4O3UB

Zymogen hgf-beta/met with zymogen activator peptide zap2.3
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
526
structure length
500
Chain Sequence
MKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKINVRCLQHFYGPNHEHCFNRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hepatocyte growth factor
publication title An allosteric switch for pro-HGF/Met signaling using zymogen activator peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/growth factor
total genus 114
structure length 500
sequence length 526
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4o3uB01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4o3uB02
2B5MA 3DSMA 4CY2A 4J86A 5FA5B 3F3FA 4PBZA 3NVXA 2CO0C 4JT6C 5FKRA 2P9LC 4J0WA 3VI3B 5H14A 5HYNB 4XYHA 1SHYB 2YB8B 5FXYA 3RMZD 2PM7B 3HFQA 4PSXB 5CYKA 4ZOVA 2G9AA 4CY3A 2UZXB 3RN0D 1PBYB 3I89A 3EI1A 2B4EA 4WJKB 2CN2A 4BL0A 4HDJA 3AFCA 3OL2A 4J87A 4JD2C 3DXMC 3JRPA 3V7DB 3I7NA 5HDBB 3EI3A 4X60B 4A0AA 5IJ7E 3PVUB 3C99A 2W18A 4GZ8A 4J8BA 4JSXC 1TYEB 2GC7A 4Z8LA 1OMWB 3MZKA 3PXSD 4J84A 5E6SB 3JZHA 5SXMA 4A7JA 4J77A 1RI6A 2H47A 1PEVA 3ZDXB 2AH0A 3JZGA 2P28A 2IUVA 3ZDZB 3MKQA 4GQ2P 3ZE0B 2P9SC 4N14A 5KDOB 1SQ9A 4GMBA 3ZDYB 5EMMB 2UZYB 2QXVA 4A09B 2P9IC 3RSEC 1GOTB 3V9FA 4CZXA 4E54B 2BCJB 3IJ0A 5GMKn 2H6QA 3SBPA 4UM8B 4H5IA 3AH8B 4NSXA 2YNPA 5IC7A 4O3TB 2XL2A 3I7HA 2HESX 5CXBB 5I5JA 1TBGA 3C9CA 3EI2A 3UVLA 2VDQB 4J0XA 3F3PA 3I7PA 4ZOYA 5GSAA 4TZ4A 4ES0A 4GGDA 5H1MA 4CI2A 2XYIA 1YFQA 1B9XA 5K19A 4GM9A 5C2VB 4QL1A 4CY1A 2P9PC 1JMXB 4A2LA 2CO0A 3NIFB 2YBAA 1MG3A 3FM0A 2AQ5A 3UKRC 3I2NA 4WK2B 1GG2B 3NVNA 3UKUC 1P22A 2VDRB 5HQGA 4J82A 2H3XA 3RFGA 4E5ZB 4Z7NB 2YNOA 3SHFA 2H6KA 2VC2B 3VH0A 4MK0B 1SSLA 2I0TA 5EARA 3F3GA 4GQ1A 4A2MA 3JB9L 3N0EA 5A2Qg 5IGQA 4AEZA 2H9LA 4ERZA 1FWXA 3A0FA 5FKQA 4H5JA 4I79A 2H9MA 4J81A 3E0CA 2IWFA 3OKYA 3SFZA 3EMHA 4FAND 2H6NA 1NEXB 4O45A 2AGXA 3J80g 3IKOA 4EWRA 3B7FA 3EI4A 4FA4D 4JT5C 2B5LA 4O3UB 4IMMA 3UVMA 5TF2A 3AL8A 5AMSA 3SWSD 2AGYA 2PBIB 4UM9B 3JPXA 3JAMg 4Y7RA 2I3SA 5FKTA 4GGAA 4JXMA 2VDOB 1L0QA 1JMZB 4CZVA 4J79A 5GXIA 1OLZA 3GFCA 1MG2A 3I7LA 2OVQB 1JOFA 4GGCA 1S4UX 3I7OA 5CYKB 4A11A 4X61B 5C9ZB 4FHLA 4OZUA 3MZLA 4LGNA 1TYQC 5FKSA 1QNIA 4OWRA 3EI1B 2AH1A 4JSVC 3VA6A 2HXCA 5TEEA 2IUQA 4PBYA 3V5WB 2G99A 2AGWA 4A09A 3OTTA 3SBRA 3EI3B 2P26A 4A0AB 5JWZA 5B4WA 4FA1D 5CXCB 3EG6A 3L4OD 3MKSB 2MTAH 5EAPA 5H17A 3P4FA 3I8CA 1N6FA 4GM3A 5EAMA 1K8KC 2Z2PA 2VDLB 4K3ID 3PXTD 4BH6A 2PM6B 2VDNB 3ZE2B 1B9YA 5TDHB 4U7AA 4IA9A 4LG8A 4JSPC 1SQJA 5HE2B 1U2VC 4D0KA 2AGLA 4QT8A 1MDAH 3OKWA 3U4YA 4YVDA 3ULEC 2I0RA 1NR0A 1N6DA 4CZYA 4J8GA 2H68A 2YNNA 4L1QD 4GM8A 3OW8A 2QC5A 4A08B 2CE8A 3CFSB 3MXXA 2H9NA 3FRXA 4E5ZA 4L3GD 3EU7A 4G56B 5EM2B 2GNQA 1XIPA 4A0BB 4QQEA 2PM9A 3FGBA 2Z2OA 4L9OA 1U4CA 4KFMB 3UR4A 2OIZA 1R5MA 4XEIC 4CY5A 3IJCA 5THAA 3SN6B 3EWEA 4ESGA 4Z7OB 2CE9A 2VDMB 4K3JB 1U8CB 5C2WB 2H9PA 3BG0A 5EMJB 3SCYA 2OK4A 4WK0B 2OK6A 4BUJC 3C5MA 4ZOZA 3RFHA 1XHMA 3SMRA 2Z2NA 3C75H 2VDPB 2P9KC 4ZN4A 1K32A 1N6EA 3RLMD 2AGZA 1PI6A 3NIGB 4PSWB 3PSLA 4U1EI 1Q47A 4QRJA 3PSCB 4PXWA 4GQBB 4Z7QB 4O9DA 3NVQA 1PGUA 4FA9D 5FQDA 3OKTA 2H14A 3JROA 2IUPA 2OVRB 1JJUB 3OKYB 5IJ8E 3UVOA 3IIWA 3T3PB 3JZNA 2CNXA 2TRCB 2I3TA 3DM0A 3EI4B 4L3HD 2OJYA 3I8EA 3AL8B 3PXWD 3SBQA 4FWWA 5IGOA 5AJAA 5HE3B 3N0DA 3NIDB 4CI3A 4R7AB 1GXRA 3OL2B 2GC4A 5CXCA 2IURA 4UI9R 2HJBA 3UVNA 3ZWLB 4E54A 3ZE1B 4PNKB 4ERQA 4Y5RD 3RN1D 5CXBA 3PVWB 3DWLC 4O1QD 3SVWD 4X3EA 4X63B 2IWKA 5EMKB 4A11B 2P9UC 3AL9A 3K26A 2YMUA 4XYIA 5I5IA 4PC0A 2I0SA 4CI8A 2J57G 3BG1A 4UM9D 4WK4B 3I7KA 1YUKA 3W15A 3DXKC 2J56H 4J73A 5K1CC 2XL3A 5I5MA 2HKRA 3BWSA 2EBSA 4JSNC 4ERYA 2XU7A 4A08A 3CIKB 5E6UB 3T3MB 3ODTA 2H13A 5EALA 1GP2B 4LG9A 5EM2A 5E6RB 3RRMC 2VDKB 3MMYA 4A0BA 2HJ4A 3VGZA 3IIYA 5HE1B 4AOWA 3KRXB 3EI2B 2OVPB 3GREA 2Q7QA 4CC9A 3UVKA 2HKMA 4FB1D 5HE0B 4D6VA 5TEFA 5FLXg 3VI4B 1A0RB 3FCUB 3IJ1A 3PE7A 2O9KA 1VYHC 3ORVD 3SJLD 4FAVD 2BBKH 3SXTD 2CN3A 3KRWB 2HYEA 2J55H 4CI1A 3CFVA 5EMLB 3J81g 2IAAA 3L4MD 3SLED 5AFU3 1ERJA 2P9NC 5IT9g 5GXHA 2B5NA 4FA5D 1XKSA 2PM9B 3K27A 4ZOXA 4J78A
chains in the Genus database with same CATH superfamily
2B5MA 3K6SA 3DSMA 1T2XA 3DDUA 4CY2A 4J86A 3O4GA 5FA5B 3F3FA 4PBZA 3NVXA 2CO0C 4JT6C 5FKRA 3T3PA 2P9LC 2EICA 4J0WA 2HU8A 2VZ3A 4G1MA 5H14A 3VI3B 5HYNB 4XYHA 1SHYB 2YB8B 5FXYA 3RMZD 2PM7B 3HFQA 3QHYB 4PSXB 5CYKA 3IUMA 4ZOVA 2G9AA 4CY3A 2UZXB 4RE6A 3RN0D 1PBYB 3I89A 3EI1A 2B4EA 4WJKB 2CN2A 4BL0A 4HDJA 3AFCA 3OL2A 4J87A 4JD2C 3DXMC 3JRPA 3V7DB 3I7NA 5HDBB 3EI3A 4X60B 4A0AA 5IJ7E 3O4JA 3PVUB 3C99A 2W18A 4GZ8A 4J8BA 4JSXC 1TYEB 2GC7A 4NENA 4Z8LA 1OMWB 3MZKA 3EQ9A 2VDNA 3PXSD 4J84A 3V4VA 5E6SB 3JZHA 5M5VA 1L5GA 5SXMA 4A7JA 4J77A 1RI6A 2H47A 1PEVA 3ZDXB 2AH0A 3JZGA 2P28A 4WK4A 2IUVA 3ZDZB 3MKQA 4GQ2P 3MUNA 3ZE0B 2P9SC 4N14A 5KDOB 1SQ9A 4GMBA 3ZDYB 5EMMB 2UZYB 5E6UA 2QXVA 3T3MA 4A09B 2P9IC 3RSEC 1GOTB 3V9FA 4CZXA 4E54B 2BCJB 3IJ0A 5GMKn 2H6QA 3SBPA 1GOFA 4UM8B 4H5IA 3AH8B 4NSXA 2YNPA 5IC7A 2VDKA 4O3TB 2XL2A 3I7HA 2HESX 5CXBB 5I5JA 1TBGA 3C9CA 3EI2A 3UVLA 2VDQB 4J0XA 4JHPC 3F3PA 4MMXA 3I7PA 2WQ8A 5M5RA 4ZOYA 5GSAA 4TZ4A 4ES0A 4GGDA 3VI4A 5H1MA 4CI2A 2XYIA 3FCUA 1YFQA 1B9XA 5K19A 4GM9A 5C2VB 4QL1A 4CY1A 2P9PC 1VE6A 3MUOA 1JMXB 4A2LA 1H2YA 2CO0A 3NIFB 4Z7OA 3IULA 2VDMA 2YBAA 1MG3A 3FM0A 2AQ5A 3UKRC 2EIBA 4WK0A 1QFSA 3I2NA 4WK2B 1GG2B 3NVNA 3UKUC 3IUQA 1P22A 2VDRB 4AMZA 3EQ8A 5HQGA 4J82A 2H3XA 3RFGA 4E5ZB 4Z7NB 2VDPA 2XZGA 2YNOA 3SHFA 2H6KA 2VC2B 3VH0A 4MK0B 3MVDK 1SSLA 4DNVA 1JTDB 2I0TA 3NIGA 5EARA 3F3GA 4GQ1A 4A2MA 3JB9L 2JWHA 3N0EA 1E5TA 5A2Qg 5IGQA 4AEZA 4Z7QA 2H9LA 3IURA 4ERZA 1FWXA 3A0FA 5FKQA 4H5JA 4I79A 3VI3A 2H9MA 4J81A 3E0CA 4JHNA 2IWFA 3OKYA 4G1EA 3SFZA 3EMHA 4FAND 2H6NA 1GOGA 1NEXB 1C9LA 4O45A 2AGXA 1E8MA 3J80g 3IKOA 4EWRA 3B7FA 3EI4A 4FA4D 4JT5C 2B5LA 4WJKA 4O3UB 4DNUA 4IMMA 3UVMA 5TF2A 3AL8A 5AMSA 3SWSD 2AGYA 2PBIB 4UM9B 3JPXA 3JAMg 4NBMA 3NIDA 4Y7RA 2I3SA 5FKTA 4GGAA 4JXMA 2VDOB 1L0QA 1JMZB 3ZE1A 4CZVA 1O6GA 4J79A 5GXIA 1OLZA 3GFCA 5E6SA 1H2XA 1MG2A 3I7LA 2OVQB 1JOFA 4GGCA 1S4UX 3I7OA 5FFGA 5CYKB 4A11A 2XDWA 4X61B 5C9ZB 4FHLA 4OZUA 3MZLA 4LGNA 1TYQC 5FKSA 1QNIA 5C86A 4OWRA 2BKLA 3EI1B 2QZPA 2AH1A 4JSVC 3VA6A 1BPOA 2HU5A 2HXCA 1UOPA 5TEEA 2IUQA 4PBYA 3V5WB 2G99A 2AGWA 4D9SA 4A09A 3OTTA 3SBRA 3EI3B 2P26A 4A0AB 4UM8A 5JWZA 5B4WA 4FA1D 5CXCB 3L4OD 3EG6A 3MKSB 2MTAH 5EAPA 5H17A 3P4FA 3I8CA 1N6FA 4GM3A 5EAMA 1K8KC 2Z2PA 2VDLB 4K3ID 3PXTD 4BP9A 2VDQA 4BH6A 1H2ZA 4AN0A 2PM6B 5E6RA 2VDNB 3ZE2B 1I2MB 1B9YA 5TDHB 1VE7A 4U7AA 4IA9A 4LG8A 4JSPC 1SQJA 5HE2B 1U2VC 4D0KA 5FFOA 2AGLA 4QT8A 1MDAH 2EIEA 3OKWA 3U4YA 5M61A 3IJEA 4YVDA 3QI0A 3ULEC 3K71A 2I0RA 3K72A 4BP8A 3NIFA 1NR0A 1N6DA 4IRZA 4CZYA 4J8GA 2H68A 2YNNA 4L1QD 4GM8A 3OW8A 2QC5A 4A08B 2CE8A 3CFSB 5M5UA 3MXXA 2H9NA 3FRXA 4E5ZA 4L3GD 3EU7A 4G56B 5EM2B 2GNQA 2VC2A 4MMZA 1XIPA 4A0BB 4QQEA 1M1XA 1GOHA 4QAMA 2PM9A 3FGBA 2QR5A 1UOQA 2Z2OA 4KFMB 1U4CA 4L9OA 3UR4A 4AX4A 2OIZA 1R5MA 5C92A 2XE4A 4XEIC 4CY5A 3IJCA 5THAA 3SN6B 3O4IA 3EWEA 3GD1I 4ESGA 2CE9A 2VDMB 4Z7OB 4K3JB 1U8CB 3OF7A 2H9PA 5C2WB 3BG0A 4O02A 5EMJB 3SCYA 4DNWA 2OK4A 4WK0B 2OK6A 3IUJA 4BUJC 4BCCA 3C5MA 4ZOZA 3RFHA 1XHMA 4UM9A 3SMRA 2Z2NA 3C75H 2VDPB 2P9KC 4ZN4A 5M5SA 1K32A 1JV2A 1A12A 1N6EA 3RLMD 2VDOA 2AGZA 1PI6A 3NIGB 4PSWB 5HDBA 3PSLA 4U1EI 1Q47A 4QRJA 3PSCB 4PXWA 4GQBB 4RE5A 4Z7QB 4O9DA 3NVQA 1PGUA 4FA9D 1TYEA 3OKTA 5FQDA 2H14A 3JROA 2IUPA 2OVRB 1JJUB 3OKYB 5IJ8E 3UVOA 1K3IA 3IIWA 3T3PB 3JZNA 3GC3B 2CNXA 2JKXA 2TRCB 2I3TA 3DM0A 3EI4B 3IVMA 3ZDXA 4L3HD 2OJYA 3ZDZA 3I8EA 3AL8B 3PXWD 3SBQA 4FWWA 4BCBA 5IGOA 5AJAA 5HE3B 3ZE0A 3N0DA 3NIDB 4CI3A 4R7AB 1GXRA 3ZDYA 3OL2B 2GC4A 5CXCA 2JWGA 2IURA 4UI9R 2HJBA 3UVNA 3ZWLB 4E54A 2VDLA 3ZE1B 3KCIA 4PNKB 4ERQA 4O2WA 1QFMA 3ZE2A 4Y5RD 3RN1D 5CXBA 3PVWB 3DWLC 4NAAA 4O1QD 3SVWD 4X3EA 4X63B 2IWKA 5EMKB 4A11B 2P9UC 3AL9A 3K26A 4MMYA 2YMUA 4XYIA 1C9IA 5I5IA 4PC0A 2I0SA 4CI8A 4NC4A 2J57G 3BG1A 4UM9D 4WK4B 1E8NA 3I7KA 1YUKA 3W15A 3O4HA 3DXKC 2J56H 3FCSA 4J73A 5K1CC 2XL3A 3IUNA 5I5MA 2HKRA 3BWSA 2EBSA 4JSNC 4ERYA 2XU7A 4A08A 3CIKB 5E6UB 2HU7A 3T3MB 3ODTA 1H2WA 4WK2A 5M5TA 2H13A 1VZ2A 5EALA 1GP2B 4LG9A 4AN1A 5EM2A 2VDRA 5E6RB 3RRMC 2VDKB 3MMYA 4A0BA 2HJ4A 3VGZA 3IIYA 5HE1B 4AOWA 4Z7NA 2VZ1A 3KRXB 3EI2B 2OVPB 3EQ7A 3GREA 4AMYA 2Q7QA 4CC9A 3UVKA 2HKMA 4FB1D 5HE0B 4D6VA 5TEFA 5FLXg 3VI4B 1A0RB 3FCUB 3IJ1A 1U8CA 3V4PA 3PE7A 2O9KA 1VYHC 3ORVD 1VZ3A 3SJLD 4FAVD 2BBKH 3SXTD 3KRWB 2CN3A 2EIDA 2HYEA 2J55H 4CI1A 3CFVA 5EMLB 1UTCA 3J81g 4BCDA 2IAAA 3L4MD 1UOOA 3SLED 5AFU3 1ERJA 2P9NC 5IT9g 1YR2A 5GXHA 2B5NA 4L1MA 1XKSA 4FA5D 2PM9B 3K27A 4ZOXA 4G55A 1O6FA 4J78A
chains in the Genus database with same CATH topology
2B5MA 3DSMA 4CY2A 4J86A 5FA5B 3F3FA 4PBZA 3NVXA 2CO0C 4JT6C 5FKRA 2P9LC 4J0WA 3VI3B 5H14A 5HYNB 4XYHA 1SHYB 2YB8B 5FXYA 3RMZD 2PM7B 3HFQA 4PSXB 5CYKA 4ZOVA 2G9AA 4CY3A 2UZXB 3RN0D 1PBYB 3I89A 3EI1A 2B4EA 4WJKB 2CN2A 4BL0A 4HDJA 3AFCA 3OL2A 4J87A 4JD2C 3DXMC 3JRPA 3V7DB 3I7NA 5HDBB 3EI3A 4X60B 4A0AA 5IJ7E 3PVUB 3C99A 2W18A 4GZ8A 4J8BA 4JSXC 1TYEB 2GC7A 4Z8LA 1OMWB 3MZKA 3PXSD 4J84A 5E6SB 3JZHA 5SXMA 4A7JA 4J77A 1RI6A 2H47A 1PEVA 3ZDXB 2AH0A 3JZGA 2P28A 2IUVA 3ZDZB 3MKQA 4GQ2P 3ZE0B 2P9SC 4N14A 5KDOB 1SQ9A 4GMBA 3ZDYB 5EMMB 2UZYB 2QXVA 4A09B 2P9IC 3RSEC 1GOTB 3V9FA 4CZXA 4E54B 2BCJB 3IJ0A 5GMKn 2H6QA 3SBPA 4UM8B 4H5IA 3AH8B 4NSXA 2YNPA 5IC7A 4O3TB 2XL2A 3I7HA 2HESX 5CXBB 5I5JA 1TBGA 3C9CA 3EI2A 3UVLA 2VDQB 4J0XA 3F3PA 3I7PA 4ZOYA 5GSAA 4TZ4A 4ES0A 4GGDA 5H1MA 4CI2A 2XYIA 1YFQA 1B9XA 5K19A 4GM9A 5C2VB 4QL1A 4CY1A 2P9PC 1JMXB 4A2LA 2CO0A 3NIFB 2YBAA 1MG3A 3FM0A 2AQ5A 3UKRC 3I2NA 4WK2B 1GG2B 3NVNA 3UKUC 1P22A 2VDRB 5HQGA 4J82A 2H3XA 3RFGA 4E5ZB 4Z7NB 2YNOA 3SHFA 2H6KA 2VC2B 3VH0A 4MK0B 1SSLA 2I0TA 5EARA 3F3GA 4GQ1A 4A2MA 3JB9L 2JWHA 3N0EA 5A2Qg 5IGQA 4AEZA 2H9LA 4ERZA 1FWXA 3A0FA 5FKQA 4H5JA 4I79A 2H9MA 4J81A 3E0CA 2IWFA 3OKYA 3SFZA 3EMHA 4FAND 2H6NA 1NEXB 4O45A 2AGXA 3J80g 3IKOA 4EWRA 3B7FA 3EI4A 4FA4D 4JT5C 2B5LA 4O3UB 4IMMA 3UVMA 5TF2A 3AL8A 5AMSA 3SWSD 2AGYA 2PBIB 4UM9B 3JPXA 3JAMg 4Y7RA 2I3SA 5FKTA 4GGAA 4JXMA 2VDOB 1L0QA 1JMZB 4CZVA 4J79A 5GXIA 1OLZA 3GFCA 1MG2A 3I7LA 2OVQB 1JOFA 4GGCA 1S4UX 3I7OA 5CYKB 4A11A 4X61B 5C9ZB 4FHLA 4OZUA 3MZLA 4LGNA 1TYQC 5FKSA 1QNIA 4OWRA 3EI1B 2AH1A 4JSVC 3VA6A 2HXCA 5TEEA 2IUQA 4PBYA 3V5WB 2G99A 2AGWA 4A09A 3OTTA 3SBRA 3EI3B 2P26A 4A0AB 5JWZA 5B4WA 4FA1D 5CXCB 3EG6A 3L4OD 3MKSB 2MTAH 5EAPA 5H17A 3P4FA 3I8CA 1N6FA 4GM3A 5EAMA 1K8KC 2Z2PA 2VDLB 4K3ID 3PXTD 4BH6A 2PM6B 2VDNB 3ZE2B 1B9YA 5TDHB 4U7AA 4IA9A 4LG8A 4JSPC 1SQJA 5HE2B 1U2VC 4D0KA 2AGLA 4QT8A 1MDAH 3OKWA 3U4YA 4YVDA 3ULEC 2I0RA 1NR0A 1N6DA 4CZYA 4J8GA 2H68A 2YNNA 4L1QD 4GM8A 3OW8A 2QC5A 4A08B 2CE8A 3CFSB 3MXXA 2H9NA 3FRXA 4E5ZA 4L3GD 3EU7A 4G56B 5EM2B 2GNQA 1XIPA 4A0BB 4QQEA 2PM9A 3FGBA 2Z2OA 4L9OA 1U4CA 4KFMB 3UR4A 2OIZA 1R5MA 4XEIC 4CY5A 3IJCA 5THAA 3SN6B 3EWEA 4ESGA 4Z7OB 2CE9A 2VDMB 4K3JB 1U8CB 5C2WB 2H9PA 3BG0A 5EMJB 3SCYA 2OK4A 4WK0B 2OK6A 4BUJC 3C5MA 4ZOZA 3RFHA 1XHMA 3SMRA 2Z2NA 3C75H 2VDPB 2P9KC 4ZN4A 1K32A 1N6EA 3RLMD 2AGZA 1PI6A 3NIGB 4PSWB 3PSLA 4U1EI 1Q47A 4QRJA 3PSCB 4PXWA 4GQBB 4Z7QB 4O9DA 3NVQA 1PGUA 4FA9D 5FQDA 3OKTA 2H14A 3JROA 2IUPA 2OVRB 1JJUB 3OKYB 5IJ8E 3UVOA 3IIWA 3T3PB 3JZNA 2CNXA 2TRCB 2I3TA 3DM0A 3EI4B 4L3HD 2OJYA 3I8EA 3AL8B 3PXWD 3SBQA 4FWWA 5IGOA 5AJAA 5HE3B 3N0DA 3NIDB 4CI3A 4R7AB 1GXRA 3OL2B 2GC4A 5CXCA 2JWGA 2IURA 4UI9R 2HJBA 3UVNA 3ZWLB 4E54A 3ZE1B 4PNKB 4ERQA 4Y5RD 3RN1D 5CXBA 3PVWB 3DWLC 4O1QD 3SVWD 4X3EA 4X63B 2IWKA 5EMKB 4A11B 2P9UC 3AL9A 3K26A 2YMUA 4XYIA 5I5IA 4PC0A 2I0SA 4CI8A 2J57G 3BG1A 4UM9D 4WK4B 3I7KA 1YUKA 3W15A 3DXKC 2J56H 4J73A 5K1CC 2XL3A 5I5MA 2HKRA 3BWSA 2EBSA 4JSNC 4ERYA 2XU7A 4A08A 3CIKB 5E6UB 3T3MB 3ODTA 2H13A 5EALA 1GP2B 4LG9A 5EM2A 5E6RB 3RRMC 2VDKB 3MMYA 4A0BA 2HJ4A 3VGZA 3IIYA 5HE1B 4AOWA 3KRXB 3EI2B 2OVPB 3GREA 2Q7QA 4CC9A 3UVKA 2HKMA 4FB1D 5HE0B 4D6VA 5TEFA 5FLXg 3VI4B 1A0RB 3FCUB 3IJ1A 3PE7A 2O9KA 1VYHC 3ORVD 3SJLD 4FAVD 2BBKH 3SXTD 2CN3A 3KRWB 2HYEA 2J55H 4CI1A 3CFVA 5EMLB 3J81g 2IAAA 3L4MD 3SLED 5AFU3 1ERJA 2P9NC 5IT9g 5GXHA 2B5NA 4FA5D 1XKSA 2PM9B 3K27A 4ZOXA 4J78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5M A;  3DSM A;  4CY2 A;  4J86 A;  5FA5 B;  3F3F A;  4PBZ A;  3NVX A;  2CO0 C;  4JT6 C;  5FKR A;  2P9L C;  4J0W A;  3VI3 B;  5H14 A;  5HYN B;  4XYH A;  1SHY B;  2YB8 B;  5FXY A;  3RMZ D;  2PM7 B;  3HFQ A;  4PSX B;  5CYK A;  4ZOV A;  2G9A A;  4CY3 A;  2UZX B;  3RN0 D;  1PBY B;  3I89 A;  3EI1 A;  2B4E A;  4WJK B;  2CN2 A;  4BL0 A;  4HDJ A;  3AFC A;  3OL2 A;  4J87 A;  4JD2 C;  3DXM C;  3JRP A;  3V7D B;  3I7N A;  5HDB B;  3EI3 A;  4X60 B;  4A0A A;  5IJ7 E;  3PVU B;  3C99 A;  2W18 A;  4GZ8 A;  4J8B A;  4JSX C;  1TYE B;  2GC7 A;  4Z8L A;  1OMW B;  3MZK A;  3PXS D;  4J84 A;  5E6S B;  3JZH A;  5SXM A;  4A7J A;  4J77 A;  1RI6 A;  2H47 A;  1PEV A;  3ZDX B;  2AH0 A;  3JZG A;  2P28 A;  2IUV A;  3ZDZ B;  3MKQ A;  4GQ2 P;  3ZE0 B;  2P9S C;  4N14 A;  5KDO B;  1SQ9 A;  4GMB A;  3ZDY B;  5EMM B;  2UZY B;  2QXV A;  4A09 B;  2P9I C;  3RSE C;  1GOT B;  3V9F A;  4CZX A;  4E54 B;  2BCJ B;  3IJ0 A;  5GMK n;  2H6Q A;  3SBP A;  4UM8 B;  4H5I A;  3AH8 B;  4NSX A;  2YNP A;  5IC7 A;  4O3T B;  2XL2 A;  3I7H A;  2HES X;  5CXB B;  5I5J A;  1TBG A;  3C9C A;  3EI2 A;  3UVL A;  2VDQ B;  4J0X A;  3F3P A;  3I7P A;  4ZOY A;  5GSA A;  4TZ4 A;  4ES0 A;  4GGD A;  5H1M A;  4CI2 A;  2XYI A;  1YFQ A;  1B9X A;  5K19 A;  4GM9 A;  5C2V B;  4QL1 A;  4CY1 A;  2P9P C;  1JMX B;  4A2L A;  2CO0 A;  3NIF B;  2YBA A;  1MG3 A;  3FM0 A;  2AQ5 A;  3UKR C;  3I2N A;  4WK2 B;  1GG2 B;  3NVN A;  3UKU C;  1P22 A;  2VDR B;  5HQG A;  4J82 A;  2H3X A;  3RFG A;  4E5Z B;  4Z7N B;  2YNO A;  3SHF A;  2H6K A;  2VC2 B;  3VH0 A;  4MK0 B;  1SSL A;  2I0T A;  5EAR A;  3F3G A;  4GQ1 A;  4A2M A;  3JB9 L;  3N0E A;  5A2Q g;  5IGQ A;  4AEZ A;  2H9L A;  4ERZ A;  1FWX A;  3A0F A;  5FKQ A;  4H5J A;  4I79 A;  2H9M A;  4J81 A;  3E0C A;  2IWF A;  3OKY A;  3SFZ A;  3EMH A;  4FAN D;  2H6N A;  1NEX B;  4O45 A;  2AGX A;  3J80 g;  3IKO A;  4EWR A;  3B7F A;  3EI4 A;  4FA4 D;  4JT5 C;  2B5L A;  4O3U B;  4IMM A;  3UVM A;  5TF2 A;  3AL8 A;  5AMS A;  3SWS D;  2AGY A;  2PBI B;  4UM9 B;  3JPX A;  3JAM g;  4Y7R A;  2I3S A;  5FKT A;  4GGA A;  4JXM A;  2VDO B;  1L0Q A;  1JMZ B;  4CZV A;  4J79 A;  5GXI A;  1OLZ A;  3GFC A;  1MG2 A;  3I7L A;  2OVQ B;  1JOF A;  4GGC A;  1S4U X;  3I7O A;  5CYK B;  4A11 A;  4X61 B;  5C9Z B;  4FHL A;  4OZU A;  3MZL A;  4LGN A;  1TYQ C;  5FKS A;  1QNI A;  4OWR A;  3EI1 B;  2AH1 A;  4JSV C;  3VA6 A;  2HXC A;  5TEE A;  2IUQ A;  4PBY A;  3V5W B;  2G99 A;  2AGW A;  4A09 A;  3OTT A;  3SBR A;  3EI3 B;  2P26 A;  4A0A B;  5JWZ A;  5B4W A;  4FA1 D;  5CXC B;  3EG6 A;  3L4O D;  3MKS B;  2MTA H;  5EAP A;  5H17 A;  3P4F A;  3I8C A;  1N6F A;  4GM3 A;  5EAM A;  1K8K C;  2Z2P A;  2VDL B;  4K3I D;  3PXT D;  4BH6 A;  2PM6 B;  2VDN B;  3ZE2 B;  1B9Y A;  5TDH B;  4U7A A;  4IA9 A;  4LG8 A;  4JSP C;  1SQJ A;  5HE2 B;  1U2V C;  4D0K A;  2AGL A;  4QT8 A;  1MDA H;  3OKW A;  3U4Y A;  4YVD A;  3ULE C;  2I0R A;  1NR0 A;  1N6D A;  4CZY A;  4J8G A;  2H68 A;  2YNN A;  4L1Q D;  4GM8 A;  3OW8 A;  2QC5 A;  4A08 B;  2CE8 A;  3CFS B;  3MXX A;  2H9N A;  3FRX A;  4E5Z A;  4L3G D;  3EU7 A;  4G56 B;  5EM2 B;  2GNQ A;  1XIP A;  4A0B B;  4QQE A;  2PM9 A;  3FGB A;  2Z2O A;  4L9O A;  1U4C A;  4KFM B;  3UR4 A;  2OIZ A;  1R5M A;  4XEI C;  4CY5 A;  3IJC A;  5THA A;  3SN6 B;  3EWE A;  4ESG A;  4Z7O B;  2CE9 A;  2VDM B;  4K3J B;  1U8C B;  5C2W B;  2H9P A;  3BG0 A;  5EMJ B;  3SCY A;  2OK4 A;  4WK0 B;  2OK6 A;  4BUJ C;  3C5M A;  4ZOZ A;  3RFH A;  1XHM A;  3SMR A;  2Z2N A;  3C75 H;  2VDP B;  2P9K C;  4ZN4 A;  1K32 A;  1N6E A;  3RLM D;  2AGZ A;  1PI6 A;  3NIG B;  4PSW B;  3PSL A;  4U1E I;  1Q47 A;  4QRJ A;  3PSC B;  4PXW A;  4GQB B;  4Z7Q B;  4O9D A;  3NVQ A;  1PGU A;  4FA9 D;  5FQD A;  3OKT A;  2H14 A;  3JRO A;  2IUP A;  2OVR B;  1JJU B;  3OKY B;  5IJ8 E;  3UVO A;  3IIW A;  3T3P B;  3JZN A;  2CNX A;  2TRC B;  2I3T A;  3DM0 A;  3EI4 B;  4L3H D;  2OJY A;  3I8E A;  3AL8 B;  3PXW D;  3SBQ A;  4FWW A;  5IGO A;  5AJA A;  5HE3 B;  3N0D A;  3NID B;  4CI3 A;  4R7A B;  1GXR A;  3OL2 B;  2GC4 A;  5CXC A;  2IUR A;  4UI9 R;  2HJB A;  3UVN A;  3ZWL B;  4E54 A;  3ZE1 B;  4PNK B;  4ERQ A;  4Y5R D;  3RN1 D;  5CXB A;  3PVW B;  3DWL C;  4O1Q D;  3SVW D;  4X3E A;  4X63 B;  2IWK A;  5EMK B;  4A11 B;  2P9U C;  3AL9 A;  3K26 A;  2YMU A;  4XYI A;  5I5I A;  4PC0 A;  2I0S A;  4CI8 A;  2J57 G;  3BG1 A;  4UM9 D;  4WK4 B;  3I7K A;  1YUK A;  3W15 A;  3DXK C;  2J56 H;  4J73 A;  5K1C C;  2XL3 A;  5I5M A;  2HKR A;  3BWS A;  2EBS A;  4JSN C;  4ERY A;  2XU7 A;  4A08 A;  3CIK B;  5E6U B;  3T3M B;  3ODT A;  2H13 A;  5EAL A;  1GP2 B;  4LG9 A;  5EM2 A;  5E6R B;  3RRM C;  2VDK B;  3MMY A;  4A0B A;  2HJ4 A;  3VGZ A;  3IIY A;  5HE1 B;  4AOW A;  3KRX B;  3EI2 B;  2OVP B;  3GRE A;  2Q7Q A;  4CC9 A;  3UVK A;  2HKM A;  4FB1 D;  5HE0 B;  4D6V A;  5TEF A;  5FLX g;  3VI4 B;  1A0R B;  3FCU B;  3IJ1 A;  3PE7 A;  2O9K A;  1VYH C;  3ORV D;  3SJL D;  4FAV D;  2BBK H;  3SXT D;  2CN3 A;  3KRW B;  2HYE A;  2J55 H;  4CI1 A;  3CFV A;  5EML B;  3J81 g;  2IAA A;  3L4M D;  3SLE D;  5AFU 3;  1ERJ A;  2P9N C;  5IT9 g;  5GXH A;  2B5N A;  4FA5 D;  1XKS A;  2PM9 B;  3K27 A;  4ZOX A;  4J78 A; 
#chains in the Genus database with same CATH topology
 2B5M A;  3K6S A;  3DSM A;  1T2X A;  3DDU A;  4CY2 A;  4J86 A;  3O4G A;  5FA5 B;  3F3F A;  4PBZ A;  3NVX A;  2CO0 C;  4JT6 C;  5FKR A;  3T3P A;  2P9L C;  2EIC A;  4J0W A;  2HU8 A;  2VZ3 A;  4G1M A;  5H14 A;  3VI3 B;  5HYN B;  4XYH A;  1SHY B;  2YB8 B;  5FXY A;  3RMZ D;  2PM7 B;  3HFQ A;  3QHY B;  4PSX B;  5CYK A;  3IUM A;  4ZOV A;  2G9A A;  4CY3 A;  2UZX B;  4RE6 A;  3RN0 D;  1PBY B;  3I89 A;  3EI1 A;  2B4E A;  4WJK B;  2CN2 A;  4BL0 A;  4HDJ A;  3AFC A;  3OL2 A;  4J87 A;  4JD2 C;  3DXM C;  3JRP A;  3V7D B;  3I7N A;  5HDB B;  3EI3 A;  4X60 B;  4A0A A;  5IJ7 E;  3O4J A;  3PVU B;  3C99 A;  2W18 A;  4GZ8 A;  4J8B A;  4JSX C;  1TYE B;  2GC7 A;  4NEN A;  4Z8L A;  1OMW B;  3MZK A;  3EQ9 A;  2VDN A;  3PXS D;  4J84 A;  3V4V A;  5E6S B;  3JZH A;  5M5V A;  1L5G A;  5SXM A;  4A7J A;  4J77 A;  1RI6 A;  2H47 A;  1PEV A;  3ZDX B;  2AH0 A;  3JZG A;  2P28 A;  4WK4 A;  2IUV A;  3ZDZ B;  3MKQ A;  4GQ2 P;  3MUN A;  3ZE0 B;  2P9S C;  4N14 A;  5KDO B;  1SQ9 A;  4GMB A;  3ZDY B;  5EMM B;  2UZY B;  5E6U A;  2QXV A;  3T3M A;  4A09 B;  2P9I C;  3RSE C;  1GOT B;  3V9F A;  4CZX A;  4E54 B;  2BCJ B;  3IJ0 A;  5GMK n;  2H6Q A;  3SBP A;  1GOF A;  4UM8 B;  4H5I A;  3AH8 B;  4NSX A;  2YNP A;  5IC7 A;  2VDK A;  4O3T B;  2XL2 A;  3I7H A;  2HES X;  5CXB B;  5I5J A;  1TBG A;  3C9C A;  3EI2 A;  3UVL A;  2VDQ B;  4J0X A;  4JHP C;  3F3P A;  4MMX A;  3I7P A;  2WQ8 A;  5M5R A;  4ZOY A;  5GSA A;  4TZ4 A;  4ES0 A;  4GGD A;  3VI4 A;  5H1M A;  4CI2 A;  2XYI A;  3FCU A;  1YFQ A;  1B9X A;  5K19 A;  4GM9 A;  5C2V B;  4QL1 A;  4CY1 A;  2P9P C;  1VE6 A;  3MUO A;  1JMX B;  4A2L A;  1H2Y A;  2CO0 A;  3NIF B;  4Z7O A;  3IUL A;  2VDM A;  2YBA A;  1MG3 A;  3FM0 A;  2AQ5 A;  3UKR C;  2EIB A;  4WK0 A;  1QFS A;  3I2N A;  4WK2 B;  1GG2 B;  3NVN A;  3UKU C;  3IUQ A;  1P22 A;  2VDR B;  4AMZ A;  3EQ8 A;  5HQG A;  4J82 A;  2H3X A;  3RFG A;  4E5Z B;  4Z7N B;  2VDP A;  2XZG A;  2YNO A;  3SHF A;  2H6K A;  2VC2 B;  3VH0 A;  4MK0 B;  3MVD K;  1SSL A;  4DNV A;  1JTD B;  2I0T A;  3NIG A;  5EAR A;  3F3G A;  4GQ1 A;  4A2M A;  3JB9 L;  2JWH A;  3N0E A;  1E5T A;  5A2Q g;  5IGQ A;  4AEZ A;  4Z7Q A;  2H9L A;  3IUR A;  4ERZ A;  1FWX A;  3A0F A;  5FKQ A;  4H5J A;  4I79 A;  3VI3 A;  2H9M A;  4J81 A;  3E0C A;  4JHN A;  2IWF A;  3OKY A;  4G1E A;  3SFZ A;  3EMH A;  4FAN D;  2H6N A;  1GOG A;  1NEX B;  1C9L A;  4O45 A;  2AGX A;  1E8M A;  3J80 g;  3IKO A;  4EWR A;  3B7F A;  3EI4 A;  4FA4 D;  4JT5 C;  2B5L A;  4WJK A;  4O3U B;  4DNU A;  4IMM A;  3UVM A;  5TF2 A;  3AL8 A;  5AMS A;  3SWS D;  2AGY A;  2PBI B;  4UM9 B;  3JPX A;  3JAM g;  4NBM A;  3NID A;  4Y7R A;  2I3S A;  5FKT A;  4GGA A;  4JXM A;  2VDO B;  1L0Q A;  1JMZ B;  3ZE1 A;  4CZV A;  1O6G A;  4J79 A;  5GXI A;  1OLZ A;  3GFC A;  5E6S A;  1H2X A;  1MG2 A;  3I7L A;  2OVQ B;  1JOF A;  4GGC A;  1S4U X;  3I7O A;  5FFG A;  5CYK B;  4A11 A;  2XDW A;  4X61 B;  5C9Z B;  4FHL A;  4OZU A;  3MZL A;  4LGN A;  1TYQ C;  5FKS A;  1QNI A;  5C86 A;  4OWR A;  2BKL A;  3EI1 B;  2QZP A;  2AH1 A;  4JSV C;  3VA6 A;  1BPO A;  2HU5 A;  2HXC A;  1UOP A;  5TEE A;  2IUQ A;  4PBY A;  3V5W B;  2G99 A;  2AGW A;  4D9S A;  4A09 A;  3OTT A;  3SBR A;  3EI3 B;  2P26 A;  4A0A B;  4UM8 A;  5JWZ A;  5B4W A;  4FA1 D;  5CXC B;  3L4O D;  3EG6 A;  3MKS B;  2MTA H;  5EAP A;  5H17 A;  3P4F A;  3I8C A;  1N6F A;  4GM3 A;  5EAM A;  1K8K C;  2Z2P A;  2VDL B;  4K3I D;  3PXT D;  4BP9 A;  2VDQ A;  4BH6 A;  1H2Z A;  4AN0 A;  2PM6 B;  5E6R A;  2VDN B;  3ZE2 B;  1I2M B;  1B9Y A;  5TDH B;  1VE7 A;  4U7A A;  4IA9 A;  4LG8 A;  4JSP C;  1SQJ A;  5HE2 B;  1U2V C;  4D0K A;  5FFO A;  2AGL A;  4QT8 A;  1MDA H;  2EIE A;  3OKW A;  3U4Y A;  5M61 A;  3IJE A;  4YVD A;  3QI0 A;  3ULE C;  3K71 A;  2I0R A;  3K72 A;  4BP8 A;  3NIF A;  1NR0 A;  1N6D A;  4IRZ A;  4CZY A;  4J8G A;  2H68 A;  2YNN A;  4L1Q D;  4GM8 A;  3OW8 A;  2QC5 A;  4A08 B;  2CE8 A;  3CFS B;  5M5U A;  3MXX A;  2H9N A;  3FRX A;  4E5Z A;  4L3G D;  3EU7 A;  4G56 B;  5EM2 B;  2GNQ A;  2VC2 A;  4MMZ A;  1XIP A;  4A0B B;  4QQE A;  1M1X A;  1GOH A;  4QAM A;  2PM9 A;  3FGB A;  2QR5 A;  1UOQ A;  2Z2O A;  4KFM B;  1U4C A;  4L9O A;  3UR4 A;  4AX4 A;  2OIZ A;  1R5M A;  5C92 A;  2XE4 A;  4XEI C;  4CY5 A;  3IJC A;  5THA A;  3SN6 B;  3O4I A;  3EWE A;  3GD1 I;  4ESG A;  2CE9 A;  2VDM B;  4Z7O B;  4K3J B;  1U8C B;  3OF7 A;  2H9P A;  5C2W B;  3BG0 A;  4O02 A;  5EMJ B;  3SCY A;  4DNW A;  2OK4 A;  4WK0 B;  2OK6 A;  3IUJ A;  4BUJ C;  4BCC A;  3C5M A;  4ZOZ A;  3RFH A;  1XHM A;  4UM9 A;  3SMR A;  2Z2N A;  3C75 H;  2VDP B;  2P9K C;  4ZN4 A;  5M5S A;  1K32 A;  1JV2 A;  1A12 A;  1N6E A;  3RLM D;  2VDO A;  2AGZ A;  1PI6 A;  3NIG B;  4PSW B;  5HDB A;  3PSL A;  4U1E I;  1Q47 A;  4QRJ A;  3PSC B;  4PXW A;  4GQB B;  4RE5 A;  4Z7Q B;  4O9D A;  3NVQ A;  1PGU A;  4FA9 D;  1TYE A;  3OKT A;  5FQD A;  2H14 A;  3JRO A;  2IUP A;  2OVR B;  1JJU B;  3OKY B;  5IJ8 E;  3UVO A;  1K3I A;  3IIW A;  3T3P B;  3JZN A;  3GC3 B;  2CNX A;  2JKX A;  2TRC B;  2I3T A;  3DM0 A;  3EI4 B;  3IVM A;  3ZDX A;  4L3H D;  2OJY A;  3ZDZ A;  3I8E A;  3AL8 B;  3PXW D;  3SBQ A;  4FWW A;  4BCB A;  5IGO A;  5AJA A;  5HE3 B;  3ZE0 A;  3N0D A;  3NID B;  4CI3 A;  4R7A B;  1GXR A;  3ZDY A;  3OL2 B;  2GC4 A;  5CXC A;  2JWG A;  2IUR A;  4UI9 R;  2HJB A;  3UVN A;  3ZWL B;  4E54 A;  2VDL A;  3ZE1 B;  3KCI A;  4PNK B;  4ERQ A;  4O2W A;  1QFM A;  3ZE2 A;  4Y5R D;  3RN1 D;  5CXB A;  3PVW B;  3DWL C;  4NAA A;  4O1Q D;  3SVW D;  4X3E A;  4X63 B;  2IWK A;  5EMK B;  4A11 B;  2P9U C;  3AL9 A;  3K26 A;  4MMY A;  2YMU A;  4XYI A;  1C9I A;  5I5I A;  4PC0 A;  2I0S A;  4CI8 A;  4NC4 A;  2J57 G;  3BG1 A;  4UM9 D;  4WK4 B;  1E8N A;  3I7K A;  1YUK A;  3W15 A;  3O4H A;  3DXK C;  2J56 H;  3FCS A;  4J73 A;  5K1C C;  2XL3 A;  3IUN A;  5I5M A;  2HKR A;  3BWS A;  2EBS A;  4JSN C;  4ERY A;  2XU7 A;  4A08 A;  3CIK B;  5E6U B;  2HU7 A;  3T3M B;  3ODT A;  1H2W A;  4WK2 A;  5M5T A;  2H13 A;  1VZ2 A;  5EAL A;  1GP2 B;  4LG9 A;  4AN1 A;  5EM2 A;  2VDR A;  5E6R B;  3RRM C;  2VDK B;  3MMY A;  4A0B A;  2HJ4 A;  3VGZ A;  3IIY A;  5HE1 B;  4AOW A;  4Z7N A;  2VZ1 A;  3KRX B;  3EI2 B;  2OVP B;  3EQ7 A;  3GRE A;  4AMY A;  2Q7Q A;  4CC9 A;  3UVK A;  2HKM A;  4FB1 D;  5HE0 B;  4D6V A;  5TEF A;  5FLX g;  3VI4 B;  1A0R B;  3FCU B;  3IJ1 A;  1U8C A;  3V4P A;  3PE7 A;  2O9K A;  1VYH C;  3ORV D;  1VZ3 A;  3SJL D;  4FAV D;  2BBK H;  3SXT D;  3KRW B;  2CN3 A;  2EID A;  2HYE A;  2J55 H;  4CI1 A;  3CFV A;  5EML B;  1UTC A;  3J81 g;  4BCD A;  2IAA A;  3L4M D;  1UOO A;  3SLE D;  5AFU 3;  1ERJ A;  2P9N C;  5IT9 g;  1YR2 A;  5GXH A;  2B5N A;  4L1M A;  1XKS A;  4FA5 D;  2PM9 B;  3K27 A;  4ZOX A;  4G55 A;  1O6F A;  4J78 A; 
#chains in the Genus database with same CATH homology
 2B5M A;  3DSM A;  4CY2 A;  4J86 A;  5FA5 B;  3F3F A;  4PBZ A;  3NVX A;  2CO0 C;  4JT6 C;  5FKR A;  2P9L C;  4J0W A;  3VI3 B;  5H14 A;  5HYN B;  4XYH A;  1SHY B;  2YB8 B;  5FXY A;  3RMZ D;  2PM7 B;  3HFQ A;  4PSX B;  5CYK A;  4ZOV A;  2G9A A;  4CY3 A;  2UZX B;  3RN0 D;  1PBY B;  3I89 A;  3EI1 A;  2B4E A;  4WJK B;  2CN2 A;  4BL0 A;  4HDJ A;  3AFC A;  3OL2 A;  4J87 A;  4JD2 C;  3DXM C;  3JRP A;  3V7D B;  3I7N A;  5HDB B;  3EI3 A;  4X60 B;  4A0A A;  5IJ7 E;  3PVU B;  3C99 A;  2W18 A;  4GZ8 A;  4J8B A;  4JSX C;  1TYE B;  2GC7 A;  4Z8L A;  1OMW B;  3MZK A;  3PXS D;  4J84 A;  5E6S B;  3JZH A;  5SXM A;  4A7J A;  4J77 A;  1RI6 A;  2H47 A;  1PEV A;  3ZDX B;  2AH0 A;  3JZG A;  2P28 A;  2IUV A;  3ZDZ B;  3MKQ A;  4GQ2 P;  3ZE0 B;  2P9S C;  4N14 A;  5KDO B;  1SQ9 A;  4GMB A;  3ZDY B;  5EMM B;  2UZY B;  2QXV A;  4A09 B;  2P9I C;  3RSE C;  1GOT B;  3V9F A;  4CZX A;  4E54 B;  2BCJ B;  3IJ0 A;  5GMK n;  2H6Q A;  3SBP A;  4UM8 B;  4H5I A;  3AH8 B;  4NSX A;  2YNP A;  5IC7 A;  4O3T B;  2XL2 A;  3I7H A;  2HES X;  5CXB B;  5I5J A;  1TBG A;  3C9C A;  3EI2 A;  3UVL A;  2VDQ B;  4J0X A;  3F3P A;  3I7P A;  4ZOY A;  5GSA A;  4TZ4 A;  4ES0 A;  4GGD A;  5H1M A;  4CI2 A;  2XYI A;  1YFQ A;  1B9X A;  5K19 A;  4GM9 A;  5C2V B;  4QL1 A;  4CY1 A;  2P9P C;  1JMX B;  4A2L A;  2CO0 A;  3NIF B;  2YBA A;  1MG3 A;  3FM0 A;  2AQ5 A;  3UKR C;  3I2N A;  4WK2 B;  1GG2 B;  3NVN A;  3UKU C;  1P22 A;  2VDR B;  5HQG A;  4J82 A;  2H3X A;  3RFG A;  4E5Z B;  4Z7N B;  2YNO A;  3SHF A;  2H6K A;  2VC2 B;  3VH0 A;  4MK0 B;  1SSL A;  2I0T A;  5EAR A;  3F3G A;  4GQ1 A;  4A2M A;  3JB9 L;  2JWH A;  3N0E A;  5A2Q g;  5IGQ A;  4AEZ A;  2H9L A;  4ERZ A;  1FWX A;  3A0F A;  5FKQ A;  4H5J A;  4I79 A;  2H9M A;  4J81 A;  3E0C A;  2IWF A;  3OKY A;  3SFZ A;  3EMH A;  4FAN D;  2H6N A;  1NEX B;  4O45 A;  2AGX A;  3J80 g;  3IKO A;  4EWR A;  3B7F A;  3EI4 A;  4FA4 D;  4JT5 C;  2B5L A;  4O3U B;  4IMM A;  3UVM A;  5TF2 A;  3AL8 A;  5AMS A;  3SWS D;  2AGY A;  2PBI B;  4UM9 B;  3JPX A;  3JAM g;  4Y7R A;  2I3S A;  5FKT A;  4GGA A;  4JXM A;  2VDO B;  1L0Q A;  1JMZ B;  4CZV A;  4J79 A;  5GXI A;  1OLZ A;  3GFC A;  1MG2 A;  3I7L A;  2OVQ B;  1JOF A;  4GGC A;  1S4U X;  3I7O A;  5CYK B;  4A11 A;  4X61 B;  5C9Z B;  4FHL A;  4OZU A;  3MZL A;  4LGN A;  1TYQ C;  5FKS A;  1QNI A;  4OWR A;  3EI1 B;  2AH1 A;  4JSV C;  3VA6 A;  2HXC A;  5TEE A;  2IUQ A;  4PBY A;  3V5W B;  2G99 A;  2AGW A;  4A09 A;  3OTT A;  3SBR A;  3EI3 B;  2P26 A;  4A0A B;  5JWZ A;  5B4W A;  4FA1 D;  5CXC B;  3EG6 A;  3L4O D;  3MKS B;  2MTA H;  5EAP A;  5H17 A;  3P4F A;  3I8C A;  1N6F A;  4GM3 A;  5EAM A;  1K8K C;  2Z2P A;  2VDL B;  4K3I D;  3PXT D;  4BH6 A;  2PM6 B;  2VDN B;  3ZE2 B;  1B9Y A;  5TDH B;  4U7A A;  4IA9 A;  4LG8 A;  4JSP C;  1SQJ A;  5HE2 B;  1U2V C;  4D0K A;  2AGL A;  4QT8 A;  1MDA H;  3OKW A;  3U4Y A;  4YVD A;  3ULE C;  2I0R A;  1NR0 A;  1N6D A;  4CZY A;  4J8G A;  2H68 A;  2YNN A;  4L1Q D;  4GM8 A;  3OW8 A;  2QC5 A;  4A08 B;  2CE8 A;  3CFS B;  3MXX A;  2H9N A;  3FRX A;  4E5Z A;  4L3G D;  3EU7 A;  4G56 B;  5EM2 B;  2GNQ A;  1XIP A;  4A0B B;  4QQE A;  2PM9 A;  3FGB A;  2Z2O A;  4L9O A;  1U4C A;  4KFM B;  3UR4 A;  2OIZ A;  1R5M A;  4XEI C;  4CY5 A;  3IJC A;  5THA A;  3SN6 B;  3EWE A;  4ESG A;  4Z7O B;  2CE9 A;  2VDM B;  4K3J B;  1U8C B;  5C2W B;  2H9P A;  3BG0 A;  5EMJ B;  3SCY A;  2OK4 A;  4WK0 B;  2OK6 A;  4BUJ C;  3C5M A;  4ZOZ A;  3RFH A;  1XHM A;  3SMR A;  2Z2N A;  3C75 H;  2VDP B;  2P9K C;  4ZN4 A;  1K32 A;  1N6E A;  3RLM D;  2AGZ A;  1PI6 A;  3NIG B;  4PSW B;  3PSL A;  4U1E I;  1Q47 A;  4QRJ A;  3PSC B;  4PXW A;  4GQB B;  4Z7Q B;  4O9D A;  3NVQ A;  1PGU A;  4FA9 D;  5FQD A;  3OKT A;  2H14 A;  3JRO A;  2IUP A;  2OVR B;  1JJU B;  3OKY B;  5IJ8 E;  3UVO A;  3IIW A;  3T3P B;  3JZN A;  2CNX A;  2TRC B;  2I3T A;  3DM0 A;  3EI4 B;  4L3H D;  2OJY A;  3I8E A;  3AL8 B;  3PXW D;  3SBQ A;  4FWW A;  5IGO A;  5AJA A;  5HE3 B;  3N0D A;  3NID B;  4CI3 A;  4R7A B;  1GXR A;  3OL2 B;  2GC4 A;  5CXC A;  2JWG A;  2IUR A;  4UI9 R;  2HJB A;  3UVN A;  3ZWL B;  4E54 A;  3ZE1 B;  4PNK B;  4ERQ A;  4Y5R D;  3RN1 D;  5CXB A;  3PVW B;  3DWL C;  4O1Q D;  3SVW D;  4X3E A;  4X63 B;  2IWK A;  5EMK B;  4A11 B;  2P9U C;  3AL9 A;  3K26 A;  2YMU A;  4XYI A;  5I5I A;  4PC0 A;  2I0S A;  4CI8 A;  2J57 G;  3BG1 A;  4UM9 D;  4WK4 B;  3I7K A;  1YUK A;  3W15 A;  3DXK C;  2J56 H;  4J73 A;  5K1C C;  2XL3 A;  5I5M A;  2HKR A;  3BWS A;  2EBS A;  4JSN C;  4ERY A;  2XU7 A;  4A08 A;  3CIK B;  5E6U B;  3T3M B;  3ODT A;  2H13 A;  5EAL A;  1GP2 B;  4LG9 A;  5EM2 A;  5E6R B;  3RRM C;  2VDK B;  3MMY A;  4A0B A;  2HJ4 A;  3VGZ A;  3IIY A;  5HE1 B;  4AOW A;  3KRX B;  3EI2 B;  2OVP B;  3GRE A;  2Q7Q A;  4CC9 A;  3UVK A;  2HKM A;  4FB1 D;  5HE0 B;  4D6V A;  5TEF A;  5FLX g;  3VI4 B;  1A0R B;  3FCU B;  3IJ1 A;  3PE7 A;  2O9K A;  1VYH C;  3ORV D;  3SJL D;  4FAV D;  2BBK H;  3SXT D;  2CN3 A;  3KRW B;  2HYE A;  2J55 H;  4CI1 A;  3CFV A;  5EML B;  3J81 g;  2IAA A;  3L4M D;  3SLE D;  5AFU 3;  1ERJ A;  2P9N C;  5IT9 g;  5GXH A;  2B5N A;  4FA5 D;  1XKS A;  2PM9 B;  3K27 A;  4ZOX A;  4J78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...