4O3UB

Zymogen hgf-beta/met with zymogen activator peptide zap2.3
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
526
structure length
500
Chain Sequence
MKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKINVRCLQHFYGPNHEHCFNRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/growth factor
molecule keywords Hepatocyte growth factor
publication title An allosteric switch for pro-HGF/Met signaling using zymogen activator peptides.
pubmed doi rcsb
source organism Homo sapiens
total genus 114
structure length 500
sequence length 526
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4o3uB01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4o3uB02
4A08B 2IAAA 2TRCB 2Z2OA 3OKTA 4A0BA 3JROA 3EU7A 4E5ZB 4JSPC 4CZVA 5JWZA 2P9IC 4Z7QB 3I7LA 4BL0A 2AQ5A 1GOTB 4PBZA 4J81A 5IGOA 3W15A 5EM2A 5E6UB 3OKWA 4A09B 3NIDB 1XIPA 3NVXA 5TF2A 2H13A 1XKSA 4QL1A 4J0WA 2HKRA 3I89A 1TYQC 2P9LC 1N6DA 2YBAA 5GXHA 4Y5RD 3IJ1A 3PE7A 4GM9A 4ERYA 3CFSB 4PBYA 3E0CA 4A0AA 5H14A 4AEZA 2XU7A 2YNOA 3PVUB 4ZOYA 3DXMC 2EBSA 4WK0B 4I79A 3L4MD 3BG1A 3UVOA 3JPXA 3L4OD 1XHMA 4JSVC 3P4FA 3EMHA 4O9DA 2XYIA 5IJ8E 1OMWB 4FA4D 3MKSB 2P9UC 4CC9A 5EAPA 3SXTD 3RN1D 1A0RB 3B7FA 3RSEC 5C2VB 3MZLA 3ZDYB 5TEFA 4ERQA 2IUPA 3VI4B 3EI3B 4J8BA 3I7PA 4CI2A 2H9PA 3F3PA 2IURA 4GM3A 5I5IA 3JZHA 5FA5B 3EI2A 4FAVD 1QNIA 1PBYB 2J57G 1Q47A 2I3SA 3OTTA 5I5JA 4J8GA 4FA9D 3SVWD 2CO0A 4OWRA 5TDHB 4JD2C 2W18A 4ZN4A 3ORVD 3EG6A 3ZE1B 4GGDA 3IKOA 4E5ZA 2G99A 2AGLA 3PXTD 1MDAH 3K26A 4JXMA 2VDQB 5EALA 5IC7A 2YNNA 1YUKA 5H1MA 2G9AA 4CY1A 3V9FA 5FXYA 4Z7OB 5A2Qg 2IUQA 2VDPB 1P22A 2H3XA 5E6SB 5FLXg 1JMXB 2P9SC 5E6RB 4E54B 3DM0A 5GMKn 2HKMA 3F3GA 4CZXA 4WK2B 1VYHC 4L1QD 3AL8B 2BCJB 4CI3A 3EI1A 2AH1A 2AGYA 2CE8A 5FKSA 4OZUA 1U8CB 2O9KA 2IUVA 4XEIC 4ZOXA 4Y7RA 1JOFA 4FA1D 4CY2A 3AFCA 3AL9A 2PM7B 4J0XA 4FWWA 4ZOZA 4BH6A 1N6EA 3I7HA 2P9PC 4GM8A 4PC0A 3ZE2B 5FKTA 4A11B 4ZOVA 1NEXB 4A2MA 1NR0A 3JRPA 4U1EI 4J87A 2VDOB 3V5WB 4JSXC 5CXBA 4FB1D 3K27A 4JT6C 4O3UB 3J81g 2OVPB 3OKYA 5CYKB 3NVQA 3JZGA 3C5MA 2AGWA 3ODTA 4XYHA 3SWSD 4L9OA 5THAA 2VDNB 4UI9R 5CXCB 1OLZA 4L3HD 2H68A 5C9ZB 3AH8B 3F3FA 3I7OA 1YFQA 2H6KA 3FCUB 1GXRA 4LG8A 2HYEA 2PM9A 4AOWA 4NSXA 2AGXA 3DWLC 3RMZD 3UKRC 2H9LA 4UM8B 2XL2A 5K1CC 4GQBB 1MG2A 3SFZA 4A0BB 4U7AA 5C2WB 4J79A 4Z8LA 2PBIB 5IGQA 1U4CA 3SBRA 5HE2B 3V7DB 5EM2B 4D0KA 3DXKC 1R5MA 4FAND 2HXCA 2OVRB 1U2VC 3IJCA 5K19A 3KRXB 3PXSD 4QRJA 2CN2A 3I2NA 3ULEC 4H5JA 5FKRA 3EWEA 4LG9A 5HE3B 2GC7A 3AL8A 4HDJA 2B5NA 4YVDA 4A08A 4A0AB 4X63B 1TBGA 1MG3A 3SHFA 3UVNA 5GSAA 4J84A 3PXWD 3KRWB 5HDBB 3VI3B 4WJKB 3DSMA 4ES0A 2I0SA 3NIFB 3VA6A 3C75H 3GREA 4J73A 4X61B 4A09A 2B5MA 1SSLA 1FWXA 4PXWA 2VDMB 2YNPA 3UVLA 1SQ9A 5IJ7E 2VC2B 2HJBA 4D6VA 4G56B 4UM9D 1PGUA 4QQEA 3N0EA 5EAMA 3MZKA 4TZ4A 2H9NA 4A2LA 4GQ1A 3SLED 4GQ2P 3BWSA 3SMRA 4ERZA 2VDRB 4CI1A 4FHLA 4PSWB 5HE0B 5EARA 4GGAA 4Z7NB 1PI6A 3PSCB 2I0TA 2P28A 2AGZA 4J82A 5AFU3 2B4EA 3EI2B 3EI4B 2I0RA 5I5MA 4KFMB 2CN3A 3GFCA 3SBQA 2GNQA 3IIWA 4X60B 5EMKB 5H17A 1GG2B 4EWRA 2CO0C 5B4WA 2OK4A 4A7JA 1JJUB 3RFHA 3U4YA 4BUJC 5FQDA 2OVQB 5KDOB 4K3ID 4O45A 2HESX 3OL2B 3EI3A 4GGCA 3VGZA 2H14A 4IMMA 3SJLD 2IWFA 2P9NC 1GP2B 3UKUC 3RLMD 4PSXB 3RN0D 1L0QA 4J78A 3N0DA 2P26A 3C99A 2QXVA 4GZ8A 2VDKB 3ZDXB 4J77A 5EMJB 3ZE0B 3JB9L 3ZWLB 2PM6B 1RI6A 4H5IA 2OIZA 4IA9A 2H9MA 4XYIA 3UVKA 3I7KA 4X3EA 5HYNB 3ZDZB 1K8KC 2XL3A 4L3GD 5TEEA 3EI1B 2GC4A 3I7NA 3MMYA 2H6NA 3PSLA 4ESGA 1PEVA 3BG0A 2UZYB 3CFVA 1B9YA 1JMZB 3UVMA 3PVWB 4MK0B 5FKQA 4PNKB 2H6QA 2YMUA 2P9KC 3OW8A 4E54A 4CI8A 3MXXA 3UR4A 2B5LA 3SCYA 2AH0A 3HFQA 5CXBB 2MTAH 3CIKB 3OKYB 4CY3A 3FGBA 3NIGB 3FM0A 5HQGA 4CZYA 3JZNA 3EI4A 3J80g 2OK6A 5AMSA 3I8EA 3RFGA 2VDLB 4K3JB 1SHYB 2J56H 5AJAA 4A11A 3FRXA 1K32A 3IIYA 2PM9B 2CNXA 4CY5A 3MKQA 4J86A 2Q7QA 3A0FA 3OL2A 2I3TA 3NVNA 2YB8B 5GXIA 2J55H 5CYKA 3SN6B 2UZXB 2Z2PA 2IWKA 3C9CA 2CE9A 5HE1B 3VH0A 3T3PB 1SQJA 4WK4B 5IT9g 2H47A 2HJ4A 2QC5A 5CXCA 3SBPA 4LGNA 4O1QD 1S4UX 1TYEB 4N14A 2BBKH 4JT5C 5EMMB 2OJYA 3I8CA 4FA5D 4QT8A 3T3MB 5SXMA 4O3TB 4R7AB 5EMLB 3IJ0A 1ERJA 1B9XA 1N6FA 2Z2NA 4JSNC 4UM9B 3JAMg 4GMBA 3RRMC
chains in the Genus database with same CATH superfamily
4A08B 2IAAA 2TRCB 2Z2OA 3OKTA 4A0BA 3JROA 3EU7A 4E5ZB 4JSPC 1JTDB 4CZVA 5JWZA 2P9IC 4Z7QB 1K3IA 3I7LA 4BL0A 2AQ5A 2VZ1A 1GOTB 4PBZA 2VZ3A 4J81A 5IGOA 3W15A 5EM2A 5E6UB 3OKWA 4A09B 3NIDB 1XIPA 1H2YA 3NVXA 5TF2A 2H13A 1XKSA 4QL1A 4J0WA 2HKRA 3I89A 1TYQC 2P9LC 1N6DA 2YBAA 5GXHA 3K72A 4Y5RD 3IJ1A 3PE7A 4GM9A 4ERYA 3CFSB 3NIGA 4PBYA 3E0CA 2HU5A 4A0AA 5H14A 4AEZA 2XU7A 2YNOA 3O4HA 3V4PA 3PVUB 4ZOYA 3DXMC 2EBSA 4WK0B 4I79A 3L4MD 3BG1A 3UVOA 3K71A 3JPXA 5HDBA 3VI3A 4WJKA 1E5TA 3L4OD 1XHMA 4JSVC 3NIFA 3P4FA 3EMHA 3IURA 4O9DA 2XYIA 3O4GA 1QFMA 5IJ8E 1OMWB 4NBMA 4FA4D 3MKSB 2P9UC 2VC2A 4CC9A 4BP8A 3IJEA 5EAPA 3SXTD 3RN1D 1A0RB 3B7FA 2EIBA 3RSEC 5C2VB 3MZLA 3IUMA 3ZDYB 1H2WA 5TEFA 4ERQA 2IUPA 3MUNA 3VI4B 3EI3B 4J8BA 2VDRA 3I7PA 4CI2A 2H9PA 3F3PA 4Z7NA 2IURA 4GM3A 5I5IA 3JZHA 5FA5B 3EI2A 4FAVD 1QNIA 1PBYB 2J57G 1Q47A 2I3SA 3OTTA 4DNVA 5I5JA 3T3MA 4J8GA 4FA9D 3SVWD 3KCIA 2CO0A 4OWRA 4AMYA 5TDHB 4UM9A 4JD2C 2W18A 4ZN4A 3ORVD 3EG6A 3ZE1B 4GGDA 3IKOA 4E5ZA 2EICA 2G99A 2AGLA 3PXTD 2JWHA 1MDAH 3K26A 4JXMA 2VDQB 5EALA 5IC7A 2YNNA 1YUKA 5H1MA 2G9AA 2VDKA 4CY1A 3V9FA 5FXYA 3ZDXA 4Z7OB 5A2Qg 2IUQA 3ZE0A 1E8MA 1GOGA 1P22A 2VDPB 2H3XA 5C92A 5E6SB 5FLXg 1JMXB 2P9SC 5E6RB 4E54B 3DM0A 5GMKn 2HKMA 3MUOA 3F3GA 4CZXA 4WK2B 1VYHC 4L1QD 5C86A 1GOHA 1C9IA 3AL8B 3V4VA 2BCJB 3ZDZA 4CI3A 3EI1A 2AH1A 4MMYA 2AGYA 3IVMA 1O6FA 2CE8A 5FKSA 1UOQA 3EQ8A 4OZUA 1H2XA 2O9KA 1U8CB 2IUVA 4XEIC 4ZOXA 4Y7RA 1JOFA 4AX4A 4FA1D 2EIDA 3OF7A 4CY2A 3AFCA 3AL9A 2PM7B 4J0XA 4FWWA 4ZOZA 4BH6A 4D9SA 1N6EA 3O4JA 4AN1A 3I7HA 2P9PC 4GM8A 4PC0A 3ZE2B 5FKTA 4A11B 4ZOVA 5M5TA 2JWGA 1NEXB 4A2MA 1NR0A 3JRPA 4U1EI 2HU7A 4J87A 4O2WA 2VDOB 3V5WB 4O02A 4JSXC 5CXBA 4FB1D 3K27A 4JT6C 4O3UB 3J81g 2OVPB 3OKYA 5CYKB 3NVQA 3JZGA 1UOOA 3C5MA 2AGWA 3ODTA 4XYHA 3SWSD 4L9OA 5THAA 2VDNB 3IUQA 4UI9R 5CXCB 1OLZA 4L3HD 2H68A 5C9ZB 3IUJA 1UTCA 3AH8B 3F3FA 3I7OA 1YFQA 2VDLA 2H6KA 3FCUB 1GXRA 4LG8A 2HYEA 2PM9A 3K6SA 4AN0A 4AOWA 4NSXA 4G1EA 2AGXA 3DWLC 2HU8A 2QR5A 4L1MA 3RMZD 3UKRC 2H9LA 4UM8B 2XL2A 5K1CC 4GQBB 1MG2A 3GD1I 1H2ZA 3SFZA 4A0BB 3T3PA 4NC4A 4U7AA 4J79A 4Z8LA 2PBIB 5C2WB 3O4IA 5IGQA 4WK4A 1U4CA 3SBRA 1TYEA 5HE2B 3V7DB 5EM2B 4D0KA 3DXKC 1R5MA 4FAND 2HXCA 2OVRB 1U2VC 3IJCA 5K19A 3KRXB 3PXSD 4QRJA 2CN2A 3I2NA 3ULEC 4H5JA 5FKRA 3EWEA 4LG9A 5M5RA 4MMXA 2GC7A 3AL8A 5HE3B 4HDJA 2B5NA 4YVDA 4A08A 4A0AB 4X63B 1TBGA 3QI0A 1MG3A 3SHFA 3UVNA 5GSAA 4Z7QA 4J84A 3PXWD 3KRWB 5HDBB 3VI3B 4WJKB 1VZ3A 3DSMA 5E6UA 4ES0A 2I0SA 3NIFB 3VA6A 3C75H 3GREA 4J73A 4X61B 3NIDA 4A09A 2B5MA 1SSLA 2XE4A 1FWXA 4PXWA 2VDMB 2YNPA 3UVLA 1SQ9A 5IJ7E 2VC2B 2HJBA 4D6VA 4G56B 4UM9D 1PGUA 4QQEA 3N0EA 1BPOA 5EAMA 4BCCA 3MZKA 4TZ4A 5M5UA 2H9NA 4A2LA 4GQ1A 3SLED 4GQ2P 1JV2A 3BWSA 3DDUA 3SMRA 4ERZA 2VDRB 4CI1A 2VDNA 4FHLA 4PSWB 5HE0B 5EARA 4GGAA 4Z7NB 1PI6A 3PSCB 2I0TA 3QHYB 4NAAA 2P28A 2AGZA 4WK0A 4J82A 5AFU3 2B4EA 3EI2B 3EI4B 5M61A 2I0RA 5I5MA 4KFMB 2CN3A 3GFCA 3SBQA 2GNQA 2BKLA 3IIWA 1A12A 4X60B 5EMKB 5FFGA 1L5GA 5H17A 1GG2B 4EWRA 2JKXA 2CO0C 5B4WA 2OK4A 4A7JA 1JJUB 3RFHA 3U4YA 4BUJC 3ZDYA 5FQDA 2OVQB 5KDOB 2EIEA 4K3ID 4O45A 2HESX 3OL2B 3VI4A 3EQ9A 3EI3A 4GGCA 1O6GA 3VGZA 2H14A 4IMMA 3SJLD 3GC3B 2IWFA 2P9NC 1GP2B 3UKUC 3RLMD 4PSXB 3RN0D 1L0QA 4J78A 3N0DA 2P26A 4JHPC 3C99A 2QXVA 1C9LA 4GZ8A 4RE5A 2VDKB 3ZDXB 4J77A 5EMJB 3ZE0B 3JB9L 3ZWLB 1UOPA 2PM6B 1RI6A 4H5IA 2OIZA 4IA9A 4BCBA 2H9MA 4XYIA 3UVKA 3I7KA 4X3EA 5HYNB 3ZDZB 3ZE1A 1K8KC 2XL3A 4L3GD 5TEEA 3EI1B 2GC4A 3I7NA 3MMYA 2H6NA 3PSLA 4ESGA 1T2XA 1PEVA 3IULA 3BG0A 2UZYB 2VDQA 3CFVA 1B9YA 1JMZB 3UVMA 5M5SA 3PVWB 1VE7A 4BP9A 4MK0B 2VDMA 3EQ7A 5FKQA 4PNKB 2H6QA 4Z7OA 2YMUA 1I2MB 2P9KC 2VDPA 5E6SA 3OW8A 5E6RA 4E54A 4CI8A 3MXXA 3UR4A 2B5LA 3SCYA 2AH0A 4DNUA 4NENA 4WK2A 1QFSA 3HFQA 5CXBB 2MTAH 1VZ2A 3CIKB 3IUNA 3OKYB 4CY3A 1VE6A 3FGBA 3NIGB 2XZGA 3FM0A 4G1MA 5HQGA 1YR2A 4CZYA 1M1XA 1U8CA 3EI4A 3FCSA 3JZNA 4IRZA 3J80g 2OK6A 5AMSA 3I8EA 3RFGA 2VDLB 4K3JB 1SHYB 2J56H 3ZE2A 4BCDA 5AJAA 4A11A 3FRXA 1K32A 3IIYA 4AMZA 2PM9B 2CNXA 4CY5A 3MKQA 4J86A 4JHNA 2Q7QA 3A0FA 3OL2A 2VDOA 2I3TA 3NVNA 5FFOA 2YB8B 5GXIA 2J55H 1E8NA 3MVDK 5CYKA 3SN6B 2UZXB 2Z2PA 2IWKA 3C9CA 2CE9A 5HE1B 3VH0A 3T3PB 1SQJA 4WK4B 5IT9g 2H47A 2HJ4A 4QAMA 2QC5A 5CXCA 3SBPA 4LGNA 4O1QD 1S4UX 1TYEB 4N14A 2BBKH 2XDWA 4JT5C 5EMMB 2OJYA 3I8CA 3FCUA 5M5VA 4FA5D 2QZPA 4QT8A 3T3MB 5SXMA 4RE6A 4O3TB 4R7AB 5EMLB 2WQ8A 3IJ0A 1ERJA 1B9XA 1N6FA 2Z2NA 4JSNC 4DNWA 3JAMg 4GMBA 4G55A 4UM9B 4MMZA 3RRMC 4UM8A 1GOFA
chains in the Genus database with same CATH topology
4A08B 2IAAA 2TRCB 2Z2OA 3OKTA 4A0BA 3JROA 3EU7A 4E5ZB 4JSPC 4CZVA 5JWZA 2P9IC 4Z7QB 3I7LA 4BL0A 2AQ5A 1GOTB 4PBZA 4J81A 5IGOA 3W15A 5EM2A 5E6UB 3OKWA 4A09B 3NIDB 1XIPA 3NVXA 5TF2A 2H13A 1XKSA 4QL1A 4J0WA 2HKRA 3I89A 1TYQC 2P9LC 1N6DA 2YBAA 5GXHA 4Y5RD 3IJ1A 3PE7A 4GM9A 4ERYA 3CFSB 4PBYA 3E0CA 4A0AA 5H14A 4AEZA 2XU7A 2YNOA 3PVUB 4ZOYA 3DXMC 2EBSA 4WK0B 4I79A 3L4MD 3BG1A 3UVOA 3JPXA 3L4OD 1XHMA 4JSVC 3P4FA 3EMHA 4O9DA 2XYIA 5IJ8E 1OMWB 4FA4D 3MKSB 2P9UC 4CC9A 5EAPA 3SXTD 3RN1D 1A0RB 3B7FA 3RSEC 5C2VB 3MZLA 3ZDYB 5TEFA 4ERQA 2IUPA 3VI4B 3EI3B 4J8BA 3I7PA 4CI2A 2H9PA 3F3PA 2IURA 4GM3A 5I5IA 3JZHA 5FA5B 3EI2A 4FAVD 1QNIA 1PBYB 2J57G 1Q47A 2I3SA 3OTTA 5I5JA 4J8GA 4FA9D 3SVWD 2CO0A 4OWRA 5TDHB 4JD2C 2W18A 4ZN4A 3ORVD 3EG6A 3ZE1B 4GGDA 3IKOA 4E5ZA 2G99A 2AGLA 3PXTD 2JWHA 1MDAH 3K26A 4JXMA 2VDQB 5EALA 5IC7A 2YNNA 1YUKA 5H1MA 2G9AA 4CY1A 3V9FA 5FXYA 4Z7OB 5A2Qg 2IUQA 2VDPB 1P22A 2H3XA 5E6SB 5FLXg 1JMXB 2P9SC 5E6RB 4E54B 3DM0A 5GMKn 2HKMA 3F3GA 4CZXA 4WK2B 1VYHC 4L1QD 3AL8B 2BCJB 4CI3A 3EI1A 2AH1A 2AGYA 2CE8A 5FKSA 4OZUA 1U8CB 2O9KA 2IUVA 4XEIC 4ZOXA 4Y7RA 1JOFA 4FA1D 4CY2A 3AFCA 3AL9A 2PM7B 4J0XA 4FWWA 4ZOZA 4BH6A 1N6EA 3I7HA 2P9PC 4GM8A 4PC0A 3ZE2B 5FKTA 4A11B 4ZOVA 2JWGA 1NEXB 4A2MA 1NR0A 3JRPA 4U1EI 4J87A 2VDOB 3V5WB 4JSXC 5CXBA 4FB1D 3K27A 4JT6C 4O3UB 3J81g 2OVPB 3OKYA 5CYKB 3NVQA 3JZGA 3C5MA 2AGWA 3ODTA 4XYHA 3SWSD 4L9OA 5THAA 2VDNB 4UI9R 5CXCB 1OLZA 4L3HD 2H68A 5C9ZB 3AH8B 3F3FA 3I7OA 1YFQA 2H6KA 3FCUB 1GXRA 4LG8A 2HYEA 2PM9A 4AOWA 4NSXA 2AGXA 3DWLC 3RMZD 3UKRC 2H9LA 4UM8B 2XL2A 5K1CC 4GQBB 1MG2A 3SFZA 4A0BB 4U7AA 5C2WB 4J79A 4Z8LA 2PBIB 5IGQA 1U4CA 3SBRA 5HE2B 3V7DB 5EM2B 4D0KA 3DXKC 1R5MA 4FAND 2HXCA 2OVRB 1U2VC 3IJCA 5K19A 3KRXB 3PXSD 4QRJA 2CN2A 3I2NA 3ULEC 4H5JA 5FKRA 3EWEA 4LG9A 5HE3B 2GC7A 3AL8A 4HDJA 2B5NA 4YVDA 4A08A 4A0AB 4X63B 1TBGA 1MG3A 3SHFA 3UVNA 5GSAA 4J84A 3PXWD 3KRWB 5HDBB 3VI3B 4WJKB 3DSMA 4ES0A 2I0SA 3NIFB 3VA6A 3C75H 3GREA 4J73A 4X61B 4A09A 2B5MA 1SSLA 1FWXA 4PXWA 2VDMB 2YNPA 3UVLA 1SQ9A 5IJ7E 2VC2B 2HJBA 4D6VA 4G56B 4UM9D 1PGUA 4QQEA 3N0EA 5EAMA 3MZKA 4TZ4A 2H9NA 4A2LA 4GQ1A 3SLED 4GQ2P 3BWSA 3SMRA 4ERZA 2VDRB 4CI1A 4FHLA 4PSWB 5HE0B 5EARA 4GGAA 4Z7NB 1PI6A 3PSCB 2I0TA 2P28A 2AGZA 4J82A 5AFU3 2B4EA 3EI2B 3EI4B 2I0RA 5I5MA 4KFMB 2CN3A 3GFCA 3SBQA 2GNQA 3IIWA 4X60B 5EMKB 5H17A 1GG2B 4EWRA 2CO0C 5B4WA 2OK4A 4A7JA 1JJUB 3RFHA 3U4YA 4BUJC 5FQDA 2OVQB 5KDOB 4K3ID 4O45A 2HESX 3OL2B 3EI3A 4GGCA 3VGZA 2H14A 4IMMA 3SJLD 2IWFA 2P9NC 1GP2B 3UKUC 3RLMD 4PSXB 3RN0D 1L0QA 4J78A 3N0DA 2P26A 3C99A 2QXVA 4GZ8A 2VDKB 3ZDXB 4J77A 5EMJB 3ZE0B 3JB9L 3ZWLB 2PM6B 1RI6A 4H5IA 2OIZA 4IA9A 2H9MA 4XYIA 3UVKA 3I7KA 4X3EA 5HYNB 3ZDZB 1K8KC 2XL3A 4L3GD 5TEEA 3EI1B 2GC4A 3I7NA 3MMYA 2H6NA 3PSLA 4ESGA 1PEVA 3BG0A 2UZYB 3CFVA 1B9YA 1JMZB 3UVMA 3PVWB 4MK0B 5FKQA 4PNKB 2H6QA 2YMUA 2P9KC 3OW8A 4E54A 4CI8A 3MXXA 3UR4A 2B5LA 3SCYA 2AH0A 3HFQA 5CXBB 2MTAH 3CIKB 3OKYB 4CY3A 3FGBA 3NIGB 3FM0A 5HQGA 4CZYA 3JZNA 3EI4A 3J80g 2OK6A 5AMSA 3I8EA 3RFGA 2VDLB 4K3JB 1SHYB 2J56H 5AJAA 4A11A 3FRXA 1K32A 3IIYA 2PM9B 2CNXA 4CY5A 3MKQA 4J86A 2Q7QA 3A0FA 3OL2A 2I3TA 3NVNA 2YB8B 5GXIA 2J55H 5CYKA 3SN6B 2UZXB 2Z2PA 2IWKA 3C9CA 2CE9A 5HE1B 3VH0A 3T3PB 1SQJA 4WK4B 5IT9g 2H47A 2HJ4A 2QC5A 5CXCA 3SBPA 4LGNA 4O1QD 1S4UX 1TYEB 4N14A 2BBKH 4JT5C 5EMMB 2OJYA 3I8CA 4FA5D 4QT8A 3T3MB 5SXMA 4O3TB 4R7AB 5EMLB 3IJ0A 1ERJA 1B9XA 1N6FA 2Z2NA 4JSNC 4UM9B 3JAMg 4GMBA 3RRMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A08 B;  2IAA A;  2TRC B;  2Z2O A;  3OKT A;  4A0B A;  3JRO A;  3EU7 A;  4E5Z B;  4JSP C;  4CZV A;  5JWZ A;  2P9I C;  4Z7Q B;  3I7L A;  4BL0 A;  2AQ5 A;  1GOT B;  4PBZ A;  4J81 A;  5IGO A;  3W15 A;  5EM2 A;  5E6U B;  3OKW A;  4A09 B;  3NID B;  1XIP A;  3NVX A;  5TF2 A;  2H13 A;  1XKS A;  4QL1 A;  4J0W A;  2HKR A;  3I89 A;  1TYQ C;  2P9L C;  1N6D A;  2YBA A;  5GXH A;  4Y5R D;  3IJ1 A;  3PE7 A;  4GM9 A;  4ERY A;  3CFS B;  4PBY A;  3E0C A;  4A0A A;  5H14 A;  4AEZ A;  2XU7 A;  2YNO A;  3PVU B;  4ZOY A;  3DXM C;  2EBS A;  4WK0 B;  4I79 A;  3L4M D;  3BG1 A;  3UVO A;  3JPX A;  3L4O D;  1XHM A;  4JSV C;  3P4F A;  3EMH A;  4O9D A;  2XYI A;  5IJ8 E;  1OMW B;  4FA4 D;  3MKS B;  2P9U C;  4CC9 A;  5EAP A;  3SXT D;  3RN1 D;  1A0R B;  3B7F A;  3RSE C;  5C2V B;  3MZL A;  3ZDY B;  5TEF A;  4ERQ A;  2IUP A;  3VI4 B;  3EI3 B;  4J8B A;  3I7P A;  4CI2 A;  2H9P A;  3F3P A;  2IUR A;  4GM3 A;  5I5I A;  3JZH A;  5FA5 B;  3EI2 A;  4FAV D;  1QNI A;  1PBY B;  2J57 G;  1Q47 A;  2I3S A;  3OTT A;  5I5J A;  4J8G A;  4FA9 D;  3SVW D;  2CO0 A;  4OWR A;  5TDH B;  4JD2 C;  2W18 A;  4ZN4 A;  3ORV D;  3EG6 A;  3ZE1 B;  4GGD A;  3IKO A;  4E5Z A;  2G99 A;  2AGL A;  3PXT D;  1MDA H;  3K26 A;  4JXM A;  2VDQ B;  5EAL A;  5IC7 A;  2YNN A;  1YUK A;  5H1M A;  2G9A A;  4CY1 A;  3V9F A;  5FXY A;  4Z7O B;  5A2Q g;  2IUQ A;  2VDP B;  1P22 A;  2H3X A;  5E6S B;  5FLX g;  1JMX B;  2P9S C;  5E6R B;  4E54 B;  3DM0 A;  5GMK n;  2HKM A;  3F3G A;  4CZX A;  4WK2 B;  1VYH C;  4L1Q D;  3AL8 B;  2BCJ B;  4CI3 A;  3EI1 A;  2AH1 A;  2AGY A;  2CE8 A;  5FKS A;  4OZU A;  1U8C B;  2O9K A;  2IUV A;  4XEI C;  4ZOX A;  4Y7R A;  1JOF A;  4FA1 D;  4CY2 A;  3AFC A;  3AL9 A;  2PM7 B;  4J0X A;  4FWW A;  4ZOZ A;  4BH6 A;  1N6E A;  3I7H A;  2P9P C;  4GM8 A;  4PC0 A;  3ZE2 B;  5FKT A;  4A11 B;  4ZOV A;  1NEX B;  4A2M A;  1NR0 A;  3JRP A;  4U1E I;  4J87 A;  2VDO B;  3V5W B;  4JSX C;  5CXB A;  4FB1 D;  3K27 A;  4JT6 C;  4O3U B;  3J81 g;  2OVP B;  3OKY A;  5CYK B;  3NVQ A;  3JZG A;  3C5M A;  2AGW A;  3ODT A;  4XYH A;  3SWS D;  4L9O A;  5THA A;  2VDN B;  4UI9 R;  5CXC B;  1OLZ A;  4L3H D;  2H68 A;  5C9Z B;  3AH8 B;  3F3F A;  3I7O A;  1YFQ A;  2H6K A;  3FCU B;  1GXR A;  4LG8 A;  2HYE A;  2PM9 A;  4AOW A;  4NSX A;  2AGX A;  3DWL C;  3RMZ D;  3UKR C;  2H9L A;  4UM8 B;  2XL2 A;  5K1C C;  4GQB B;  1MG2 A;  3SFZ A;  4A0B B;  4U7A A;  5C2W B;  4J79 A;  4Z8L A;  2PBI B;  5IGQ A;  1U4C A;  3SBR A;  5HE2 B;  3V7D B;  5EM2 B;  4D0K A;  3DXK C;  1R5M A;  4FAN D;  2HXC A;  2OVR B;  1U2V C;  3IJC A;  5K19 A;  3KRX B;  3PXS D;  4QRJ A;  2CN2 A;  3I2N A;  3ULE C;  4H5J A;  5FKR A;  3EWE A;  4LG9 A;  5HE3 B;  2GC7 A;  3AL8 A;  4HDJ A;  2B5N A;  4YVD A;  4A08 A;  4A0A B;  4X63 B;  1TBG A;  1MG3 A;  3SHF A;  3UVN A;  5GSA A;  4J84 A;  3PXW D;  3KRW B;  5HDB B;  3VI3 B;  4WJK B;  3DSM A;  4ES0 A;  2I0S A;  3NIF B;  3VA6 A;  3C75 H;  3GRE A;  4J73 A;  4X61 B;  4A09 A;  2B5M A;  1SSL A;  1FWX A;  4PXW A;  2VDM B;  2YNP A;  3UVL A;  1SQ9 A;  5IJ7 E;  2VC2 B;  2HJB A;  4D6V A;  4G56 B;  4UM9 D;  1PGU A;  4QQE A;  3N0E A;  5EAM A;  3MZK A;  4TZ4 A;  2H9N A;  4A2L A;  4GQ1 A;  3SLE D;  4GQ2 P;  3BWS A;  3SMR A;  4ERZ A;  2VDR B;  4CI1 A;  4FHL A;  4PSW B;  5HE0 B;  5EAR A;  4GGA A;  4Z7N B;  1PI6 A;  3PSC B;  2I0T A;  2P28 A;  2AGZ A;  4J82 A;  5AFU 3;  2B4E A;  3EI2 B;  3EI4 B;  2I0R A;  5I5M A;  4KFM B;  2CN3 A;  3GFC A;  3SBQ A;  2GNQ A;  3IIW A;  4X60 B;  5EMK B;  5H17 A;  1GG2 B;  4EWR A;  2CO0 C;  5B4W A;  2OK4 A;  4A7J A;  1JJU B;  3RFH A;  3U4Y A;  4BUJ C;  5FQD A;  2OVQ B;  5KDO B;  4K3I D;  4O45 A;  2HES X;  3OL2 B;  3EI3 A;  4GGC A;  3VGZ A;  2H14 A;  4IMM A;  3SJL D;  2IWF A;  2P9N C;  1GP2 B;  3UKU C;  3RLM D;  4PSX B;  3RN0 D;  1L0Q A;  4J78 A;  3N0D A;  2P26 A;  3C99 A;  2QXV A;  4GZ8 A;  2VDK B;  3ZDX B;  4J77 A;  5EMJ B;  3ZE0 B;  3JB9 L;  3ZWL B;  2PM6 B;  1RI6 A;  4H5I A;  2OIZ A;  4IA9 A;  2H9M A;  4XYI A;  3UVK A;  3I7K A;  4X3E A;  5HYN B;  3ZDZ B;  1K8K C;  2XL3 A;  4L3G D;  5TEE A;  3EI1 B;  2GC4 A;  3I7N A;  3MMY A;  2H6N A;  3PSL A;  4ESG A;  1PEV A;  3BG0 A;  2UZY B;  3CFV A;  1B9Y A;  1JMZ B;  3UVM A;  3PVW B;  4MK0 B;  5FKQ A;  4PNK B;  2H6Q A;  2YMU A;  2P9K C;  3OW8 A;  4E54 A;  4CI8 A;  3MXX A;  3UR4 A;  2B5L A;  3SCY A;  2AH0 A;  3HFQ A;  5CXB B;  2MTA H;  3CIK B;  3OKY B;  4CY3 A;  3FGB A;  3NIG B;  3FM0 A;  5HQG A;  4CZY A;  3JZN A;  3EI4 A;  3J80 g;  2OK6 A;  5AMS A;  3I8E A;  3RFG A;  2VDL B;  4K3J B;  1SHY B;  2J56 H;  5AJA A;  4A11 A;  3FRX A;  1K32 A;  3IIY A;  2PM9 B;  2CNX A;  4CY5 A;  3MKQ A;  4J86 A;  2Q7Q A;  3A0F A;  3OL2 A;  2I3T A;  3NVN A;  2YB8 B;  5GXI A;  2J55 H;  5CYK A;  3SN6 B;  2UZX B;  2Z2P A;  2IWK A;  3C9C A;  2CE9 A;  5HE1 B;  3VH0 A;  3T3P B;  1SQJ A;  4WK4 B;  5IT9 g;  2H47 A;  2HJ4 A;  2QC5 A;  5CXC A;  3SBP A;  4LGN A;  4O1Q D;  1S4U X;  1TYE B;  4N14 A;  2BBK H;  4JT5 C;  5EMM B;  2OJY A;  3I8C A;  4FA5 D;  4QT8 A;  3T3M B;  5SXM A;  4O3T B;  4R7A B;  5EML B;  3IJ0 A;  1ERJ A;  1B9X A;  1N6F A;  2Z2N A;  4JSN C;  4UM9 B;  3JAM g;  4GMB A;  3RRM C; 
#chains in the Genus database with same CATH topology
 4A08 B;  2IAA A;  2TRC B;  2Z2O A;  3OKT A;  4A0B A;  3JRO A;  3EU7 A;  4E5Z B;  4JSP C;  1JTD B;  4CZV A;  5JWZ A;  2P9I C;  4Z7Q B;  1K3I A;  3I7L A;  4BL0 A;  2AQ5 A;  2VZ1 A;  1GOT B;  4PBZ A;  2VZ3 A;  4J81 A;  5IGO A;  3W15 A;  5EM2 A;  5E6U B;  3OKW A;  4A09 B;  3NID B;  1XIP A;  1H2Y A;  3NVX A;  5TF2 A;  2H13 A;  1XKS A;  4QL1 A;  4J0W A;  2HKR A;  3I89 A;  1TYQ C;  2P9L C;  1N6D A;  2YBA A;  5GXH A;  3K72 A;  4Y5R D;  3IJ1 A;  3PE7 A;  4GM9 A;  4ERY A;  3CFS B;  3NIG A;  4PBY A;  3E0C A;  2HU5 A;  4A0A A;  5H14 A;  4AEZ A;  2XU7 A;  2YNO A;  3O4H A;  3V4P A;  3PVU B;  4ZOY A;  3DXM C;  2EBS A;  4WK0 B;  4I79 A;  3L4M D;  3BG1 A;  3UVO A;  3K71 A;  3JPX A;  5HDB A;  3VI3 A;  4WJK A;  1E5T A;  3L4O D;  1XHM A;  4JSV C;  3NIF A;  3P4F A;  3EMH A;  3IUR A;  4O9D A;  2XYI A;  3O4G A;  1QFM A;  5IJ8 E;  1OMW B;  4NBM A;  4FA4 D;  3MKS B;  2P9U C;  2VC2 A;  4CC9 A;  4BP8 A;  3IJE A;  5EAP A;  3SXT D;  3RN1 D;  1A0R B;  3B7F A;  2EIB A;  3RSE C;  5C2V B;  3MZL A;  3IUM A;  3ZDY B;  1H2W A;  5TEF A;  4ERQ A;  2IUP A;  3MUN A;  3VI4 B;  3EI3 B;  4J8B A;  2VDR A;  3I7P A;  4CI2 A;  2H9P A;  3F3P A;  4Z7N A;  2IUR A;  4GM3 A;  5I5I A;  3JZH A;  5FA5 B;  3EI2 A;  4FAV D;  1QNI A;  1PBY B;  2J57 G;  1Q47 A;  2I3S A;  3OTT A;  4DNV A;  5I5J A;  3T3M A;  4J8G A;  4FA9 D;  3SVW D;  3KCI A;  2CO0 A;  4OWR A;  4AMY A;  5TDH B;  4UM9 A;  4JD2 C;  2W18 A;  4ZN4 A;  3ORV D;  3EG6 A;  3ZE1 B;  4GGD A;  3IKO A;  4E5Z A;  2EIC A;  2G99 A;  2AGL A;  3PXT D;  2JWH A;  1MDA H;  3K26 A;  4JXM A;  2VDQ B;  5EAL A;  5IC7 A;  2YNN A;  1YUK A;  5H1M A;  2G9A A;  2VDK A;  4CY1 A;  3V9F A;  5FXY A;  3ZDX A;  4Z7O B;  5A2Q g;  2IUQ A;  3ZE0 A;  1E8M A;  1GOG A;  1P22 A;  2VDP B;  2H3X A;  5C92 A;  5E6S B;  5FLX g;  1JMX B;  2P9S C;  5E6R B;  4E54 B;  3DM0 A;  5GMK n;  2HKM A;  3MUO A;  3F3G A;  4CZX A;  4WK2 B;  1VYH C;  4L1Q D;  5C86 A;  1GOH A;  1C9I A;  3AL8 B;  3V4V A;  2BCJ B;  3ZDZ A;  4CI3 A;  3EI1 A;  2AH1 A;  4MMY A;  2AGY A;  3IVM A;  1O6F A;  2CE8 A;  5FKS A;  1UOQ A;  3EQ8 A;  4OZU A;  1H2X A;  2O9K A;  1U8C B;  2IUV A;  4XEI C;  4ZOX A;  4Y7R A;  1JOF A;  4AX4 A;  4FA1 D;  2EID A;  3OF7 A;  4CY2 A;  3AFC A;  3AL9 A;  2PM7 B;  4J0X A;  4FWW A;  4ZOZ A;  4BH6 A;  4D9S A;  1N6E A;  3O4J A;  4AN1 A;  3I7H A;  2P9P C;  4GM8 A;  4PC0 A;  3ZE2 B;  5FKT A;  4A11 B;  4ZOV A;  5M5T A;  2JWG A;  1NEX B;  4A2M A;  1NR0 A;  3JRP A;  4U1E I;  2HU7 A;  4J87 A;  4O2W A;  2VDO B;  3V5W B;  4O02 A;  4JSX C;  5CXB A;  4FB1 D;  3K27 A;  4JT6 C;  4O3U B;  3J81 g;  2OVP B;  3OKY A;  5CYK B;  3NVQ A;  3JZG A;  1UOO A;  3C5M A;  2AGW A;  3ODT A;  4XYH A;  3SWS D;  4L9O A;  5THA A;  2VDN B;  3IUQ A;  4UI9 R;  5CXC B;  1OLZ A;  4L3H D;  2H68 A;  5C9Z B;  3IUJ A;  1UTC A;  3AH8 B;  3F3F A;  3I7O A;  1YFQ A;  2VDL A;  2H6K A;  3FCU B;  1GXR A;  4LG8 A;  2HYE A;  2PM9 A;  3K6S A;  4AN0 A;  4AOW A;  4NSX A;  4G1E A;  2AGX A;  3DWL C;  2HU8 A;  2QR5 A;  4L1M A;  3RMZ D;  3UKR C;  2H9L A;  4UM8 B;  2XL2 A;  5K1C C;  4GQB B;  1MG2 A;  3GD1 I;  1H2Z A;  3SFZ A;  4A0B B;  3T3P A;  4NC4 A;  4U7A A;  4J79 A;  4Z8L A;  2PBI B;  5C2W B;  3O4I A;  5IGQ A;  4WK4 A;  1U4C A;  3SBR A;  1TYE A;  5HE2 B;  3V7D B;  5EM2 B;  4D0K A;  3DXK C;  1R5M A;  4FAN D;  2HXC A;  2OVR B;  1U2V C;  3IJC A;  5K19 A;  3KRX B;  3PXS D;  4QRJ A;  2CN2 A;  3I2N A;  3ULE C;  4H5J A;  5FKR A;  3EWE A;  4LG9 A;  5M5R A;  4MMX A;  2GC7 A;  3AL8 A;  5HE3 B;  4HDJ A;  2B5N A;  4YVD A;  4A08 A;  4A0A B;  4X63 B;  1TBG A;  3QI0 A;  1MG3 A;  3SHF A;  3UVN A;  5GSA A;  4Z7Q A;  4J84 A;  3PXW D;  3KRW B;  5HDB B;  3VI3 B;  4WJK B;  1VZ3 A;  3DSM A;  5E6U A;  4ES0 A;  2I0S A;  3NIF B;  3VA6 A;  3C75 H;  3GRE A;  4J73 A;  4X61 B;  3NID A;  4A09 A;  2B5M A;  1SSL A;  2XE4 A;  1FWX A;  4PXW A;  2VDM B;  2YNP A;  3UVL A;  1SQ9 A;  5IJ7 E;  2VC2 B;  2HJB A;  4D6V A;  4G56 B;  4UM9 D;  1PGU A;  4QQE A;  3N0E A;  1BPO A;  5EAM A;  4BCC A;  3MZK A;  4TZ4 A;  5M5U A;  2H9N A;  4A2L A;  4GQ1 A;  3SLE D;  4GQ2 P;  1JV2 A;  3BWS A;  3DDU A;  3SMR A;  4ERZ A;  2VDR B;  4CI1 A;  2VDN A;  4FHL A;  4PSW B;  5HE0 B;  5EAR A;  4GGA A;  4Z7N B;  1PI6 A;  3PSC B;  2I0T A;  3QHY B;  4NAA A;  2P28 A;  2AGZ A;  4WK0 A;  4J82 A;  5AFU 3;  2B4E A;  3EI2 B;  3EI4 B;  5M61 A;  2I0R A;  5I5M A;  4KFM B;  2CN3 A;  3GFC A;  3SBQ A;  2GNQ A;  2BKL A;  3IIW A;  1A12 A;  4X60 B;  5EMK B;  5FFG A;  1L5G A;  5H17 A;  1GG2 B;  4EWR A;  2JKX A;  2CO0 C;  5B4W A;  2OK4 A;  4A7J A;  1JJU B;  3RFH A;  3U4Y A;  4BUJ C;  3ZDY A;  5FQD A;  2OVQ B;  5KDO B;  2EIE A;  4K3I D;  4O45 A;  2HES X;  3OL2 B;  3VI4 A;  3EQ9 A;  3EI3 A;  4GGC A;  1O6G A;  3VGZ A;  2H14 A;  4IMM A;  3SJL D;  3GC3 B;  2IWF A;  2P9N C;  1GP2 B;  3UKU C;  3RLM D;  4PSX B;  3RN0 D;  1L0Q A;  4J78 A;  3N0D A;  2P26 A;  4JHP C;  3C99 A;  2QXV A;  1C9L A;  4GZ8 A;  4RE5 A;  2VDK B;  3ZDX B;  4J77 A;  5EMJ B;  3ZE0 B;  3JB9 L;  3ZWL B;  1UOP A;  2PM6 B;  1RI6 A;  4H5I A;  2OIZ A;  4IA9 A;  4BCB A;  2H9M A;  4XYI A;  3UVK A;  3I7K A;  4X3E A;  5HYN B;  3ZDZ B;  3ZE1 A;  1K8K C;  2XL3 A;  4L3G D;  5TEE A;  3EI1 B;  2GC4 A;  3I7N A;  3MMY A;  2H6N A;  3PSL A;  4ESG A;  1T2X A;  1PEV A;  3IUL A;  3BG0 A;  2UZY B;  2VDQ A;  3CFV A;  1B9Y A;  1JMZ B;  3UVM A;  5M5S A;  3PVW B;  1VE7 A;  4BP9 A;  4MK0 B;  2VDM A;  3EQ7 A;  5FKQ A;  4PNK B;  2H6Q A;  4Z7O A;  2YMU A;  1I2M B;  2P9K C;  2VDP A;  5E6S A;  3OW8 A;  5E6R A;  4E54 A;  4CI8 A;  3MXX A;  3UR4 A;  2B5L A;  3SCY A;  2AH0 A;  4DNU A;  4NEN A;  4WK2 A;  1QFS A;  3HFQ A;  5CXB B;  2MTA H;  1VZ2 A;  3CIK B;  3IUN A;  3OKY B;  4CY3 A;  1VE6 A;  3FGB A;  3NIG B;  2XZG A;  3FM0 A;  4G1M A;  5HQG A;  1YR2 A;  4CZY A;  1M1X A;  1U8C A;  3EI4 A;  3FCS A;  3JZN A;  4IRZ A;  3J80 g;  2OK6 A;  5AMS A;  3I8E A;  3RFG A;  2VDL B;  4K3J B;  1SHY B;  2J56 H;  3ZE2 A;  4BCD A;  5AJA A;  4A11 A;  3FRX A;  1K32 A;  3IIY A;  4AMZ A;  2PM9 B;  2CNX A;  4CY5 A;  3MKQ A;  4J86 A;  4JHN A;  2Q7Q A;  3A0F A;  3OL2 A;  2VDO A;  2I3T A;  3NVN A;  5FFO A;  2YB8 B;  5GXI A;  2J55 H;  1E8N A;  3MVD K;  5CYK A;  3SN6 B;  2UZX B;  2Z2P A;  2IWK A;  3C9C A;  2CE9 A;  5HE1 B;  3VH0 A;  3T3P B;  1SQJ A;  4WK4 B;  5IT9 g;  2H47 A;  2HJ4 A;  4QAM A;  2QC5 A;  5CXC A;  3SBP A;  4LGN A;  4O1Q D;  1S4U X;  1TYE B;  4N14 A;  2BBK H;  2XDW A;  4JT5 C;  5EMM B;  2OJY A;  3I8C A;  3FCU A;  5M5V A;  4FA5 D;  2QZP A;  4QT8 A;  3T3M B;  5SXM A;  4RE6 A;  4O3T B;  4R7A B;  5EML B;  2WQ8 A;  3IJ0 A;  1ERJ A;  1B9X A;  1N6F A;  2Z2N A;  4JSN C;  4DNW A;  3JAM g;  4GMB A;  4G55 A;  4UM9 B;  4MMZ A;  3RRM C;  4UM8 A;  1GOF A; 
#chains in the Genus database with same CATH homology
 4A08 B;  2IAA A;  2TRC B;  2Z2O A;  3OKT A;  4A0B A;  3JRO A;  3EU7 A;  4E5Z B;  4JSP C;  4CZV A;  5JWZ A;  2P9I C;  4Z7Q B;  3I7L A;  4BL0 A;  2AQ5 A;  1GOT B;  4PBZ A;  4J81 A;  5IGO A;  3W15 A;  5EM2 A;  5E6U B;  3OKW A;  4A09 B;  3NID B;  1XIP A;  3NVX A;  5TF2 A;  2H13 A;  1XKS A;  4QL1 A;  4J0W A;  2HKR A;  3I89 A;  1TYQ C;  2P9L C;  1N6D A;  2YBA A;  5GXH A;  4Y5R D;  3IJ1 A;  3PE7 A;  4GM9 A;  4ERY A;  3CFS B;  4PBY A;  3E0C A;  4A0A A;  5H14 A;  4AEZ A;  2XU7 A;  2YNO A;  3PVU B;  4ZOY A;  3DXM C;  2EBS A;  4WK0 B;  4I79 A;  3L4M D;  3BG1 A;  3UVO A;  3JPX A;  3L4O D;  1XHM A;  4JSV C;  3P4F A;  3EMH A;  4O9D A;  2XYI A;  5IJ8 E;  1OMW B;  4FA4 D;  3MKS B;  2P9U C;  4CC9 A;  5EAP A;  3SXT D;  3RN1 D;  1A0R B;  3B7F A;  3RSE C;  5C2V B;  3MZL A;  3ZDY B;  5TEF A;  4ERQ A;  2IUP A;  3VI4 B;  3EI3 B;  4J8B A;  3I7P A;  4CI2 A;  2H9P A;  3F3P A;  2IUR A;  4GM3 A;  5I5I A;  3JZH A;  5FA5 B;  3EI2 A;  4FAV D;  1QNI A;  1PBY B;  2J57 G;  1Q47 A;  2I3S A;  3OTT A;  5I5J A;  4J8G A;  4FA9 D;  3SVW D;  2CO0 A;  4OWR A;  5TDH B;  4JD2 C;  2W18 A;  4ZN4 A;  3ORV D;  3EG6 A;  3ZE1 B;  4GGD A;  3IKO A;  4E5Z A;  2G99 A;  2AGL A;  3PXT D;  2JWH A;  1MDA H;  3K26 A;  4JXM A;  2VDQ B;  5EAL A;  5IC7 A;  2YNN A;  1YUK A;  5H1M A;  2G9A A;  4CY1 A;  3V9F A;  5FXY A;  4Z7O B;  5A2Q g;  2IUQ A;  2VDP B;  1P22 A;  2H3X A;  5E6S B;  5FLX g;  1JMX B;  2P9S C;  5E6R B;  4E54 B;  3DM0 A;  5GMK n;  2HKM A;  3F3G A;  4CZX A;  4WK2 B;  1VYH C;  4L1Q D;  3AL8 B;  2BCJ B;  4CI3 A;  3EI1 A;  2AH1 A;  2AGY A;  2CE8 A;  5FKS A;  4OZU A;  1U8C B;  2O9K A;  2IUV A;  4XEI C;  4ZOX A;  4Y7R A;  1JOF A;  4FA1 D;  4CY2 A;  3AFC A;  3AL9 A;  2PM7 B;  4J0X A;  4FWW A;  4ZOZ A;  4BH6 A;  1N6E A;  3I7H A;  2P9P C;  4GM8 A;  4PC0 A;  3ZE2 B;  5FKT A;  4A11 B;  4ZOV A;  2JWG A;  1NEX B;  4A2M A;  1NR0 A;  3JRP A;  4U1E I;  4J87 A;  2VDO B;  3V5W B;  4JSX C;  5CXB A;  4FB1 D;  3K27 A;  4JT6 C;  4O3U B;  3J81 g;  2OVP B;  3OKY A;  5CYK B;  3NVQ A;  3JZG A;  3C5M A;  2AGW A;  3ODT A;  4XYH A;  3SWS D;  4L9O A;  5THA A;  2VDN B;  4UI9 R;  5CXC B;  1OLZ A;  4L3H D;  2H68 A;  5C9Z B;  3AH8 B;  3F3F A;  3I7O A;  1YFQ A;  2H6K A;  3FCU B;  1GXR A;  4LG8 A;  2HYE A;  2PM9 A;  4AOW A;  4NSX A;  2AGX A;  3DWL C;  3RMZ D;  3UKR C;  2H9L A;  4UM8 B;  2XL2 A;  5K1C C;  4GQB B;  1MG2 A;  3SFZ A;  4A0B B;  4U7A A;  5C2W B;  4J79 A;  4Z8L A;  2PBI B;  5IGQ A;  1U4C A;  3SBR A;  5HE2 B;  3V7D B;  5EM2 B;  4D0K A;  3DXK C;  1R5M A;  4FAN D;  2HXC A;  2OVR B;  1U2V C;  3IJC A;  5K19 A;  3KRX B;  3PXS D;  4QRJ A;  2CN2 A;  3I2N A;  3ULE C;  4H5J A;  5FKR A;  3EWE A;  4LG9 A;  5HE3 B;  2GC7 A;  3AL8 A;  4HDJ A;  2B5N A;  4YVD A;  4A08 A;  4A0A B;  4X63 B;  1TBG A;  1MG3 A;  3SHF A;  3UVN A;  5GSA A;  4J84 A;  3PXW D;  3KRW B;  5HDB B;  3VI3 B;  4WJK B;  3DSM A;  4ES0 A;  2I0S A;  3NIF B;  3VA6 A;  3C75 H;  3GRE A;  4J73 A;  4X61 B;  4A09 A;  2B5M A;  1SSL A;  1FWX A;  4PXW A;  2VDM B;  2YNP A;  3UVL A;  1SQ9 A;  5IJ7 E;  2VC2 B;  2HJB A;  4D6V A;  4G56 B;  4UM9 D;  1PGU A;  4QQE A;  3N0E A;  5EAM A;  3MZK A;  4TZ4 A;  2H9N A;  4A2L A;  4GQ1 A;  3SLE D;  4GQ2 P;  3BWS A;  3SMR A;  4ERZ A;  2VDR B;  4CI1 A;  4FHL A;  4PSW B;  5HE0 B;  5EAR A;  4GGA A;  4Z7N B;  1PI6 A;  3PSC B;  2I0T A;  2P28 A;  2AGZ A;  4J82 A;  5AFU 3;  2B4E A;  3EI2 B;  3EI4 B;  2I0R A;  5I5M A;  4KFM B;  2CN3 A;  3GFC A;  3SBQ A;  2GNQ A;  3IIW A;  4X60 B;  5EMK B;  5H17 A;  1GG2 B;  4EWR A;  2CO0 C;  5B4W A;  2OK4 A;  4A7J A;  1JJU B;  3RFH A;  3U4Y A;  4BUJ C;  5FQD A;  2OVQ B;  5KDO B;  4K3I D;  4O45 A;  2HES X;  3OL2 B;  3EI3 A;  4GGC A;  3VGZ A;  2H14 A;  4IMM A;  3SJL D;  2IWF A;  2P9N C;  1GP2 B;  3UKU C;  3RLM D;  4PSX B;  3RN0 D;  1L0Q A;  4J78 A;  3N0D A;  2P26 A;  3C99 A;  2QXV A;  4GZ8 A;  2VDK B;  3ZDX B;  4J77 A;  5EMJ B;  3ZE0 B;  3JB9 L;  3ZWL B;  2PM6 B;  1RI6 A;  4H5I A;  2OIZ A;  4IA9 A;  2H9M A;  4XYI A;  3UVK A;  3I7K A;  4X3E A;  5HYN B;  3ZDZ B;  1K8K C;  2XL3 A;  4L3G D;  5TEE A;  3EI1 B;  2GC4 A;  3I7N A;  3MMY A;  2H6N A;  3PSL A;  4ESG A;  1PEV A;  3BG0 A;  2UZY B;  3CFV A;  1B9Y A;  1JMZ B;  3UVM A;  3PVW B;  4MK0 B;  5FKQ A;  4PNK B;  2H6Q A;  2YMU A;  2P9K C;  3OW8 A;  4E54 A;  4CI8 A;  3MXX A;  3UR4 A;  2B5L A;  3SCY A;  2AH0 A;  3HFQ A;  5CXB B;  2MTA H;  3CIK B;  3OKY B;  4CY3 A;  3FGB A;  3NIG B;  3FM0 A;  5HQG A;  4CZY A;  3JZN A;  3EI4 A;  3J80 g;  2OK6 A;  5AMS A;  3I8E A;  3RFG A;  2VDL B;  4K3J B;  1SHY B;  2J56 H;  5AJA A;  4A11 A;  3FRX A;  1K32 A;  3IIY A;  2PM9 B;  2CNX A;  4CY5 A;  3MKQ A;  4J86 A;  2Q7Q A;  3A0F A;  3OL2 A;  2I3T A;  3NVN A;  2YB8 B;  5GXI A;  2J55 H;  5CYK A;  3SN6 B;  2UZX B;  2Z2P A;  2IWK A;  3C9C A;  2CE9 A;  5HE1 B;  3VH0 A;  3T3P B;  1SQJ A;  4WK4 B;  5IT9 g;  2H47 A;  2HJ4 A;  2QC5 A;  5CXC A;  3SBP A;  4LGN A;  4O1Q D;  1S4U X;  1TYE B;  4N14 A;  2BBK H;  4JT5 C;  5EMM B;  2OJY A;  3I8C A;  4FA5 D;  4QT8 A;  3T3M B;  5SXM A;  4O3T B;  4R7A B;  5EML B;  3IJ0 A;  1ERJ A;  1B9X A;  1N6F A;  2Z2N A;  4JSN C;  4UM9 B;  3JAM g;  4GMB A;  3RRM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...