79 A;  4GQ2 P;  4D6V A;  1OLZ A;  4FA5 D;  3I7L A;  5CXB A;  3EI4 A;  1Q47 A;  3K27 A;  4J81 A;  4J86 A;  3AL8 A;  4E54 A;  2IUP A;  3UVN A;  3KRX B;  4GQB B;  4G56 B;  5HE0 B;  4CI2 A;  5C2V B;  1B9Y A;  2P9I C;  3CFV A;  3SJL D;  4PSX B;  2YNN A;  3SBP A;  3ODT A;  3PSC B;  3EMH A;  4IA9 A;  5IC7 A;  2GC7 A;  3IKO A;  2HJ4 A;  2W18 A;  3JZH A;  2I0T A;  4E54 B;  1RI6 A;  3UKU C;  2P9S C;  2IWK A;  4X61 B;  3W15 A;  2AGW A;  3FRX A;  4FB1 D;  2J57 G;  4CY3 A;  5H14 A;  3JAM g;  1SHY B;  1YFQ A;  4ERY A;  5C9Z B;  4IMM A;  1QNI A;  1MG3 A;  2YB8 B;  3FGB A;  4JXM A;  4A0A A;  5FQD A;  4A2L A;  4A11 A;  3PSL A;  1PI6 A;  3ORV D;  4J77 A;  4FA4 D;  3UKR C;  4XYH A;  2OJY A;  1K32 A;  4XEI C;  2H13 A;  2UZX B;  3C5M A;  4ESG A;  2AGY A;  4GZ8 A;  3DXK C;  3MXX A;  5EMK B;  3IIW A;  3C99 A;  5CYK A;  4N14 A;  5IJ7 E;  3L4O D;  4PNK B;  4A2M A;  2IUR A;  2PBI B;  1NEX B;  3CFS B;  2EBS A;  5FKQ A;  4A0B A;  4A11 B;  5GXH A;  4JT6 C;  2H9M A;  3ULE C;  3EI2 A;  3JRO A;  3JB9 L;  5AFU 3;  2Z2P A;  3RSE C;  3SLE D;  5GMK n;  4CI3 A;  3I89 A;  5THA A;  1JMX B;  1ERJ A;  5CYK B;  4H5I A;  1OMW B;  5FKT A;  4LG9 A;  5IJ8 E;  4A0B B;  2H6N A;  5FA5 B;  5TEE A;  2I3T A;  2MTA H;  3OL2 A;  3EI2 B;  2Q7Q A;  5EAL A;  3N0E A;  1N6E A;  1TBG A;  2AGX A;  1GOT B;  4CZY A;  3CIK B;  1L0Q A;  4FWW A;  1XKS A;  4BH6 A;  3JRP A;  4KFM B;  3I7H A;  3F3P A;  2P9P C;  2CO0 C;  5I5I A;  4ERZ A;  2P9L C;  4PXW A;  4UI9 R;  4A7J A;  3DSM A;  4X60 B;  3L4M D;  4U1E I;  3RMZ D;  2UZY B;  3E0C A;  3OW8 A;  2G99 A;  4J0W A;  4H5J A;  2G9A A;  4CC9 A;  3RLM D;  5TEF A;  3I8C A;  5B4W A;  3EI3 A;  5CXB B;  3EI4 B;  4FHL A;  3PE7 A;  2HJB A;  3IIY A;  4J8B A;  4X63 B;  3SBR A;  3AL8 B;  4J73 A;  1XHM A;  3V7D B;  4E5Z A;  3UR4 A;  5HE3 B;  3PXT D;  3ZWL B;  2OVR B;  5HE2 B;  3SCY A;  5GXI A;  3JZG A;  2GNQ A;  3BG1 A;  5EM2 A;  5FLX g;  3AL9 A;  3GRE A;  2AGL A;  2CE8 A;  4K3I D;  2OK4 A;  3V9F A;  5TDH B;  4QL1 A;  3UVM A;  2HES X;  4JD2 C;  2XU7 A;  3I2N A;  5JWZ A;  4JT5 C;  1GP2 B;  3PVW B;  4CY1 A;  5CXC A;  4J87 A;  4EWR A;  4GM3 A;  3DWL C;  4Z8L A;  2Z2O A;  3K26 A;  4GM9 A;  2B5N A;  2TRC B;  2P9N C;  4O3U B;  4ZOX A;  3NVX A;  4GGA A;  1PGU A;  4BL0 A;  4GQ1 A;  2CNX A;  1N6D A;  3DXM C;  4A0A B;  3FM0 A;  5FXY A;  1SQ9 A;  3EWE A;  4X3E A;  1PBY B;  3AH8 B;  3PVU B;  3C75 H;  3V5W B;  5A2Q g;  3SBQ A;  3RFG A;  5CXC B;  3NVN A;  4ZOZ A;  2AQ5 A;  2H9L A;  4GM8 A;  3J81 g;  4FAN D;  1JMZ B;  2P9U C;  4GGD A;  3OKY A;  1N6F A; 
#chains in the Genus database with same CATH topology
 3SFZ A;  4WK4 A;  5EAP A;  1UOO A;  1TYQ C;  1YR2 A;  1U4C A;  2B5M A;  3FCS A;  2HKM A;  2VDL A;  4MMX A;  4DNU A;  4A08 A;  5I5J A;  5EMJ B;  1I2M B;  3NVQ A;  5IGO A;  4GGC A;  3EQ7 A;  2H14 A;  3MMY A;  4CZX A;  2HKR A;  4Y5R D;  2H3X A;  2CO0 A;  4NAA A;  3U4Y A;  2OIZ A;  2QZP A;  2I3S A;  3IUJ A;  4GMB A;  2EIB A;  2IWF A;  3UVL A;  2PM7 B;  3IJE A;  2OVP B;  3HFQ A;  2VDQ A;  4NEN A;  1H2Y A;  3EU7 A;  3I7N A;  3K72 A;  3N0D A;  2PM9 A;  2HU7 A;  3GD1 I;  2YMU A;  2QC5 A;  4ZOV A;  1FWX A;  5IGQ A;  1UOQ A;  3F3G A;  3OL2 B;  4XYI A;  1U2V C;  3NIG A;  2HXC A;  3JPX A;  4AN1 A;  2CN2 A;  3SMR A;  2XL2 A;  4CZV A;  2WQ8 A;  3I7O A;  3V4V A;  3O4G A;  3MZL A;  4FA9 D;  2CE9 A;  5HDB A;  2YNP A;  5E6U A;  5K1C C;  3I7K A;  1B9X A;  3J80 g;  4UM9 A;  4J8G A;  3C9C A;  1VE6 A;  2H47 A;  1P22 A;  3MUO A;  5KDO B;  3EG6 A;  2PM9 B;  4NSX A;  3RRM C;  2I0S A;  1GOF A;  3VA6 A;  5FFO A;  3SXT D;  1L5G A;  3A0F A;  3MVD K;  4WK2 A;  3RFH A;  3OKT A;  4CY5 A;  3O4H A;  3OTT A;  5EMM B;  2I0R A;  4R7A B;  4QRJ A;  4OZU A;  5IT9 g;  1QFS A;  4O9D A;  1SQJ A;  3SWS D;  2H9P A;  3IUL A;  2YBA A;  5EAM A;  1A0R B;  2VC2 A;  4LGN A;  3EI3 B;  4J84 A;  2XL3 A;  2H6Q A;  3T3P A;  5AMS A;  3MKS B;  1VE7 A;  4Z7N A;  3MKQ A;  3B7F A;  1K3I A;  3PXS D;  3IJ0 A;  4JSX C;  3GFC A;  2AH1 A;  2H6K A;  4QQE A;  2BCJ B;  4A09 A;  1JOF A;  5GSA A;  3K71 A;  4O45 A;  5SXM A;  4BCB A;  4E5Z B;  2QXV A;  4JSP C;  4L9O A;  4AOW A;  3IJC A;  3JZN A;  3RN1 D;  5HYN B;  1K8K C;  2Z2N A;  4L3H D;  4D9S A;  2B4E A;  2OVQ B;  2BBK H;  1T2X A;  2AH0 A;  2VDP A;  5EM2 B;  5H1M A;  1U8C A;  3O4J A;  4J0X A;  3PXW D;  5HE1 B;  2IUQ A;  4CI1 A;  1A12 A;  2IAA A;  1MG2 A;  4WJK A;  3UVK A;  4A09 B;  4G55 A;  4J79 A;  3P4F A;  2PM6 B;  2OK6 A;  5FKR A;  1XIP A;  1MDA H;  4ZOY A;  3SHF A;  3BG0 A;  5TF2 A;  2J56 H;  1H2X A;  5C92 A;  4AMZ A;  2CN3 A;  3F3F A;  4FAV D;  1S4U X;  4AEZ A;  2H68 A;  3ZE0 A;  3MZK A;  1R5M A;  3OF7 A;  2XYI A;  4O02 A;  4ERQ A;  5EAR A;  1GXR A;  5EML B;  3FCU A;  3DM0 A;  5I5M A;  4CY2 A;  2GC4 A;  4YVD A;  3ZE2 A;  3EI1 A;  4L3G D;  4O1Q D;  1QFM A;  4JSV C;  4U7A A;  4OWR A;  2B5L A;  3AFC A;  3I7P A;  3KRW B;  4ZN4 A;  3VH0 A;  5H17 A;  4PSW B;  3IJ1 A;  3NIF A;  3QHY B;  3QI0 A;  1GOG A;  4MK0 B;  2J55 H;  2AGZ A;  4CI8 A;  3SVW D;  4BCD A;  5K19 A;  3RN0 D;  3KCI A;  4UM8 A;  4PBZ A;  4FA1 D;  1NR0 A;  2YNO A;  5C2W B;  3VGZ A;  5M5S A;  1PEV A;  4JSN C;  3SN6 B;  2HYE A;  3OKW A;  1GG2 B;  1JTD B;  3OKY B;  4PBY A;  5FKS A;  4ES0 A;  3IUQ A;  4PC0 A;  4J78 A;  1JJU B;  2IUV A;  4D0K A;  3I8E A;  4QAM A;  4O3T B;  3EI1 B;  2H9N A;  4J82 A;  1VYH C;  4K3J B;  4L1M A;  1H2W A;  2P9K C;  4RE6 A;  5HQG A;  4AX4 A;  4Y7R A;  4A08 B;  2O9K A;  4LG8 A;  3BWS A;  3UVO A;  4L1Q D;  5AJA A;  4HDJ A;  4TZ4 A;  4BUJ C;  5M5V A;  4QT8 A;  4I79 A;  3EQ8 A;  4GQ2 P;  3ZDY A;  4D6V A;  1OLZ A;  4BP9 A;  4FA5 D;  3I7L A;  5CXB A;  3EI4 A;  1Q47 A;  3K27 A;  3VI3 A;  3T3M A;  4J81 A;  2VZ1 A;  4J86 A;  4RE5 A;  3ZDZ A;  3AL8 A;  4E54 A;  2IUP A;  3UVN A;  3KRX B;  4GQB B;  5E6S A;  4G56 B;  5HE0 B;  1M1X A;  4Z7Q A;  4CI2 A;  5M5T A;  5C2V B;  1B9Y A;  2P9I C;  3CFV A;  3SJL D;  4PSX B;  2YNN A;  4JHP C;  3SBP A;  3ODT A;  3PSC B;  3EMH A;  4IA9 A;  5IC7 A;  2GC7 A;  3IUN A;  1O6F A;  4AMY A;  3IKO A;  1VZ2 A;  2HJ4 A;  2W18 A;  3JZH A;  3DDU A;  2I0T A;  4E54 B;  1RI6 A;  3UKU C;  2P9S C;  2IWK A;  3ZDX A;  4X61 B;  3VI4 A;  3W15 A;  2AGW A;  2JKX A;  3FRX A;  4FB1 D;  5C86 A;  2J57 G;  4CY3 A;  5H14 A;  4G1E A;  3JAM g;  4NBM A;  1SHY B;  3IVM A;  1YFQ A;  4ERY A;  5C9Z B;  4IMM A;  3ZE1 A;  1QNI A;  1C9I A;  1MG3 A;  1UOP A;  2YB8 B;  3FGB A;  4JXM A;  4A0A A;  5FQD A;  4A2L A;  4A11 A;  3PSL A;  1PI6 A;  3ORV D;  4J77 A;  4FA4 D;  3UKR C;  4XYH A;  2OJY A;  1K32 A;  4XEI C;  2H13 A;  2UZX B;  2VDM A;  3C5M A;  4ESG A;  2AGY A;  3V4P A;  4GZ8 A;  3EQ9 A;  3DXK C;  3MXX A;  5EMK B;  3IIW A;  3C99 A;  5CYK A;  4N14 A;  5IJ7 E;  3L4O D;  4PNK B;  2BKL A;  2VDO A;  4A2M A;  2IUR A;  2PBI B;  1NEX B;  3CFS B;  2EBS A;  5FKQ A;  3K6S A;  4A0B A;  4A11 B;  2VDK A;  5GXH A;  4JT6 C;  1GOH A;  1TYE A;  2H9M A;  3ULE C;  3EI2 A;  4JHN A;  3JRO A;  3JB9 L;  5AFU 3;  2Z2P A;  3RSE C;  3SLE D;  5GMK n;  4CI3 A;  3I89 A;  5THA A;  3GC3 B;  1JMX B;  1ERJ A;  4BCC A;  2VDR A;  5CYK B;  4H5I A;  1OMW B;  4MMY A;  4BP8 A;  5FKT A;  4LG9 A;  2VZ3 A;  5IJ8 E;  4A0B B;  5FFG A;  1E5T A;  2H6N A;  5FA5 B;  5TEE A;  2I3T A;  2MTA H;  3OL2 A;  4WK0 A;  3EI2 B;  5E6R A;  2Q7Q A;  4NC4 A;  5EAL A;  3N0E A;  1N6E A;  1TBG A;  2AGX A;  4O2W A;  1GOT B;  4CZY A;  3CIK B;  1L0Q A;  4FWW A;  1XKS A;  4BH6 A;  3JRP A;  4KFM B;  4AN0 A;  3I7H A;  3F3P A;  4IRZ A;  2EID A;  2P9P C;  4G1M A;  4DNV A;  2CO0 C;  5I5I A;  4ERZ A;  2P9L C;  4PXW A;  4UI9 R;  5M61 A;  4A7J A;  1E8N A;  3DSM A;  4X60 B;  3L4M D;  5M5R A;  4U1E I;  3RMZ D;  1UTC A;  2UZY B;  3E0C A;  3NID A;  3OW8 A;  2G99 A;  4J0W A;  4H5J A;  2G9A A;  4CC9 A;  2XE4 A;  3RLM D;  5TEF A;  2QR5 A;  3I8C A;  5B4W A;  3EI3 A;  5CXB B;  3EI4 B;  2HU8 A;  4FHL A;  3PE7 A;  2HJB A;  3IIY A;  4J8B A;  1VZ3 A;  4X63 B;  3SBR A;  2EIE A;  3AL8 B;  4J73 A;  1XHM A;  3V7D B;  4E5Z A;  2XDW A;  3UR4 A;  5HE3 B;  3PXT D;  3ZWL B;  2OVR B;  1E8M A;  5HE2 B;  3SCY A;  1H2Z A;  5GXI A;  5M5U A;  3JZG A;  3MUN A;  2GNQ A;  3BG1 A;  5EM2 A;  3IUM A;  5FLX g;  3AL9 A;  3GRE A;  2AGL A;  2CE8 A;  4K3I D;  2OK4 A;  1O6G A;  4MMZ A;  3V9F A;  5TDH B;  3IUR A;  4QL1 A;  3UVM A;  2HES X;  4JD2 C;  2XU7 A;  3I2N A;  5JWZ A;  4JT5 C;  1GP2 B;  3PVW B;  4CY1 A;  5CXC A;  4J87 A;  4EWR A;  4GM3 A;  3DWL C;  4Z8L A;  2Z2O A;  3K26 A;  4GM9 A;  2B5N A;  2TRC B;  2HU5 A;  2P9N C;  4O3U B;  4ZOX A;  3NVX A;  4GGA A;  1PGU A;  4BL0 A;  4GQ1 A;  2CNX A;  1N6D A;  1JV2 A;  3DXM C;  4A0A B;  3FM0 A;  5FXY A;  1SQ9 A;  3EWE A;  4X3E A;  1PBY B;  2VDN A;  3AH8 B;  4Z7O A;  3PVU B;  3C75 H;  3V5W B;  5A2Q g;  3SBQ A;  3RFG A;  1BPO A;  5CXC B;  3NVN A;  4ZOZ A;  2EIC A;  2AQ5 A;  2H9L A;  4GM8 A;  3J81 g;  4FAN D;  3O4I A;  1JMZ B;  2P9U C;  4GGD A;  1C9L A;  3OKY A;  1N6F A;  2XZG A;  4DNW A; 
#chains in the Genus database with same CATH homology
 3SFZ A;  5EAP A;  1TYQ C;  1U4C A;  2B5M A;  2HKM A;  4A08 A;  5I5J A;  5EMJ B;  3NVQ A;  5IGO A;  4GGC A;  2H14 A;  3MMY A;  4CZX A;  2HKR A;  4Y5R D;  2H3X A;  2CO0 A;  3U4Y A;  2OIZ A;  2I3S A;  4GMB A;  2IWF A;  3UVL A;  2PM7 B;  2OVP B;  3HFQ A;  3EU7 A;  3I7N A;  3N0D A;  2PM9 A;  2YMU A;  2QC5 A;  4ZOV A;  1FWX A;  5IGQ A;  3F3G A;  3OL2 B;  4XYI A;  1U2V C;  2HXC A;  3JPX A;  2CN2 A;  3SMR A;  2XL2 A;  4CZV A;  3I7O A;  3MZL A;  4FA9 D;  2CE9 A;  2YNP A;  5K1C C;  3I7K A;  1B9X A;  3J80 g;  4J8G A;  3C9C A;  2H47 A;  1P22 A;  5KDO B;  3EG6 A;  2PM9 B;  4NSX A;  3RRM C;  2I0S A;  3VA6 A;  3SXT D;  3A0F A;  3RFH A;  3OKT A;  4CY5 A;  3OTT A;  5EMM B;  2I0R A;  4R7A B;  4QRJ A;  4OZU A;  5IT9 g;  4O9D A;  1SQJ A;  3SWS D;  2H9P A;  2YBA A;  5EAM A;  1A0R B;  4LGN A;  3EI3 B;  4J84 A;  2XL3 A;  2H6Q A;  5AMS A;  3MKS B;  3MKQ A;  3B7F A;  3PXS D;  3IJ0 A;  4JSX C;  3GFC A;  2AH1 A;  2H6K A;  4QQE A;  2BCJ B;  4A09 A;  1JOF A;  5GSA A;  4O45 A;  5SXM A;  4E5Z B;  2QXV A;  4JSP C;  4L9O A;  4AOW A;  3IJC A;  3JZN A;  3RN1 D;  5HYN B;  1K8K C;  2Z2N A;  4L3H D;  2B4E A;  2OVQ B;  2BBK H;  2AH0 A;  5EM2 B;  5H1M A;  4J0X A;  3PXW D;  5HE1 B;  2IUQ A;  4CI1 A;  2IAA A;  1MG2 A;  3UVK A;  4A09 B;  4J79 A;  3P4F A;  2PM6 B;  2OK6 A;  5FKR A;  1XIP A;  1MDA H;  4ZOY A;  3SHF A;  3BG0 A;  5TF2 A;  2J56 H;  2CN3 A;  3F3F A;  4FAV D;  1S4U X;  4AEZ A;  2H68 A;  3MZK A;  1R5M A;  2XYI A;  4ERQ A;  5EAR A;  1GXR A;  5EML B;  5I5M A;  3DM0 A;  4CY2 A;  2GC4 A;  4YVD A;  3EI1 A;  4L3G D;  4O1Q D;  4JSV C;  4U7A A;  4OWR A;  2B5L A;  3AFC A;  3I7P A;  3KRW B;  4ZN4 A;  3VH0 A;  5H17 A;  4PSW B;  3IJ1 A;  4MK0 B;  2J55 H;  2AGZ A;  4CI8 A;  3SVW D;  5K19 A;  3RN0 D;  4PBZ A;  4FA1 D;  1NR0 A;  2YNO A;  5C2W B;  3VGZ A;  1PEV A;  4JSN C;  3SN6 B;  2HYE A;  3OKW A;  1GG2 B;  3OKY B;  4PBY A;  5FKS A;  4ES0 A;  4PC0 A;  4J78 A;  1JJU B;  2IUV A;  4D0K A;  3I8E A;  4O3T B;  3EI1 B;  2H9N A;  4J82 A;  1VYH C;  4K3J B;  5HQG A;  2P9K C;  4Y7R A;  4A08 B;  2O9K A;  4LG8 A;  3BWS A;  3UVO A;  4L1Q D;  5AJA A;  4HDJ A;  4TZ4 A;  4BUJ C;  4QT8 A;  4I79 A;  4GQ2 P;  4D6V A;  1OLZ A;  4FA5 D;  3I7L A;  5CXB A;  3EI4 A;  1Q47 A;  3K27 A;  4J81 A;  4J86 A;  3AL8 A;  4E54 A;  2IUP A;  3UVN A;  3KRX B;  4GQB B;  4G56 B;  5HE0 B;  4CI2 A;  5C2V B;  1B9Y A;  2P9I C;  3CFV A;  3SJL D;  4PSX B;  2YNN A;  3SBP A;  3ODT A;  3PSC B;  3EMH A;  4IA9 A;  5IC7 A;  2GC7 A;  3IKO A;  2HJ4 A;  2W18 A;  3JZH A;  2I0T A;  4E54 B;  1RI6 A;  3UKU C;  2P9S C;  2IWK A;  4X61 B;  3W15 A;  2AGW A;  3FRX A;  4FB1 D;  2J57 G;  4CY3 A;  5H14 A;  3JAM g;  1SHY B;  1YFQ A;  4ERY A;  5C9Z B;  4IMM A;  1QNI A;  1MG3 A;  2YB8 B;  3FGB A;  4JXM A;  4A0A A;  5FQD A;  4A2L A;  4A11 A;  3PSL A;  1PI6 A;  3ORV D;  4J77 A;  4FA4 D;  3UKR C;  4XYH A;  2OJY A;  1K32 A;  4XEI C;  2H13 A;  2UZX B;  3C5M A;  4ESG A;  2AGY A;  4GZ8 A;  3DXK C;  3MXX A;  5EMK B;  3IIW A;  3C99 A;  5CYK A;  4N14 A;  5IJ7 E;  3L4O D;  4PNK B;  4A2M A;  2IUR A;  2PBI B;  1NEX B;  3CFS B;  2EBS A;  5FKQ A;  4A0B A;  4A11 B;  5GXH A;  4JT6 C;  2H9M A;  3ULE C;  3EI2 A;  3JRO A;  3JB9 L;  5AFU 3;  2Z2P A;  3RSE C;  3SLE D;  5GMK n;  4CI3 A;  3I89 A;  5THA A;  1JMX B;  1ERJ A;  5CYK B;  4H5I A;  1OMW B;  5FKT A;  4LG9 A;  5IJ8 E;  4A0B B;  2H6N A;  5FA5 B;  5TEE A;  2I3T A;  2MTA H;  3OL2 A;  3EI2 B;  2Q7Q A;  5EAL A;  3N0E A;  1N6E A;  1TBG A;  2AGX A;  1GOT B;  4CZY A;  3CIK B;  1L0Q A;  4FWW A;  1XKS A;  4BH6 A;  3JRP A;  4KFM B;  3I7H A;  3F3P A;  2P9P C;  2CO0 C;  5I5I A;  4ERZ A;  2P9L C;  4PXW A;  4UI9 R;  4A7J A;  3DSM A;  4X60 B;  3L4M D;  4U1E I;  3RMZ D;  2UZY B;  3E0C A;  3OW8 A;  2G99 A;  4J0W A;  4H5J A;  2G9A A;  4CC9 A;  3RLM D;  5TEF A;  3I8C A;  5B4W A;  3EI3 A;  5CXB B;  3EI4 B;  4FHL A;  3PE7 A;  2HJB A;  3IIY A;  4J8B A;  4X63 B;  3SBR A;  3AL8 B;  4J73 A;  1XHM A;  3V7D B;  4E5Z A;  3UR4 A;  5HE3 B;  3PXT D;  3ZWL B;  2OVR B;  5HE2 B;  3SCY A;  5GXI A;  3JZG A;  2GNQ A;  3BG1 A;  5EM2 A;  5FLX g;  3AL9 A;  3GRE A;  2AGL A;  2CE8 A;  4K3I D;  2OK4 A;  3V9F A;  5TDH B;  4QL1 A;  3UVM A;  2HES X;  4JD2 C;  2XU7 A;  3I2N A;  5JWZ A;  4JT5 C;  1GP2 B;  3PVW B;  4CY1 A;  5CXC A;  4J87 A;  4EWR A;  4GM3 A;  3DWL C;  4Z8L A;  2Z2O A;  3K26 A;  4GM9 A;  2B5N A;  2TRC B;  2P9N C;  4O3U B;  4ZOX A;  3NVX A;  4GGA A;  1PGU A;  4BL0 A;  4GQ1 A;  2CNX A;  1N6D A;  3DXM C;  4A0A B;  3FM0 A;  5FXY A;  1SQ9 A;  3EWE A;  4X3E A;  1PBY B;  3AH8 B;  3PVU B;  3C75 H;  3V5W B;  5A2Q g;  3SBQ A;  3RFG A;  5CXC B;  3NVN A;  4ZOZ A;  2AQ5 A;  2H9L A;  4GM8 A;  3J81 g;  4FAN D;  1JMZ B;  2P9U C;  4GGD A;  3OKY A;  1N6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...