2HKMA

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with phenylethylamine.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
molecule tags Oxidoreductase
total genus 95
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hkmA01
3FM0A 4ZOXA 3AFCA 3FRXA 4BH6A 2P9NC 3EI1B 5TEEA 2I3SA 4FHLA 4A08A 4PSWB 5EAPA 4OWRA 3W15A 2I3TA 2PM9A 5H17A 3RSEC 3MMYA 5A2Qg 3VA6A 3B7FA 4BUJC 2CN2A 1B9XA 2HJ4A 3SMRA 2GC7A 1GXRA 4A09A 4K3ID 3PVUB 3C99A 4GQ1A 1SQ9A 4A11A 5I5IA 2MTAH 4ZOYA 2OK4A 3AL8B 3SHFA 1A0RB 3JZGA 3NVQA 4Z8LA 1K8KC 4GM8A 4Y5RD 5AFU3 3PXTD 5HYNB 5EM2B 3EU7A 4JSVC 2UZXB 2YMUA 4G56B 5B4WA 5HQGA 1XIPA 4A0BA 4CZYA 3V5WB 3KRWB 4U7AA 5GXIA 2CE9A 2AGXA 2O9KA 3I7LA 5AJAA 1K32A 2CN3A 1R5MA 2XL2A 3OKWA 5FLXg 3MZLA 3SN6B 5GXHA 3IJ0A 5K19A 4L3HD 1N6EA 2PM7B 5IJ7E 4GMBA 4CI2A 3EI1A 3EWEA 3JPXA 3C75H 4OZUA 4LGNA 3HFQA 3I7NA 5FQDA 3F3FA 3K27A 5KDOB 2GNQA 3L4OD 4CI3A 5EAMA 3UR4A 4A7JA 1JOFA 5CYKB 4L1QD 3CFVA 2H9MA 3E0CA 4GQ2P 3JAMg 3JROA 3AL8A 4FA1D 2BBKH 4PBYA 3JB9L 3P4FA 4X3EA 4CC9A 4K3JB 4ES0A 4CI1A 5FKRA 1MDAH 4JT5C 3SBRA 2HJBA 5EM2A 1GP2B 3MZKA 4UI9R 3VH0A 2H6QA 2AH1A 2H14A 4FB1D 5IGOA 4MK0B 4H5JA 2OVPB 1QNIA 3OKTA 4L3GD 4NSXA 3EI3B 3ODTA 3RFGA 3GFCA 3F3PA 4O45A 3BWSA 3OW8A 2I0SA 5C2VB 3EI4B 1JJUB 4J8GA 3RMZD 3V7DB 3JZNA 3I7HA 2G99A 2Z2NA 3OKYB 4A2MA 3U4YA 3DSMA 2CO0C 4J82A 4JSXC 1PGUA 1U4CA 3VGZA 4D6VA 4CZXA 2QC5A 5C9ZB 5CYKA 5GMKn 1MG3A 2P9SC 3PE7A 4ESGA 3SBQA 3PXSD 4D0KA 5C2WB 2CE8A 3SXTD 4AOWA 1RI6A 2YNPA 4J73A 3F3GA 2AGWA 3UVLA 4ERZA 3MXXA 4CY2A 4J77A 1PI6A 2YNNA 3I2NA 3UKUC 3RLMD 4GM3A 4XYHA 1S4UX 3L4MD 4ZN4A 4PBZA 3KRXB 1VYHC 3EI3A 4IMMA 5CXCB 5EMKB 4J78A 4QT8A 2UZYB 2J56H 5HE1B 4CY1A 2Z2PA 3ULEC 3DM0A 2H68A 1JMZB 1OMWB 3EI4A 4TZ4A 5CXBB 3OKYA 4Y7RA 2G9AA 3I8EA 3JZHA 5FKQA 4BL0A 4J87A 3OTTA 3JRPA 2H9PA 4E54B 2HKRA 3IIWA 3CFSB 1FWXA 2H13A 1TYQC 1U2VC 5TF2A 3RN1D 2OIZA 4FA4D 2AGYA 3J81g 1NR0A 4CI8A 1MG2A 2XL3A 2XU7A 4O3UB 4J79A 5FKTA 2HYEA 2Q7QA 2XYIA 4GGDA 4X60B 5EALA 3SWSD 2B5LA 5CXCA 1XKSA 2GC4A 3N0EA 3PXWD 5IC7A 3K26A 3RRMC 3I7OA 4J0WA 1SQJA 3N0DA 4X63B 4CY3A 5CXBA 4J0XA 5THAA 2H47A 4A0AB 4J84A 1YFQA 2IWKA 5I5JA 2YNOA 5HE0B 5FA5B 2IUVA 4LG8A 2H6KA 2YBAA 5TEFA 3SJLD 4E54A 2P9LC 5IJ8E 3I89A 3UVNA 3EMHA 4X61B 4FA9D 3RN0D 5FKSA 4QL1A 5JWZA 1PEVA 2OVRB 4N14A 2TRCB 4PSXB 2H9LA 4JD2C 5FXYA 3ORVD 2IURA 3DWLC 4A2LA 2J57G 3EG6A 1L0QA 4GGCA 3OL2B 3SCYA 4FWWA 4E5ZB 4U1EI 3MKQA 1SHYB 3DXKC 3UVKA 4JSPC 3SFZA 2I0RA 4GGAA 3DXMC 5EMMB 5HE3B 2EBSA 2CNXA 3IIYA 2AH0A 2B4EA 5EARA 4HDJA 3A0FA 3MKSB 1Q47A 2OJYA 2Z2OA 1GG2B 4PC0A 2IAAA 3BG1A 4O3TB 4J86A 3NVNA 5EMLB 3V9FA 5I5MA 2YB8B 4O1QD 4A0AA 2H9NA 2HKMA 3BG0A 4QRJA 3I7PA 4GM9A 3PVWB 3PSCB 4JT6C 3EI2A 5TDHB 4QQEA 3C5MA 4JXMA 2B5MA 1ERJA 4FAND 2QXVA 1JMXB 5AMSA 2P9IC 1TBGA 3FGBA 2J55H 3I8CA 5IGQA 4AEZA 3I7KA 2OVQB 2H3XA 2HESX 4FA5D 4L9OA 4EWRA 1N6DA 3PSLA 4CZVA 2IUPA 3SBPA 3SVWD 1OLZA 2P9PC 2PBIB 2AQ5A 3UVOA 3AH8B 3OL2A 4GQBB 2PM6B 2I0TA 4E5ZA 4XEIC 4R7AB 4CY5A 4O9DA 5IT9g 1P22A 4XYIA 5EMJB 5HE2B 3RFHA 2CO0A 2AGLA 2H6NA 4A08B 1B9YA 2BCJB 4IA9A 4FAVD 2PM9B 2W18A 1GOTB 2OK6A 4GZ8A 4JSNC 5H14A 2IWFA 3SLED 4YVDA 5H1MA 5GSAA 4A09B 5SXMA 4I79A 2P9KC 4J8BA 1NEXB 3CIKB 1XHMA 4A11B 2AGZA 3UVMA 3IKOA 2P9UC 3GREA 4H5IA 2HXCA 3AL9A 3J80g 3IJ1A 3NVXA 3EI2B 4ERQA 4ZOVA 5K1CC 1N6FA 1PBYB 4PXWA 3IJCA 2IUQA 4J81A 4KFMB 3ZWLB 4A0BB 3C9CA 4ERYA 2B5NA 3UKRC 4LG9A 4PNKB 4ZOZA
chains in the Genus database with same CATH superfamily
3FM0A 4ZOXA 3AFCA 4NC4A 4MMZA 3FRXA 4BH6A 4RE6A 2P9NC 3EI1B 5TEEA 2BKLA 2I3SA 4FHLA 4A08A 4PSWB 5EAPA 4OWRA 3W15A 2I3TA 2PM9A 1L5GA 5H17A 3K71A 3QHYB 3RSEC 3MMYA 5A2Qg 1UOPA 3VA6A 3B7FA 4WK4A 4BUJC 2CN2A 1B9XA 2HJ4A 3SMRA 2GC7A 1GXRA 4A09A 4K3ID 3VI3A 3MVDK 1E8NA 3PVUB 3C99A 4GQ1A 1H2ZA 1SQ9A 4A11A 5I5IA 2EIBA 2MTAH 4ZOYA 2OK4A 3AL8B 3SHFA 1A0RB 3JZGA 3NVQA 4D9SA 4AX4A 4Z8LA 1K8KC 4GM8A 4Z7OA 4Y5RD 5AFU3 3PXTD 5HYNB 4G1MA 5EM2B 3EU7A 4JSVC 2UZXB 2YMUA 4G56B 1GOFA 5B4WA 5HQGA 5HDBA 3MUNA 1XIPA 4A0BA 2VDOA 4CZYA 3V5WB 2VDQA 3NIFA 3KRWB 4U7AA 5GXIA 4NBMA 4DNUA 2CE9A 2AGXA 1VZ2A 2O9KA 3I7LA 5AJAA 1K32A 2CN3A 1R5MA 2XL2A 3IVMA 3OKWA 5M61A 5FLXg 3MZLA 3SN6B 4DNVA 5GXHA 3IJ0A 5K19A 4L3HD 4AMZA 1N6EA 4G1EA 1T2XA 2PM7B 5IJ7E 4GMBA 4CI2A 3EI1A 3EWEA 1E8MA 3JPXA 3C75H 4JHNA 4OZUA 4LGNA 3HFQA 3I7NA 5FQDA 3F3FA 3K27A 5KDOB 2GNQA 3T3MA 1E5TA 3L4OD 4CI3A 5EAMA 3UR4A 1VE6A 2XZGA 4A7JA 3IUJA 5E6UA 1JOFA 3VI4A 5CYKB 4L1QD 3CFVA 2H9MA 1JTDB 3E0CA 4GQ2P 3JAMg 3JROA 3AL8A 4FA1D 2BBKH 4PBYA 3JB9L 3P4FA 4X3EA 4CC9A 4K3JB 4ES0A 4CI1A 3IURA 5FKRA 1MDAH 4IRZA 4JT5C 2VZ1A 3SBRA 2HJBA 5EM2A 1GP2B 1UOOA 3MZKA 2VDKA 3IUQA 1K3IA 4UI9R 3VH0A 4JHPC 2H6QA 2AH1A 2H14A 4FB1D 5IGOA 4MK0B 4H5JA 2OVPB 4Z7QA 1QNIA 4BP8A 5M5RA 3OKTA 4L3GD 4NSXA 3EI3B 3ZDZA 3ODTA 4DNWA 3RFGA 3GFCA 3F3PA 4O45A 3BWSA 3OW8A 2I0SA 5C2VB 3EI4B 1JJUB 4J8GA 3RMZD 3V7DB 3JZNA 3I7HA 3EQ8A 2G99A 2Z2NA 3OKYB 4A2MA 3U4YA 3DSMA 2CO0C 2VDPA 4J82A 3V4VA 4JSXC 1PGUA 4BCBA 1U4CA 3VGZA 4D6VA 3ZE2A 4CZXA 2QC5A 3O4GA 3EQ7A 5C9ZB 5CYKA 5GMKn 1MG3A 2P9SC 3PE7A 4ESGA 4NAAA 1M1XA 3SBQA 3PXSD 4D0KA 5C2WB 2CE8A 3SXTD 1C9LA 4AOWA 1RI6A 2YNPA 3O4HA 4J73A 1O6GA 3F3GA 2AGWA 3UVLA 4ERZA 3MXXA 4CY2A 4J77A 1PI6A 2YNNA 3DDUA 3I2NA 3UKUC 3RLMD 4GM3A 4XYHA 1S4UX 3L4MD 3ZE0A 4ZN4A 1C9IA 4PBZA 3KRXB 1VYHC 3EI3A 4IMMA 5CXCB 5EMKB 1H2WA 4J78A 4QT8A 2UZYB 2J56H 5HE1B 4CY1A 2Z2PA 3ULEC 3DM0A 2H68A 1JMZB 1OMWB 3EQ9A 3EI4A 4TZ4A 3ZDXA 5CXBB 3OKYA 3NIDA 4Y7RA 2G9AA 3I8EA 3JZHA 5FKQA 4BL0A 4J87A 3OTTA 3JRPA 2HU5A 2H9PA 4E54B 2HKRA 3IIWA 3CFSB 1FWXA 2VC2A 1GOHA 2H13A 1TYQC 1U2VC 4WK2A 5TF2A 3RN1D 2OIZA 4FA4D 3MUOA 2AGYA 3J81g 3KCIA 2EICA 3NIGA 4WJKA 1NR0A 2VDLA 4CI8A 3K72A 1MG2A 2EIDA 2XL3A 1H2YA 2XU7A 4NENA 1UTCA 4O3UB 3ZE1A 3IUMA 3OF7A 4J79A 5FKTA 2HYEA 2Q7QA 1YR2A 2XYIA 4GGDA 4X60B 5EALA 3SWSD 2B5LA 5M5VA 5CXCA 1XKSA 2GC4A 3N0EA 4UM9A 4BCDA 3PXWD 1UOQA 5IC7A 3K26A 3RRMC 3I7OA 4J0WA 1SQJA 3N0DA 4X63B 4CY3A 5C86A 1QFMA 5CXBA 4J0XA 5THAA 2H47A 4A0AB 4J84A 1U8CA 1YFQA 2IWKA 2QR5A 5I5JA 1JV2A 2YNOA 5HE0B 5FA5B 2IUVA 2H6KA 4LG8A 2YBAA 5E6RA 5TEFA 3SJLD 4BCCA 4E54A 5M5SA 2P9LC 5IJ8E 3I89A 3UVNA 3EMHA 4X61B 4FA9D 3RN0D 5FKSA 4RE5A 4QL1A 5JWZA 1PEVA 2OVRB 3QI0A 4N14A 2TRCB 4PSXB 2H9LA 4JD2C 5FXYA 3ORVD 3V4PA 2IURA 3DWLC 4A2LA 2J57G 3EG6A 3O4IA 2VDRA 1L0QA 4GGCA 5E6SA 3IJEA 3OL2B 3SCYA 4FWWA 4E5ZB 3FCSA 4U1EI 3ZDYA 3MKQA 1SHYB 3DXKC 3UVKA 4JSPC 3SFZA 2I0RA 4GGAA 3DXMC 5EMMB 5HE3B 2EBSA 2CNXA 3IIYA 5FFGA 2AH0A 2B4EA 5EARA 4HDJA 3A0FA 3O4JA 3MKSB 1Q47A 4AMYA 2OJYA 2Z2OA 1GG2B 4PC0A 2IAAA 2VDNA 3BG1A 4J86A 4L1MA 3NVNA 4O3TB 4MMXA 5EMLB 3V9FA 5I5MA 2YB8B 4O1QD 4A0AA 2H9NA 2HKMA 3BG0A 4QRJA 3I7PA 4GM9A 3PVWB 3PSCB 4JT6C 3EI2A 5TDHB 4QQEA 3C5MA 4WK0A 4AN0A 4JXMA 2B5MA 1ERJA 4FAND 2QXVA 1O6FA 4MMYA 1JMXB 5AMSA 2P9IC 3FCUA 1I2MB 4QAMA 1TBGA 3FGBA 2J55H 3I8CA 5IGQA 4AEZA 3I7KA 2OVQB 2XE4A 2H3XA 2QZPA 5C92A 2HESX 4FA5D 4L9OA 4EWRA 1N6DA 3PSLA 4CZVA 3GD1I 2IUPA 3SBPA 3SVWD 1OLZA 2P9PC 2PBIB 2AQ5A 3UVOA 3AH8B 3OL2A 4GQBB 2PM6B 2I0TA 3K6SA 4E5ZA 4UM8A 1VZ3A 4XEIC 4R7AB 4CY5A 4O9DA 5IT9g 5M5UA 1TYEA 4BP9A 1P22A 4XYIA 5EMJB 5HE2B 4Z7NA 3RFHA 2CO0A 2AGLA 3IUNA 2H6NA 4A08B 1H2XA 1B9YA 3GC3B 2BCJB 4IA9A 4FAVD 2PM9B 2W18A 1GOTB 2OK6A 4GZ8A 2XDWA 4JSNC 5H14A 2IWFA 4G55A 3SLED 4YVDA 5H1MA 5M5TA 1QFSA 5GSAA 2HU8A 4O02A 2JKXA 4A09B 5SXMA 4I79A 3T3PA 2HU7A 2P9KC 4J8BA 1NEXB 1GOGA 3CIKB 2EIEA 1A12A 1XHMA 4A11B 1BPOA 2AGZA 3UVMA 3IKOA 2P9UC 4AN1A 3GREA 4H5IA 2WQ8A 2HXCA 3AL9A 3J80g 3IJ1A 3NVXA 3EI2B 4O2WA 4ERQA 4ZOVA 5K1CC 1N6FA 1PBYB 4PXWA 3IJCA 2IUQA 3IULA 2VDMA 4J81A 4KFMB 3ZWLB 4A0BB 5FFOA 3C9CA 4ERYA 2VZ3A 2B5NA 3UKRC 4LG9A 4PNKB 1VE7A 4ZOZA
chains in the Genus database with same CATH topology
3FM0A 4ZOXA 3AFCA 3FRXA 4BH6A 2P9NC 3EI1B 5TEEA 2I3SA 4FHLA 4A08A 4PSWB 5EAPA 4OWRA 3W15A 2I3TA 2PM9A 5H17A 3RSEC 3MMYA 5A2Qg 3VA6A 3B7FA 4BUJC 2CN2A 1B9XA 2HJ4A 3SMRA 2GC7A 1GXRA 4A09A 4K3ID 3PVUB 3C99A 4GQ1A 1SQ9A 4A11A 5I5IA 2MTAH 4ZOYA 2OK4A 3AL8B 3SHFA 1A0RB 3JZGA 3NVQA 4Z8LA 1K8KC 4GM8A 4Y5RD 5AFU3 3PXTD 5HYNB 5EM2B 3EU7A 4JSVC 2UZXB 2YMUA 4G56B 5B4WA 5HQGA 1XIPA 4A0BA 4CZYA 3V5WB 3KRWB 4U7AA 5GXIA 2CE9A 2AGXA 2O9KA 3I7LA 5AJAA 1K32A 2CN3A 1R5MA 2XL2A 3OKWA 5FLXg 3MZLA 3SN6B 5GXHA 3IJ0A 5K19A 4L3HD 1N6EA 2PM7B 5IJ7E 4GMBA 4CI2A 3EI1A 3EWEA 3JPXA 3C75H 4OZUA 4LGNA 3HFQA 3I7NA 5FQDA 3F3FA 3K27A 5KDOB 2GNQA 3L4OD 4CI3A 5EAMA 3UR4A 4A7JA 1JOFA 5CYKB 4L1QD 3CFVA 2H9MA 3E0CA 4GQ2P 3JAMg 3JROA 3AL8A 4FA1D 2BBKH 4PBYA 3JB9L 3P4FA 4X3EA 4CC9A 4K3JB 4ES0A 4CI1A 5FKRA 1MDAH 4JT5C 3SBRA 2HJBA 5EM2A 1GP2B 3MZKA 4UI9R 3VH0A 2H6QA 2AH1A 2H14A 4FB1D 5IGOA 4MK0B 4H5JA 2OVPB 1QNIA 3OKTA 4L3GD 4NSXA 3EI3B 3ODTA 3RFGA 3GFCA 3F3PA 4O45A 3BWSA 3OW8A 2I0SA 5C2VB 3EI4B 1JJUB 4J8GA 3RMZD 3V7DB 3JZNA 3I7HA 2G99A 2Z2NA 3OKYB 4A2MA 3U4YA 3DSMA 2CO0C 4J82A 4JSXC 1PGUA 1U4CA 3VGZA 4D6VA 4CZXA 2QC5A 5C9ZB 5CYKA 5GMKn 1MG3A 2P9SC 3PE7A 4ESGA 3SBQA 3PXSD 4D0KA 5C2WB 2CE8A 3SXTD 4AOWA 1RI6A 2YNPA 4J73A 3F3GA 2AGWA 3UVLA 4ERZA 3MXXA 4CY2A 4J77A 1PI6A 2YNNA 3I2NA 3UKUC 3RLMD 4GM3A 4XYHA 1S4UX 3L4MD 4ZN4A 4PBZA 3KRXB 1VYHC 3EI3A 4IMMA 5CXCB 5EMKB 4J78A 4QT8A 2UZYB 2J56H 5HE1B 4CY1A 2Z2PA 3ULEC 3DM0A 2H68A 1JMZB 1OMWB 3EI4A 4TZ4A 5CXBB 3OKYA 4Y7RA 2G9AA 3I8EA 3JZHA 5FKQA 4BL0A 4J87A 3OTTA 3JRPA 2H9PA 4E54B 2HKRA 3IIWA 3CFSB 1FWXA 2H13A 1TYQC 1U2VC 5TF2A 3RN1D 2OIZA 4FA4D 2AGYA 3J81g 1NR0A 4CI8A 1MG2A 2XL3A 2XU7A 4O3UB 4J79A 5FKTA 2HYEA 2Q7QA 2XYIA 4GGDA 4X60B 5EALA 3SWSD 2B5LA 5CXCA 1XKSA 2GC4A 3N0EA 3PXWD 5IC7A 3K26A 3RRMC 3I7OA 4J0WA 1SQJA 3N0DA 4X63B 4CY3A 5CXBA 4J0XA 5THAA 2H47A 4A0AB 4J84A 1YFQA 2IWKA 5I5JA 2YNOA 5HE0B 5FA5B 2IUVA 4LG8A 2H6KA 2YBAA 5TEFA 3SJLD 4E54A 2P9LC 5IJ8E 3I89A 3UVNA 3EMHA 4X61B 4FA9D 3RN0D 5FKSA 4QL1A 5JWZA 1PEVA 2OVRB 4N14A 2TRCB 4PSXB 2H9LA 4JD2C 5FXYA 3ORVD 2IURA 3DWLC 4A2LA 2J57G 3EG6A 1L0QA 4GGCA 3OL2B 3SCYA 4FWWA 4E5ZB 4U1EI 3MKQA 1SHYB 3DXKC 3UVKA 4JSPC 3SFZA 2I0RA 4GGAA 3DXMC 5EMMB 5HE3B 2EBSA 2CNXA 3IIYA 2AH0A 2B4EA 5EARA 4HDJA 3A0FA 3MKSB 1Q47A 2OJYA 2Z2OA 1GG2B 4PC0A 2IAAA 3BG1A 4O3TB 4J86A 3NVNA 5EMLB 3V9FA 5I5MA 2YB8B 4O1QD 4A0AA 2H9NA 2HKMA 3BG0A 4QRJA 3I7PA 4GM9A 3PVWB 3PSCB 4JT6C 3EI2A 5TDHB 4QQEA 3C5MA 4JXMA 2B5MA 1ERJA 4FAND 2QXVA 1JMXB 5AMSA 2P9IC 1TBGA 3FGBA 2J55H 3I8CA 5IGQA 4AEZA 3I7KA 2OVQB 2H3XA 2HESX 4FA5D 4L9OA 4EWRA 1N6DA 3PSLA 4CZVA 2IUPA 3SBPA 3SVWD 1OLZA 2P9PC 2PBIB 2AQ5A 3UVOA 3AH8B 3OL2A 4GQBB 2PM6B 2I0TA 4E5ZA 4XEIC 4R7AB 4CY5A 4O9DA 5IT9g 1P22A 4XYIA 5EMJB 5HE2B 3RFHA 2CO0A 2AGLA 2H6NA 4A08B 1B9YA 2BCJB 4IA9A 4FAVD 2PM9B 2W18A 1GOTB 2OK6A 4GZ8A 4JSNC 5H14A 2IWFA 3SLED 4YVDA 5H1MA 5GSAA 4A09B 5SXMA 4I79A 2P9KC 4J8BA 1NEXB 3CIKB 1XHMA 4A11B 2AGZA 3UVMA 3IKOA 2P9UC 3GREA 4H5IA 2HXCA 3AL9A 3J80g 3IJ1A 3NVXA 3EI2B 4ERQA 4ZOVA 5K1CC 1N6FA 1PBYB 4PXWA 3IJCA 2IUQA 4J81A 4KFMB 3ZWLB 4A0BB 3C9CA 4ERYA 2B5NA 3UKRC 4LG9A 4PNKB 4ZOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM0 A;  4ZOX A;  3AFC A;  3FRX A;  4BH6 A;  2P9N C;  3EI1 B;  5TEE A;  2I3S A;  4FHL A;  4A08 A;  4PSW B;  5EAP A;  4OWR A;  3W15 A;  2I3T A;  2PM9 A;  5H17 A;  3RSE C;  3MMY A;  5A2Q g;  3VA6 A;  3B7F A;  4BUJ C;  2CN2 A;  1B9X A;  2HJ4 A;  3SMR A;  2GC7 A;  1GXR A;  4A09 A;  4K3I D;  3PVU B;  3C99 A;  4GQ1 A;  1SQ9 A;  4A11 A;  5I5I A;  2MTA H;  4ZOY A;  2OK4 A;  3AL8 B;  3SHF A;  1A0R B;  3JZG A;  3NVQ A;  4Z8L A;  1K8K C;  4GM8 A;  4Y5R D;  5AFU 3;  3PXT D;  5HYN B;  5EM2 B;  3EU7 A;  4JSV C;  2UZX B;  2YMU A;  4G56 B;  5B4W A;  5HQG A;  1XIP A;  4A0B A;  4CZY A;  3V5W B;  3KRW B;  4U7A A;  5GXI A;  2CE9 A;  2AGX A;  2O9K A;  3I7L A;  5AJA A;  1K32 A;  2CN3 A;  1R5M A;  2XL2 A;  3OKW A;  5FLX g;  3MZL A;  3SN6 B;  5GXH A;  3IJ0 A;  5K19 A;  4L3H D;  1N6E A;  2PM7 B;  5IJ7 E;  4GMB A;  4CI2 A;  3EI1 A;  3EWE A;  3JPX A;  3C75 H;  4OZU A;  4LGN A;  3HFQ A;  3I7N A;  5FQD A;  3F3F A;  3K27 A;  5KDO B;  2GNQ A;  3L4O D;  4CI3 A;  5EAM A;  3UR4 A;  4A7J A;  1JOF A;  5CYK B;  4L1Q D;  3CFV A;  2H9M A;  3E0C A;  4GQ2 P;  3JAM g;  3JRO A;  3AL8 A;  4FA1 D;  2BBK H;  4PBY A;  3JB9 L;  3P4F A;  4X3E A;  4CC9 A;  4K3J B;  4ES0 A;  4CI1 A;  5FKR A;  1MDA H;  4JT5 C;  3SBR A;  2HJB A;  5EM2 A;  1GP2 B;  3MZK A;  4UI9 R;  3VH0 A;  2H6Q A;  2AH1 A;  2H14 A;  4FB1 D;  5IGO A;  4MK0 B;  4H5J A;  2OVP B;  1QNI A;  3OKT A;  4L3G D;  4NSX A;  3EI3 B;  3ODT A;  3RFG A;  3GFC A;  3F3P A;  4O45 A;  3BWS A;  3OW8 A;  2I0S A;  5C2V B;  3EI4 B;  1JJU B;  4J8G A;  3RMZ D;  3V7D B;  3JZN A;  3I7H A;  2G99 A;  2Z2N A;  3OKY B;  4A2M A;  3U4Y A;  3DSM A;  2CO0 C;  4J82 A;  4JSX C;  1PGU A;  1U4C A;  3VGZ A;  4D6V A;  4CZX A;  2QC5 A;  5C9Z B;  5CYK A;  5GMK n;  1MG3 A;  2P9S C;  3PE7 A;  4ESG A;  3SBQ A;  3PXS D;  4D0K A;  5C2W B;  2CE8 A;  3SXT D;  4AOW A;  1RI6 A;  2YNP A;  4J73 A;  3F3G A;  2AGW A;  3UVL A;  4ERZ A;  3MXX A;  4CY2 A;  4J77 A;  1PI6 A;  2YNN A;  3I2N A;  3UKU C;  3RLM D;  4GM3 A;  4XYH A;  1S4U X;  3L4M D;  4ZN4 A;  4PBZ A;  3KRX B;  1VYH C;  3EI3 A;  4IMM A;  5CXC B;  5EMK B;  4J78 A;  4QT8 A;  2UZY B;  2J56 H;  5HE1 B;  4CY1 A;  2Z2P A;  3ULE C;  3DM0 A;  2H68 A;  1JMZ B;  1OMW B;  3EI4 A;  4TZ4 A;  5CXB B;  3OKY A;  4Y7R A;  2G9A A;  3I8E A;  3JZH A;  5FKQ A;  4BL0 A;  4J87 A;  3OTT A;  3JRP A;  2H9P A;  4E54 B;  2HKR A;  3IIW A;  3CFS B;  1FWX A;  2H13 A;  1TYQ C;  1U2V C;  5TF2 A;  3RN1 D;  2OIZ A;  4FA4 D;  2AGY A;  3J81 g;  1NR0 A;  4CI8 A;  1MG2 A;  2XL3 A;  2XU7 A;  4O3U B;  4J79 A;  5FKT A;  2HYE A;  2Q7Q A;  2XYI A;  4GGD A;  4X60 B;  5EAL A;  3SWS D;  2B5L A;  5CXC A;  1XKS A;  2GC4 A;  3N0E A;  3PXW D;  5IC7 A;  3K26 A;  3RRM C;  3I7O A;  4J0W A;  1SQJ A;  3N0D A;  4X63 B;  4CY3 A;  5CXB A;  4J0X A;  5THA A;  2H47 A;  4A0A B;  4J84 A;  1YFQ A;  2IWK A;  5I5J A;  2YNO A;  5HE0 B;  5FA5 B;  2IUV A;  4LG8 A;  2H6K A;  2YBA A;  5TEF A;  3SJL D;  4E54 A;  2P9L C;  5IJ8 E;  3I89 A;  3UVN A;  3EMH A;  4X61 B;  4FA9 D;  3RN0 D;  5FKS A;  4QL1 A;  5JWZ A;  1PEV A;  2OVR B;  4N14 A;  2TRC B;  4PSX B;  2H9L A;  4JD2 C;  5FXY A;  3ORV D;  2IUR A;  3DWL C;  4A2L A;  2J57 G;  3EG6 A;  1L0Q A;  4GGC A;  3OL2 B;  3SCY A;  4FWW A;  4E5Z B;  4U1E I;  3MKQ A;  1SHY B;  3DXK C;  3UVK A;  4JSP C;  3SFZ A;  2I0R A;  4GGA A;  3DXM C;  5EMM B;  5HE3 B;  2EBS A;  2CNX A;  3IIY A;  2AH0 A;  2B4E A;  5EAR A;  4HDJ A;  3A0F A;  3MKS B;  1Q47 A;  2OJY A;  2Z2O A;  1GG2 B;  4PC0 A;  2IAA A;  3BG1 A;  4O3T B;  4J86 A;  3NVN A;  5EML B;  3V9F A;  5I5M A;  2YB8 B;  4O1Q D;  4A0A A;  2H9N A;  2HKM A;  3BG0 A;  4QRJ A;  3I7P A;  4GM9 A;  3PVW B;  3PSC B;  4JT6 C;  3EI2 A;  5TDH B;  4QQE A;  3C5M A;  4JXM A;  2B5M A;  1ERJ A;  4FAN D;  2QXV A;  1JMX B;  5AMS A;  2P9I C;  1TBG A;  3FGB A;  2J55 H;  3I8C A;  5IGQ A;  4AEZ A;  3I7K A;  2OVQ B;  2H3X A;  2HES X;  4FA5 D;  4L9O A;  4EWR A;  1N6D A;  3PSL A;  4CZV A;  2IUP A;  3SBP A;  3SVW D;  1OLZ A;  2P9P C;  2PBI B;  2AQ5 A;  3UVO A;  3AH8 B;  3OL2 A;  4GQB B;  2PM6 B;  2I0T A;  4E5Z A;  4XEI C;  4R7A B;  4CY5 A;  4O9D A;  5IT9 g;  1P22 A;  4XYI A;  5EMJ B;  5HE2 B;  3RFH A;  2CO0 A;  2AGL A;  2H6N A;  4A08 B;  1B9Y A;  2BCJ B;  4IA9 A;  4FAV D;  2PM9 B;  2W18 A;  1GOT B;  2OK6 A;  4GZ8 A;  4JSN C;  5H14 A;  2IWF A;  3SLE D;  4YVD A;  5H1M A;  5GSA A;  4A09 B;  5SXM A;  4I79 A;  2P9K C;  4J8B A;  1NEX B;  3CIK B;  1XHM A;  4A11 B;  2AGZ A;  3UVM A;  3IKO A;  2P9U C;  3GRE A;  4H5I A;  2HXC A;  3AL9 A;  3J80 g;  3IJ1 A;  3NVX A;  3EI2 B;  4ERQ A;  4ZOV A;  5K1C C;  1N6F A;  1PBY B;  4PXW A;  3IJC A;  2IUQ A;  4J81 A;  4KFM B;  3ZWL B;  4A0B B;  3C9C A;  4ERY A;  2B5N A;  3UKR C;  4LG9 A;  4PNK B;  4ZOZ A; 
#chains in the Genus database with same CATH topology
 3FM0 A;  4ZOX A;  3AFC A;  4NC4 A;  4MMZ A;  3FRX A;  4BH6 A;  4RE6 A;  2P9N C;  3EI1 B;  5TEE A;  2BKL A;  2I3S A;  4FHL A;  4A08 A;  4PSW B;  5EAP A;  4OWR A;  3W15 A;  2I3T A;  2PM9 A;  1L5G A;  5H17 A;  3K71 A;  3QHY B;  3RSE C;  3MMY A;  5A2Q g;  1UOP A;  3VA6 A;  3B7F A;  4WK4 A;  4BUJ C;  2CN2 A;  1B9X A;  2HJ4 A;  3SMR A;  2GC7 A;  1GXR A;  4A09 A;  4K3I D;  3VI3 A;  3MVD K;  1E8N A;  3PVU B;  3C99 A;  4GQ1 A;  1H2Z A;  1SQ9 A;  4A11 A;  5I5I A;  2EIB A;  2MTA H;  4ZOY A;  2OK4 A;  3AL8 B;  3SHF A;  1A0R B;  3JZG A;  3NVQ A;  4D9S A;  4AX4 A;  4Z8L A;  1K8K C;  4GM8 A;  4Z7O A;  4Y5R D;  5AFU 3;  3PXT D;  5HYN B;  4G1M A;  5EM2 B;  3EU7 A;  4JSV C;  2UZX B;  2YMU A;  4G56 B;  1GOF A;  5B4W A;  5HQG A;  5HDB A;  3MUN A;  1XIP A;  4A0B A;  2VDO A;  4CZY A;  3V5W B;  2VDQ A;  3NIF A;  3KRW B;  4U7A A;  5GXI A;  4NBM A;  4DNU A;  2CE9 A;  2AGX A;  1VZ2 A;  2O9K A;  3I7L A;  5AJA A;  1K32 A;  2CN3 A;  1R5M A;  2XL2 A;  3IVM A;  3OKW A;  5M61 A;  5FLX g;  3MZL A;  3SN6 B;  4DNV A;  5GXH A;  3IJ0 A;  5K19 A;  4L3H D;  4AMZ A;  1N6E A;  4G1E A;  1T2X A;  2PM7 B;  5IJ7 E;  4GMB A;  4CI2 A;  3EI1 A;  3EWE A;  1E8M A;  3JPX A;  3C75 H;  4JHN A;  4OZU A;  4LGN A;  3HFQ A;  3I7N A;  5FQD A;  3F3F A;  3K27 A;  5KDO B;  2GNQ A;  3T3M A;  1E5T A;  3L4O D;  4CI3 A;  5EAM A;  3UR4 A;  1VE6 A;  2XZG A;  4A7J A;  3IUJ A;  5E6U A;  1JOF A;  3VI4 A;  5CYK B;  4L1Q D;  3CFV A;  2H9M A;  1JTD B;  3E0C A;  4GQ2 P;  3JAM g;  3JRO A;  3AL8 A;  4FA1 D;  2BBK H;  4PBY A;  3JB9 L;  3P4F A;  4X3E A;  4CC9 A;  4K3J B;  4ES0 A;  4CI1 A;  3IUR A;  5FKR A;  1MDA H;  4IRZ A;  4JT5 C;  2VZ1 A;  3SBR A;  2HJB A;  5EM2 A;  1GP2 B;  1UOO A;  3MZK A;  2VDK A;  3IUQ A;  1K3I A;  4UI9 R;  3VH0 A;  4JHP C;  2H6Q A;  2AH1 A;  2H14 A;  4FB1 D;  5IGO A;  4MK0 B;  4H5J A;  2OVP B;  4Z7Q A;  1QNI A;  4BP8 A;  5M5R A;  3OKT A;  4L3G D;  4NSX A;  3EI3 B;  3ZDZ A;  3ODT A;  4DNW A;  3RFG A;  3GFC A;  3F3P A;  4O45 A;  3BWS A;  3OW8 A;  2I0S A;  5C2V B;  3EI4 B;  1JJU B;  4J8G A;  3RMZ D;  3V7D B;  3JZN A;  3I7H A;  3EQ8 A;  2G99 A;  2Z2N A;  3OKY B;  4A2M A;  3U4Y A;  3DSM A;  2CO0 C;  2VDP A;  4J82 A;  3V4V A;  4JSX C;  1PGU A;  4BCB A;  1U4C A;  3VGZ A;  4D6V A;  3ZE2 A;  4CZX A;  2QC5 A;  3O4G A;  3EQ7 A;  5C9Z B;  5CYK A;  5GMK n;  1MG3 A;  2P9S C;  3PE7 A;  4ESG A;  4NAA A;  1M1X A;  3SBQ A;  3PXS D;  4D0K A;  5C2W B;  2CE8 A;  3SXT D;  1C9L A;  4AOW A;  1RI6 A;  2YNP A;  3O4H A;  4J73 A;  1O6G A;  3F3G A;  2AGW A;  3UVL A;  4ERZ A;  3MXX A;  4CY2 A;  4J77 A;  1PI6 A;  2YNN A;  3DDU A;  3I2N A;  3UKU C;  3RLM D;  4GM3 A;  4XYH A;  1S4U X;  3L4M D;  3ZE0 A;  4ZN4 A;  1C9I A;  4PBZ A;  3KRX B;  1VYH C;  3EI3 A;  4IMM A;  5CXC B;  5EMK B;  1H2W A;  4J78 A;  4QT8 A;  2UZY B;  2J56 H;  5HE1 B;  4CY1 A;  2Z2P A;  3ULE C;  3DM0 A;  2H68 A;  1JMZ B;  1OMW B;  3EQ9 A;  3EI4 A;  4TZ4 A;  3ZDX A;  5CXB B;  3OKY A;  3NID A;  4Y7R A;  2G9A A;  3I8E A;  3JZH A;  5FKQ A;  4BL0 A;  4J87 A;  3OTT A;  3JRP A;  2HU5 A;  2H9P A;  4E54 B;  2HKR A;  3IIW A;  3CFS B;  1FWX A;  2VC2 A;  1GOH A;  2H13 A;  1TYQ C;  1U2V C;  4WK2 A;  5TF2 A;  3RN1 D;  2OIZ A;  4FA4 D;  3MUO A;  2AGY A;  3J81 g;  3KCI A;  2EIC A;  3NIG A;  4WJK A;  1NR0 A;  2VDL A;  4CI8 A;  3K72 A;  1MG2 A;  2EID A;  2XL3 A;  1H2Y A;  2XU7 A;  4NEN A;  1UTC A;  4O3U B;  3ZE1 A;  3IUM A;  3OF7 A;  4J79 A;  5FKT A;  2HYE A;  2Q7Q A;  1YR2 A;  2XYI A;  4GGD A;  4X60 B;  5EAL A;  3SWS D;  2B5L A;  5M5V A;  5CXC A;  1XKS A;  2GC4 A;  3N0E A;  4UM9 A;  4BCD A;  3PXW D;  1UOQ A;  5IC7 A;  3K26 A;  3RRM C;  3I7O A;  4J0W A;  1SQJ A;  3N0D A;  4X63 B;  4CY3 A;  5C86 A;  1QFM A;  5CXB A;  4J0X A;  5THA A;  2H47 A;  4A0A B;  4J84 A;  1U8C A;  1YFQ A;  2IWK A;  2QR5 A;  5I5J A;  1JV2 A;  2YNO A;  5HE0 B;  5FA5 B;  2IUV A;  2H6K A;  4LG8 A;  2YBA A;  5E6R A;  5TEF A;  3SJL D;  4BCC A;  4E54 A;  5M5S A;  2P9L C;  5IJ8 E;  3I89 A;  3UVN A;  3EMH A;  4X61 B;  4FA9 D;  3RN0 D;  5FKS A;  4RE5 A;  4QL1 A;  5JWZ A;  1PEV A;  2OVR B;  3QI0 A;  4N14 A;  2TRC B;  4PSX B;  2H9L A;  4JD2 C;  5FXY A;  3ORV D;  3V4P A;  2IUR A;  3DWL C;  4A2L A;  2J57 G;  3EG6 A;  3O4I A;  2VDR A;  1L0Q A;  4GGC A;  5E6S A;  3IJE A;  3OL2 B;  3SCY A;  4FWW A;  4E5Z B;  3FCS A;  4U1E I;  3ZDY A;  3MKQ A;  1SHY B;  3DXK C;  3UVK A;  4JSP C;  3SFZ A;  2I0R A;  4GGA A;  3DXM C;  5EMM B;  5HE3 B;  2EBS A;  2CNX A;  3IIY A;  5FFG A;  2AH0 A;  2B4E A;  5EAR A;  4HDJ A;  3A0F A;  3O4J A;  3MKS B;  1Q47 A;  4AMY A;  2OJY A;  2Z2O A;  1GG2 B;  4PC0 A;  2IAA A;  2VDN A;  3BG1 A;  4J86 A;  4L1M A;  3NVN A;  4O3T B;  4MMX A;  5EML B;  3V9F A;  5I5M A;  2YB8 B;  4O1Q D;  4A0A A;  2H9N A;  2HKM A;  3BG0 A;  4QRJ A;  3I7P A;  4GM9 A;  3PVW B;  3PSC B;  4JT6 C;  3EI2 A;  5TDH B;  4QQE A;  3C5M A;  4WK0 A;  4AN0 A;  4JXM A;  2B5M A;  1ERJ A;  4FAN D;  2QXV A;  1O6F A;  4MMY A;  1JMX B;  5AMS A;  2P9I C;  3FCU A;  1I2M B;  4QAM A;  1TBG A;  3FGB A;  2J55 H;  3I8C A;  5IGQ A;  4AEZ A;  3I7K A;  2OVQ B;  2XE4 A;  2H3X A;  2QZP A;  5C92 A;  2HES X;  4FA5 D;  4L9O A;  4EWR A;  1N6D A;  3PSL A;  4CZV A;  3GD1 I;  2IUP A;  3SBP A;  3SVW D;  1OLZ A;  2P9P C;  2PBI B;  2AQ5 A;  3UVO A;  3AH8 B;  3OL2 A;  4GQB B;  2PM6 B;  2I0T A;  3K6S A;  4E5Z A;  4UM8 A;  1VZ3 A;  4XEI C;  4R7A B;  4CY5 A;  4O9D A;  5IT9 g;  5M5U A;  1TYE A;  4BP9 A;  1P22 A;  4XYI A;  5EMJ B;  5HE2 B;  4Z7N A;  3RFH A;  2CO0 A;  2AGL A;  3IUN A;  2H6N A;  4A08 B;  1H2X A;  1B9Y A;  3GC3 B;  2BCJ B;  4IA9 A;  4FAV D;  2PM9 B;  2W18 A;  1GOT B;  2OK6 A;  4GZ8 A;  2XDW A;  4JSN C;  5H14 A;  2IWF A;  4G55 A;  3SLE D;  4YVD A;  5H1M A;  5M5T A;  1QFS A;  5GSA A;  2HU8 A;  4O02 A;  2JKX A;  4A09 B;  5SXM A;  4I79 A;  3T3P A;  2HU7 A;  2P9K C;  4J8B A;  1NEX B;  1GOG A;  3CIK B;  2EIE A;  1A12 A;  1XHM A;  4A11 B;  1BPO A;  2AGZ A;  3UVM A;  3IKO A;  2P9U C;  4AN1 A;  3GRE A;  4H5I A;  2WQ8 A;  2HXC A;  3AL9 A;  3J80 g;  3IJ1 A;  3NVX A;  3EI2 B;  4O2W A;  4ERQ A;  4ZOV A;  5K1C C;  1N6F A;  1PBY B;  4PXW A;  3IJC A;  2IUQ A;  3IUL A;  2VDM A;  4J81 A;  4KFM B;  3ZWL B;  4A0B B;  5FFO A;  3C9C A;  4ERY A;  2VZ3 A;  2B5N A;  3UKR C;  4LG9 A;  4PNK B;  1VE7 A;  4ZOZ A; 
#chains in the Genus database with same CATH homology
 3FM0 A;  4ZOX A;  3AFC A;  3FRX A;  4BH6 A;  2P9N C;  3EI1 B;  5TEE A;  2I3S A;  4FHL A;  4A08 A;  4PSW B;  5EAP A;  4OWR A;  3W15 A;  2I3T A;  2PM9 A;  5H17 A;  3RSE C;  3MMY A;  5A2Q g;  3VA6 A;  3B7F A;  4BUJ C;  2CN2 A;  1B9X A;  2HJ4 A;  3SMR A;  2GC7 A;  1GXR A;  4A09 A;  4K3I D;  3PVU B;  3C99 A;  4GQ1 A;  1SQ9 A;  4A11 A;  5I5I A;  2MTA H;  4ZOY A;  2OK4 A;  3AL8 B;  3SHF A;  1A0R B;  3JZG A;  3NVQ A;  4Z8L A;  1K8K C;  4GM8 A;  4Y5R D;  5AFU 3;  3PXT D;  5HYN B;  5EM2 B;  3EU7 A;  4JSV C;  2UZX B;  2YMU A;  4G56 B;  5B4W A;  5HQG A;  1XIP A;  4A0B A;  4CZY A;  3V5W B;  3KRW B;  4U7A A;  5GXI A;  2CE9 A;  2AGX A;  2O9K A;  3I7L A;  5AJA A;  1K32 A;  2CN3 A;  1R5M A;  2XL2 A;  3OKW A;  5FLX g;  3MZL A;  3SN6 B;  5GXH A;  3IJ0 A;  5K19 A;  4L3H D;  1N6E A;  2PM7 B;  5IJ7 E;  4GMB A;  4CI2 A;  3EI1 A;  3EWE A;  3JPX A;  3C75 H;  4OZU A;  4LGN A;  3HFQ A;  3I7N A;  5FQD A;  3F3F A;  3K27 A;  5KDO B;  2GNQ A;  3L4O D;  4CI3 A;  5EAM A;  3UR4 A;  4A7J A;  1JOF A;  5CYK B;  4L1Q D;  3CFV A;  2H9M A;  3E0C A;  4GQ2 P;  3JAM g;  3JRO A;  3AL8 A;  4FA1 D;  2BBK H;  4PBY A;  3JB9 L;  3P4F A;  4X3E A;  4CC9 A;  4K3J B;  4ES0 A;  4CI1 A;  5FKR A;  1MDA H;  4JT5 C;  3SBR A;  2HJB A;  5EM2 A;  1GP2 B;  3MZK A;  4UI9 R;  3VH0 A;  2H6Q A;  2AH1 A;  2H14 A;  4FB1 D;  5IGO A;  4MK0 B;  4H5J A;  2OVP B;  1QNI A;  3OKT A;  4L3G D;  4NSX A;  3EI3 B;  3ODT A;  3RFG A;  3GFC A;  3F3P A;  4O45 A;  3BWS A;  3OW8 A;  2I0S A;  5C2V B;  3EI4 B;  1JJU B;  4J8G A;  3RMZ D;  3V7D B;  3JZN A;  3I7H A;  2G99 A;  2Z2N A;  3OKY B;  4A2M A;  3U4Y A;  3DSM A;  2CO0 C;  4J82 A;  4JSX C;  1PGU A;  1U4C A;  3VGZ A;  4D6V A;  4CZX A;  2QC5 A;  5C9Z B;  5CYK A;  5GMK n;  1MG3 A;  2P9S C;  3PE7 A;  4ESG A;  3SBQ A;  3PXS D;  4D0K A;  5C2W B;  2CE8 A;  3SXT D;  4AOW A;  1RI6 A;  2YNP A;  4J73 A;  3F3G A;  2AGW A;  3UVL A;  4ERZ A;  3MXX A;  4CY2 A;  4J77 A;  1PI6 A;  2YNN A;  3I2N A;  3UKU C;  3RLM D;  4GM3 A;  4XYH A;  1S4U X;  3L4M D;  4ZN4 A;  4PBZ A;  3KRX B;  1VYH C;  3EI3 A;  4IMM A;  5CXC B;  5EMK B;  4J78 A;  4QT8 A;  2UZY B;  2J56 H;  5HE1 B;  4CY1 A;  2Z2P A;  3ULE C;  3DM0 A;  2H68 A;  1JMZ B;  1OMW B;  3EI4 A;  4TZ4 A;  5CXB B;  3OKY A;  4Y7R A;  2G9A A;  3I8E A;  3JZH A;  5FKQ A;  4BL0 A;  4J87 A;  3OTT A;  3JRP A;  2H9P A;  4E54 B;  2HKR A;  3IIW A;  3CFS B;  1FWX A;  2H13 A;  1TYQ C;  1U2V C;  5TF2 A;  3RN1 D;  2OIZ A;  4FA4 D;  2AGY A;  3J81 g;  1NR0 A;  4CI8 A;  1MG2 A;  2XL3 A;  2XU7 A;  4O3U B;  4J79 A;  5FKT A;  2HYE A;  2Q7Q A;  2XYI A;  4GGD A;  4X60 B;  5EAL A;  3SWS D;  2B5L A;  5CXC A;  1XKS A;  2GC4 A;  3N0E A;  3PXW D;  5IC7 A;  3K26 A;  3RRM C;  3I7O A;  4J0W A;  1SQJ A;  3N0D A;  4X63 B;  4CY3 A;  5CXB A;  4J0X A;  5THA A;  2H47 A;  4A0A B;  4J84 A;  1YFQ A;  2IWK A;  5I5J A;  2YNO A;  5HE0 B;  5FA5 B;  2IUV A;  4LG8 A;  2H6K A;  2YBA A;  5TEF A;  3SJL D;  4E54 A;  2P9L C;  5IJ8 E;  3I89 A;  3UVN A;  3EMH A;  4X61 B;  4FA9 D;  3RN0 D;  5FKS A;  4QL1 A;  5JWZ A;  1PEV A;  2OVR B;  4N14 A;  2TRC B;  4PSX B;  2H9L A;  4JD2 C;  5FXY A;  3ORV D;  2IUR A;  3DWL C;  4A2L A;  2J57 G;  3EG6 A;  1L0Q A;  4GGC A;  3OL2 B;  3SCY A;  4FWW A;  4E5Z B;  4U1E I;  3MKQ A;  1SHY B;  3DXK C;  3UVK A;  4JSP C;  3SFZ A;  2I0R A;  4GGA A;  3DXM C;  5EMM B;  5HE3 B;  2EBS A;  2CNX A;  3IIY A;  2AH0 A;  2B4E A;  5EAR A;  4HDJ A;  3A0F A;  3MKS B;  1Q47 A;  2OJY A;  2Z2O A;  1GG2 B;  4PC0 A;  2IAA A;  3BG1 A;  4O3T B;  4J86 A;  3NVN A;  5EML B;  3V9F A;  5I5M A;  2YB8 B;  4O1Q D;  4A0A A;  2H9N A;  2HKM A;  3BG0 A;  4QRJ A;  3I7P A;  4GM9 A;  3PVW B;  3PSC B;  4JT6 C;  3EI2 A;  5TDH B;  4QQE A;  3C5M A;  4JXM A;  2B5M A;  1ERJ A;  4FAN D;  2QXV A;  1JMX B;  5AMS A;  2P9I C;  1TBG A;  3FGB A;  2J55 H;  3I8C A;  5IGQ A;  4AEZ A;  3I7K A;  2OVQ B;  2H3X A;  2HES X;  4FA5 D;  4L9O A;  4EWR A;  1N6D A;  3PSL A;  4CZV A;  2IUP A;  3SBP A;  3SVW D;  1OLZ A;  2P9P C;  2PBI B;  2AQ5 A;  3UVO A;  3AH8 B;  3OL2 A;  4GQB B;  2PM6 B;  2I0T A;  4E5Z A;  4XEI C;  4R7A B;  4CY5 A;  4O9D A;  5IT9 g;  1P22 A;  4XYI A;  5EMJ B;  5HE2 B;  3RFH A;  2CO0 A;  2AGL A;  2H6N A;  4A08 B;  1B9Y A;  2BCJ B;  4IA9 A;  4FAV D;  2PM9 B;  2W18 A;  1GOT B;  2OK6 A;  4GZ8 A;  4JSN C;  5H14 A;  2IWF A;  3SLE D;  4YVD A;  5H1M A;  5GSA A;  4A09 B;  5SXM A;  4I79 A;  2P9K C;  4J8B A;  1NEX B;  3CIK B;  1XHM A;  4A11 B;  2AGZ A;  3UVM A;  3IKO A;  2P9U C;  3GRE A;  4H5I A;  2HXC A;  3AL9 A;  3J80 g;  3IJ1 A;  3NVX A;  3EI2 B;  4ERQ A;  4ZOV A;  5K1C C;  1N6F A;  1PBY B;  4PXW A;  3IJC A;  2IUQ A;  4J81 A;  4KFM B;  3ZWL B;  4A0B B;  3C9C A;  4ERY A;  2B5N A;  3UKR C;  4LG9 A;  4PNK B;  4ZOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...