2HKMA

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with phenylethylamine.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
total genus 95
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hkmA01
2Q7QA 4LGNA 2CO0A 4GM3A 1B9YA 5TEFA 5C9ZB 1R5MA 1GP2B 3N0EA 4A2MA 1QNIA 2XL3A 1SQ9A 4BL0A 4QT8A 2PM9B 4FA5D 4JSXC 3EMHA 4ZOYA 1NR0A 3ODTA 3OL2A 3AFCA 4CZXA 2J55H 3CIKB 3EWEA 4A11B 4JSNC 3EI3A 3AL9A 5TEEA 5FXYA 3E0CA 2HKMA 4Y5RD 4J8GA 3I8CA 3C99A 5IGQA 2YNNA 1XHMA 3A0FA 4AOWA 3OKYB 3PXSD 1MDAH 4X60B 2IUPA 2HJ4A 4QQEA 3KRWB 3I89A 4A7JA 3SMRA 1N6DA 4ZOXA 2BCJB 2I3SA 3JZHA 1OMWB 3CFSB 4K3ID 4PBZA 5B4WA 4GGDA 4D0KA 5GMKn 3PXWD 5IGOA 2IWKA 3AH8B 2P9IC 5IJ8E 3DSMA 3I7NA 3PXTD 3EI3B 3L4MD 3BG0A 2HESX 4A08B 3UVNA 5HE3B 3N0DA 3FGBA 1B9XA 4YVDA 4CC9A 3NVXA 4E54A 4O3TB 3EI4A 3IKOA 4J84A 3L4OD 4CY3A 3MZLA 3C9CA 3IIWA 5EM2A 5FKTA 3PE7A 3DWLC 5GSAA 3I7PA 3F3GA 5FKRA 5IJ7E 5FLXg 5GXIA 4A0AA 2HKRA 4OWRA 2CE9A 2HYEA 4FA9D 5K19A 2YNOA 3V9FA 4CZYA 2I0SA 2H6KA 3K26A 4O9DA 3OKTA 1JJUB 5FA5B 2TRCB 4J79A 4IMMA 4A2LA 3PSCB 4J0XA 4E54B 4L3HD 3OKWA 3RMZD 4J87A 3RFGA 1K32A 3I2NA 3UR4A 2H13A 3C5MA 5EM2B 3J80g 2AH1A 3B7FA 2P9UC 2CNXA 2J57G 5SXMA 4A09A 4U1EI 5TDHB 2AGYA 4J73A 4TZ4A 3IIYA 1TBGA 2HJBA 1JMZB 2AH0A 2IAAA 1PI6A 2PM6B 1YFQA 3JZGA 2OVPB 5EMJB 5CYKA 3RRMC 4JSVC 3ORVD 3UKRC 4CI1A 5AMSA 4GQBB 4GM8A 3F3PA 2CE8A 3IJ0A 1SQJA 3GFCA 3JAMg 4Y7RA 2Z2PA 2PM7B 5CXBA 4CY5A 2UZYB 2P9PC 4PSXB 3JROA 4GZ8A 2IUVA 1K8KC 4CY2A 2HXCA 3C75H 4GGCA 2IWFA 4JD2C 5I5JA 4ZOVA 5JWZA 3ZWLB 4EWRA 2Z2NA 2AGXA 5C2WB 5EAPA 3PSLA 4HDJA 3OL2B 3UVOA 5I5IA 4XYIA 3F3FA 3JRPA 3VH0A 3VGZA 2IURA 2OJYA 2YMUA 5AFU3 2GC4A 4A0BA 3MMYA 3EI1A 4UI9R 5CXBB 3DM0A 3SHFA 2AGLA 3W15A 3DXMC 2I0TA 4L9OA 3PVUB 3U4YA 5HE0B 3V7DB 3SJLD 3RFHA 3SCYA 4FA1D 2MTAH 2GC7A 3EI2A 4NSXA 2P9SC 2P9KC 3SBQA 4MK0B 5H17A 4H5IA 4X3EA 4J78A 2QXVA 4J8BA 1NEXB 4GGAA 2P9LC 1GG2B 2CN3A 3DXKC 4FWWA 2YNPA 3PVWB 4X63B 4H5JA 5TF2A 3NVQA 4X61B 4ERQA 4QRJA 3CFVA 2OIZA 4J81A 2P9NC 3AL8A 4CI8A 1PEVA 3OTTA 1P22A 2UZXB 1RI6A 3EI4B 1L0QA 3OW8A 1TYQC 2B5NA 1OLZA 2PM9A 3UVLA 3FRXA 4L3GD 4FAVD 5HYNB 2CN2A 2G9AA 2EBSA 4CI3A 2XU7A 1PGUA 2I3TA 3I7LA 4GMBA 3UVKA 2OK4A 4A11A 2W18A 3GREA 4JSPC 1GXRA 3I7HA 2B5LA 3MKQA 4A0AB 1XKSA 4L1QD 5CXCA 1SHYB 4XEIC 3I7OA 2OVQB 2GNQA 2H14A 4ES0A 4JT5C 4JT6C 2OK6A 4FHLA 4BH6A 4IA9A 4R7AB 4J0WA 2H3XA 3SLED 4CI2A 3SFZA 3RLMD 4D6VA 4N14A 1U2VC 3BG1A 3MKSB 2AGZA 4CZVA 3ULEC 5FQDA 4XYHA 4JXMA 4PC0A 3SWSD 2OVRB 5AJAA 3BWSA 1N6FA 4AEZA 4A09B 1ERJA 5C2VB 4G56B 4A08A 5A2Qg 3J81g 5IC7A 4QL1A 5CXCB 1U4CA 5EARA 1FWXA 3SVWD 3NVNA 5CYKB 5EAMA 3SXTD 2J56H 3RN1D 2I0RA 3I8EA 1N6EA 2PBIB 4ESGA 3SN6B 4PXWA 2H6NA 2IUQA 4J86A 5KDOB 1S4UX 2H6QA 3V5WB 5THAA 2H9LA 2H9PA 3I7KA 4ZN4A 4ZOZA 4J77A 4KFMB 3SBPA 1VYHC 3RSEC 4BUJC 2Z2OA 4O45A 2G99A 2XYIA 4I79A 1PBYB 4Z8LA 2O9KA 2XL2A 5I5MA 2QC5A 1JOFA 4PNKB 3FM0A 2B4EA 2H9NA 4K3JB 3KRXB 4FA4D 4ERYA 2BBKH 5K1CC 4E5ZA 1XIPA 4LG9A 4ERZA 4PSWB 3RN0D 2AQ5A 5FKQA 5GXHA 4GQ2P 4A0BB 4OZUA 3EI1B 5EALA 2H47A 4O3UB 1JMXB 3K27A 5EMKB 5EMLB 3UKUC 1MG2A 3JZNA 3EI2B 2H9MA 1GOTB 3MZKA 2YBAA 2YB8B 3MXXA 2AGWA 2CO0C 2B5MA 3JB9L 5IT9g 1A0RB 5HE2B 5HE1B 4GQ1A 3VA6A 5FKSA 3HFQA 4CY1A 4PBYA 3P4FA 4LG8A 5EMMB 5H14A 1Q47A 5H1MA 5HQGA 3UVMA 3EU7A 4E5ZB 3SBRA 4J82A 3OKYA 3IJCA 4U7AA 3IJ1A 4FAND 3AL8B 1MG3A 4FB1D 2H68A 3EG6A 3JPXA 4O1QD 4GM9A
chains in the Genus database with same CATH superfamily
2Q7QA 4LGNA 2CO0A 4GM3A 3ZDXA 1B9YA 5TEFA 5C9ZB 1R5MA 1GP2B 4WK0A 1I2MB 3N0EA 4A2MA 1QNIA 2XL3A 5M5VA 1SQ9A 2HU8A 4BL0A 4QT8A 2PM9B 4FA5D 4JSXC 3EMHA 4ZOYA 1NR0A 3ODTA 5M5RA 3OL2A 3AFCA 4CZXA 2J55H 3CIKB 1A12A 3EWEA 3ZDYA 3GC3B 4AMYA 4A11B 4JSNC 4NBMA 3EI3A 3AL9A 5TEEA 5FXYA 3E0CA 2HKMA 4Y5RD 2VDNA 4J8GA 3I8CA 3C99A 4MMZA 5IGQA 2YNNA 1XHMA 3A0FA 4AOWA 2EICA 3OKYB 4BP8A 3PXSD 1MDAH 1K3IA 2VDLA 5M61A 4X60B 2IUPA 3IVMA 2HJ4A 4QQEA 3KRWB 3I89A 4A7JA 3SMRA 1N6DA 4ZOXA 2BCJB 2I3SA 3JZHA 1OMWB 3CFSB 1VZ3A 4K3ID 4PBZA 5B4WA 4GGDA 4D0KA 5GMKn 3PXWD 5IGOA 2IWKA 4AN0A 3IJEA 3AH8B 2P9IC 5IJ8E 3DSMA 3I7NA 3PXTD 3EI3B 3L4MD 5E6RA 3BG0A 2HESX 4A08B 3UVNA 5HE3B 3N0DA 3FGBA 1B9XA 4YVDA 5HDBA 4CC9A 3NVXA 4E54A 4O3TB 3EI4A 3IKOA 4J84A 4Z7OA 3L4OD 1GOFA 4CY3A 3MZLA 3C9CA 3IIWA 5EM2A 5FKTA 3PE7A 3DWLC 5GSAA 3T3PA 3EQ7A 3I7PA 3F3GA 3IULA 5FKRA 5IJ7E 1UOPA 1H2YA 5FLXg 5GXIA 4G1MA 3K6SA 2WQ8A 4A0AA 2HKRA 4OWRA 2CE9A 5FFOA 2HYEA 4FA9D 5K19A 2YNOA 3V9FA 4CZYA 2I0SA 2H6KA 3K26A 4O9DA 5C86A 3OKTA 1JJUB 5FA5B 2TRCB 4J79A 4IMMA 4A2LA 3PSCB 4J0XA 5M5UA 4E54B 4L3HD 1VZ2A 3OKWA 4O02A 3RMZD 3GD1I 4J87A 3RFGA 1K32A 3I2NA 3UR4A 1GOHA 2H13A 2XE4A 3C5MA 4BP9A 2VZ1A 5EM2B 3J80g 1TYEA 2AH1A 2VZ3A 2VDOA 3B7FA 2P9UC 4AMZA 2CNXA 1VE7A 1H2ZA 2J57G 5SXMA 4A09A 4U1EI 5TDHB 2AGYA 5FFGA 4J73A 4TZ4A 3IIYA 1TBGA 2HJBA 1JMZB 1UOQA 5M5SA 2AH0A 2XDWA 4MMYA 2IAAA 3K71A 1PI6A 3MUNA 2PM6B 1YFQA 3JZGA 2OVPB 5EMJB 5CYKA 3RRMC 4JSVC 3ORVD 3UKRC 3KCIA 4CI1A 5AMSA 4GQBB 2JKXA 3F3PA 4GM8A 3FCUA 2CE8A 3IJ0A 1SQJA 3GFCA 3JAMg 4Y7RA 1H2XA 3V4VA 2Z2PA 3ZE2A 2PM7B 5CXBA 4CY5A 2UZYB 2P9PC 4Z7QA 4PSXB 4NENA 3JROA 4GZ8A 2IUVA 4MMXA 1K8KC 4CY2A 2HXCA 3C75H 1C9LA 4GGCA 4AN1A 2IWFA 4JD2C 4BCBA 5I5JA 2EIBA 4ZOVA 5JWZA 3ZWLB 4EWRA 2Z2NA 2AGXA 5E6UA 5C2WB 5EAPA 3ZDZA 3O4IA 3PSLA 4BCCA 4HDJA 3OL2B 3UVOA 5I5IA 4XYIA 3F3FA 3V4PA 3JRPA 3VH0A 1YR2A 3NIDA 3VGZA 2IURA 1T2XA 2OJYA 2YMUA 5AFU3 2QR5A 2GC4A 4A0BA 3MMYA 3EI1A 4UI9R 5CXBB 3DM0A 3SHFA 2AGLA 1E5TA 2VDMA 3W15A 3DXMC 2I0TA 4L9OA 3PVUB 1M1XA 3U4YA 5HE0B 3MUOA 3V7DB 3SJLD 3RFHA 3SCYA 4FA1D 2BKLA 2MTAH 2GC7A 3EI2A 4NSXA 2P9SC 4L1MA 2P9KC 3SBQA 4MK0B 5H17A 4H5IA 2VDKA 4X3EA 4J78A 2QXVA 4J8BA 1NEXB 4G55A 3EQ8A 4GGAA 2P9LC 1GG2B 2EIEA 2CN3A 3VI3A 3DXKC 4FWWA 2YNPA 3PVWB 4Z7NA 3IUJA 4X63B 4H5JA 5TF2A 3NVQA 4X61B 4ERQA 4QRJA 1U8CA 3CFVA 2OIZA 1UTCA 2P9NC 3AL8A 4J81A 4CI8A 1PEVA 3OTTA 4DNVA 1P22A 3ZE1A 2UZXB 1RI6A 3EI4B 1L0QA 3OW8A 1TYQC 2B5NA 1OLZA 4AX4A 2PM9A 3UVLA 3FRXA 4L3GD 4FAVD 5HYNB 2CN2A 2G9AA 3MVDK 2EBSA 4CI3A 2XU7A 1PGUA 2I3TA 3I7LA 4GMBA 3UVKA 3ZE0A 2OK4A 4A11A 2HU7A 2W18A 3GREA 4JSPC 4WJKA 1GXRA 2VC2A 2B5LA 1H2WA 3I7HA 3MKQA 4A0AB 1XKSA 4L1QD 5CXCA 1SHYB 4XEIC 3I7OA 2OVQB 2GNQA 1QFMA 1QFSA 2H14A 4ES0A 4JT5C 3T3MA 4JT6C 2OK6A 4FHLA 4BH6A 4IA9A 3O4HA 4R7AB 4G1EA 4J0WA 2H3XA 3SLED 4CI2A 3SFZA 3RLMD 4D6VA 4N14A 5E6SA 1U2VC 3BG1A 4WK2A 3MKSB 4QAMA 2AGZA 4CZVA 2XZGA 3ULEC 5FQDA 4XYHA 3K72A 4JXMA 4O2WA 4PC0A 3SWSD 2OVRB 5AJAA 3BWSA 1N6FA 4AEZA 4A09B 1O6GA 2HU5A 1ERJA 5C2VB 4G56B 4A08A 5A2Qg 3J81g 4NC4A 5IC7A 1C9IA 1L5GA 4QL1A 5CXCB 1U4CA 4UM8A 5EARA 1FWXA 3SVWD 3NVNA 5CYKB 5EAMA 3SXTD 2J56H 3RN1D 2I0RA 3DDUA 3I8EA 1N6EA 2PBIB 4ESGA 4BCDA 3SN6B 1GOGA 4PXWA 2H6NA 2IUQA 4J86A 5C92A 5KDOB 1S4UX 2H6QA 3V5WB 5M5TA 5THAA 2H9LA 2H9PA 3I7KA 3NIFA 4ZN4A 4ZOZA 4J77A 2VDQA 4KFMB 3SBPA 1BPOA 1VYHC 3RSEC 4BUJC 1E8NA 2Z2OA 4O45A 3QHYB 2G99A 2XYIA 4I79A 1PBYB 4UM9A 4RE5A 4JHNA 4Z8LA 2O9KA 1JTDB 2XL2A 3IURA 5I5MA 2QC5A 1JOFA 2VDPA 3IUQA 4PNKB 3NIGA 3FM0A 2B4EA 4DNWA 2H9NA 4K3JB 1JV2A 3KRXB 4FA4D 3VI4A 1VE6A 4ERYA 2BBKH 5K1CC 4E5ZA 4DNUA 1XIPA 4LG9A 4ERZA 4RE6A 3EQ9A 4PSWB 3RN0D 2AQ5A 5FKQA 4D9SA 3QI0A 5GXHA 4GQ2P 4A0BB 4OZUA 3EI1B 5EALA 2H47A 4O3UB 1JMXB 1O6FA 3K27A 5EMKB 5EMLB 1E8MA 3UKUC 1MG2A 4WK4A 3JZNA 3EI2B 2H9MA 1GOTB 3MZKA 2YBAA 2YB8B 3MXXA 2AGWA 2CO0C 2B5MA 3IUNA 3JB9L 5IT9g 1A0RB 3OF7A 5HE2B 5HE1B 4GQ1A 3O4GA 3VA6A 3O4JA 4IRZA 5FKSA 3FCSA 3HFQA 4CY1A 4PBYA 4JHPC 2QZPA 3P4FA 4LG8A 5EMMB 5H14A 1Q47A 5H1MA 2VDRA 3IUMA 5HQGA 3UVMA 3EU7A 4E5ZB 3SBRA 4J82A 3OKYA 3IJCA 1UOOA 4U7AA 3IJ1A 4FAND 3AL8B 1MG3A 4NAAA 4FB1D 2EIDA 2H68A 3EG6A 3JPXA 4O1QD 4GM9A
chains in the Genus database with same CATH topology
2Q7QA 4LGNA 2CO0A 4GM3A 1B9YA 5TEFA 5C9ZB 1R5MA 1GP2B 3N0EA 4A2MA 1QNIA 2XL3A 1SQ9A 4BL0A 4QT8A 2PM9B 4FA5D 4JSXC 3EMHA 4ZOYA 1NR0A 3ODTA 3OL2A 3AFCA 4CZXA 2J55H 3CIKB 3EWEA 4A11B 4JSNC 3EI3A 3AL9A 5TEEA 5FXYA 3E0CA 2HKMA 4Y5RD 4J8GA 3I8CA 3C99A 5IGQA 2YNNA 1XHMA 3A0FA 4AOWA 3OKYB 3PXSD 1MDAH 4X60B 2IUPA 2HJ4A 4QQEA 3KRWB 3I89A 4A7JA 3SMRA 1N6DA 4ZOXA 2BCJB 2I3SA 3JZHA 1OMWB 3CFSB 4K3ID 4PBZA 5B4WA 4GGDA 4D0KA 5GMKn 3PXWD 5IGOA 2IWKA 3AH8B 2P9IC 5IJ8E 3DSMA 3I7NA 3PXTD 3EI3B 3L4MD 3BG0A 2HESX 4A08B 3UVNA 5HE3B 3N0DA 3FGBA 1B9XA 4YVDA 4CC9A 3NVXA 4E54A 4O3TB 3EI4A 3IKOA 4J84A 3L4OD 4CY3A 3MZLA 3C9CA 3IIWA 5EM2A 5FKTA 3PE7A 3DWLC 5GSAA 3I7PA 3F3GA 5FKRA 5IJ7E 5FLXg 5GXIA 4A0AA 2HKRA 4OWRA 2CE9A 2HYEA 4FA9D 5K19A 2YNOA 3V9FA 4CZYA 2I0SA 2H6KA 3K26A 4O9DA 3OKTA 1JJUB 5FA5B 2TRCB 4J79A 4IMMA 4A2LA 3PSCB 4J0XA 4E54B 4L3HD 3OKWA 3RMZD 4J87A 3RFGA 1K32A 3I2NA 3UR4A 2H13A 3C5MA 5EM2B 3J80g 2AH1A 3B7FA 2P9UC 2CNXA 2J57G 5SXMA 4A09A 4U1EI 5TDHB 2AGYA 4J73A 4TZ4A 3IIYA 1TBGA 2HJBA 1JMZB 2AH0A 2IAAA 1PI6A 2PM6B 1YFQA 3JZGA 2OVPB 5EMJB 5CYKA 3RRMC 4JSVC 3ORVD 3UKRC 4CI1A 5AMSA 4GQBB 4GM8A 3F3PA 2CE8A 3IJ0A 1SQJA 3GFCA 3JAMg 4Y7RA 2Z2PA 2PM7B 5CXBA 4CY5A 2UZYB 2P9PC 4PSXB 3JROA 4GZ8A 2IUVA 1K8KC 4CY2A 2HXCA 3C75H 4GGCA 2IWFA 4JD2C 5I5JA 4ZOVA 5JWZA 3ZWLB 4EWRA 2Z2NA 2AGXA 5C2WB 5EAPA 3PSLA 4HDJA 3OL2B 3UVOA 5I5IA 4XYIA 3F3FA 3JRPA 3VH0A 3VGZA 2IURA 2OJYA 2YMUA 5AFU3 2GC4A 4A0BA 3MMYA 3EI1A 4UI9R 5CXBB 3DM0A 3SHFA 2AGLA 3W15A 3DXMC 2I0TA 4L9OA 3PVUB 3U4YA 5HE0B 3V7DB 3SJLD 3RFHA 3SCYA 4FA1D 2MTAH 2GC7A 3EI2A 4NSXA 2P9SC 2P9KC 3SBQA 4MK0B 5H17A 4H5IA 4X3EA 4J78A 2QXVA 4J8BA 1NEXB 4GGAA 2P9LC 1GG2B 2CN3A 3DXKC 4FWWA 2YNPA 3PVWB 4X63B 4H5JA 5TF2A 3NVQA 4X61B 4ERQA 4QRJA 3CFVA 2OIZA 4J81A 2P9NC 3AL8A 4CI8A 1PEVA 3OTTA 1P22A 2UZXB 1RI6A 3EI4B 1L0QA 3OW8A 1TYQC 2B5NA 1OLZA 2PM9A 3UVLA 3FRXA 4L3GD 4FAVD 5HYNB 2CN2A 2G9AA 2EBSA 4CI3A 2XU7A 1PGUA 2I3TA 3I7LA 4GMBA 3UVKA 2OK4A 4A11A 2W18A 3GREA 4JSPC 1GXRA 3I7HA 2B5LA 3MKQA 4A0AB 1XKSA 4L1QD 5CXCA 1SHYB 4XEIC 3I7OA 2OVQB 2GNQA 2H14A 4ES0A 4JT5C 4JT6C 2OK6A 4FHLA 4BH6A 4IA9A 4R7AB 4J0WA 2H3XA 3SLED 4CI2A 3SFZA 3RLMD 4D6VA 4N14A 1U2VC 3BG1A 3MKSB 2AGZA 4CZVA 3ULEC 5FQDA 4XYHA 4JXMA 4PC0A 3SWSD 2OVRB 5AJAA 3BWSA 1N6FA 4AEZA 4A09B 1ERJA 5C2VB 4G56B 4A08A 5A2Qg 3J81g 5IC7A 4QL1A 5CXCB 1U4CA 5EARA 1FWXA 3SVWD 3NVNA 5CYKB 5EAMA 3SXTD 2J56H 3RN1D 2I0RA 3I8EA 1N6EA 2PBIB 4ESGA 3SN6B 4PXWA 2H6NA 2IUQA 4J86A 5KDOB 1S4UX 2H6QA 3V5WB 5THAA 2H9LA 2H9PA 3I7KA 4ZN4A 4ZOZA 4J77A 4KFMB 3SBPA 1VYHC 3RSEC 4BUJC 2Z2OA 4O45A 2G99A 2XYIA 4I79A 1PBYB 4Z8LA 2O9KA 2XL2A 5I5MA 2QC5A 1JOFA 4PNKB 3FM0A 2B4EA 2H9NA 4K3JB 3KRXB 4FA4D 4ERYA 2BBKH 5K1CC 4E5ZA 1XIPA 4LG9A 4ERZA 4PSWB 3RN0D 2AQ5A 5FKQA 5GXHA 4GQ2P 4A0BB 4OZUA 3EI1B 5EALA 2H47A 4O3UB 1JMXB 3K27A 5EMKB 5EMLB 3UKUC 1MG2A 3JZNA 3EI2B 2H9MA 1GOTB 3MZKA 2YBAA 2YB8B 3MXXA 2AGWA 2CO0C 2B5MA 3JB9L 5IT9g 1A0RB 5HE2B 5HE1B 4GQ1A 3VA6A 5FKSA 3HFQA 4CY1A 4PBYA 3P4FA 4LG8A 5EMMB 5H14A 1Q47A 5H1MA 5HQGA 3UVMA 3EU7A 4E5ZB 3SBRA 4J82A 3OKYA 3IJCA 4U7AA 3IJ1A 4FAND 3AL8B 1MG3A 4FB1D 2H68A 3EG6A 3JPXA 4O1QD 4GM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7Q A;  4LGN A;  2CO0 A;  4GM3 A;  1B9Y A;  5TEF A;  5C9Z B;  1R5M A;  1GP2 B;  3N0E A;  4A2M A;  1QNI A;  2XL3 A;  1SQ9 A;  4BL0 A;  4QT8 A;  2PM9 B;  4FA5 D;  4JSX C;  3EMH A;  4ZOY A;  1NR0 A;  3ODT A;  3OL2 A;  3AFC A;  4CZX A;  2J55 H;  3CIK B;  3EWE A;  4A11 B;  4JSN C;  3EI3 A;  3AL9 A;  5TEE A;  5FXY A;  3E0C A;  2HKM A;  4Y5R D;  4J8G A;  3I8C A;  3C99 A;  5IGQ A;  2YNN A;  1XHM A;  3A0F A;  4AOW A;  3OKY B;  3PXS D;  1MDA H;  4X60 B;  2IUP A;  2HJ4 A;  4QQE A;  3KRW B;  3I89 A;  4A7J A;  3SMR A;  1N6D A;  4ZOX A;  2BCJ B;  2I3S A;  3JZH A;  1OMW B;  3CFS B;  4K3I D;  4PBZ A;  5B4W A;  4GGD A;  4D0K A;  5GMK n;  3PXW D;  5IGO A;  2IWK A;  3AH8 B;  2P9I C;  5IJ8 E;  3DSM A;  3I7N A;  3PXT D;  3EI3 B;  3L4M D;  3BG0 A;  2HES X;  4A08 B;  3UVN A;  5HE3 B;  3N0D A;  3FGB A;  1B9X A;  4YVD A;  4CC9 A;  3NVX A;  4E54 A;  4O3T B;  3EI4 A;  3IKO A;  4J84 A;  3L4O D;  4CY3 A;  3MZL A;  3C9C A;  3IIW A;  5EM2 A;  5FKT A;  3PE7 A;  3DWL C;  5GSA A;  3I7P A;  3F3G A;  5FKR A;  5IJ7 E;  5FLX g;  5GXI A;  4A0A A;  2HKR A;  4OWR A;  2CE9 A;  2HYE A;  4FA9 D;  5K19 A;  2YNO A;  3V9F A;  4CZY A;  2I0S A;  2H6K A;  3K26 A;  4O9D A;  3OKT A;  1JJU B;  5FA5 B;  2TRC B;  4J79 A;  4IMM A;  4A2L A;  3PSC B;  4J0X A;  4E54 B;  4L3H D;  3OKW A;  3RMZ D;  4J87 A;  3RFG A;  1K32 A;  3I2N A;  3UR4 A;  2H13 A;  3C5M A;  5EM2 B;  3J80 g;  2AH1 A;  3B7F A;  2P9U C;  2CNX A;  2J57 G;  5SXM A;  4A09 A;  4U1E I;  5TDH B;  2AGY A;  4J73 A;  4TZ4 A;  3IIY A;  1TBG A;  2HJB A;  1JMZ B;  2AH0 A;  2IAA A;  1PI6 A;  2PM6 B;  1YFQ A;  3JZG A;  2OVP B;  5EMJ B;  5CYK A;  3RRM C;  4JSV C;  3ORV D;  3UKR C;  4CI1 A;  5AMS A;  4GQB B;  4GM8 A;  3F3P A;  2CE8 A;  3IJ0 A;  1SQJ A;  3GFC A;  3JAM g;  4Y7R A;  2Z2P A;  2PM7 B;  5CXB A;  4CY5 A;  2UZY B;  2P9P C;  4PSX B;  3JRO A;  4GZ8 A;  2IUV A;  1K8K C;  4CY2 A;  2HXC A;  3C75 H;  4GGC A;  2IWF A;  4JD2 C;  5I5J A;  4ZOV A;  5JWZ A;  3ZWL B;  4EWR A;  2Z2N A;  2AGX A;  5C2W B;  5EAP A;  3PSL A;  4HDJ A;  3OL2 B;  3UVO A;  5I5I A;  4XYI A;  3F3F A;  3JRP A;  3VH0 A;  3VGZ A;  2IUR A;  2OJY A;  2YMU A;  5AFU 3;  2GC4 A;  4A0B A;  3MMY A;  3EI1 A;  4UI9 R;  5CXB B;  3DM0 A;  3SHF A;  2AGL A;  3W15 A;  3DXM C;  2I0T A;  4L9O A;  3PVU B;  3U4Y A;  5HE0 B;  3V7D B;  3SJL D;  3RFH A;  3SCY A;  4FA1 D;  2MTA H;  2GC7 A;  3EI2 A;  4NSX A;  2P9S C;  2P9K C;  3SBQ A;  4MK0 B;  5H17 A;  4H5I A;  4X3E A;  4J78 A;  2QXV A;  4J8B A;  1NEX B;  4GGA A;  2P9L C;  1GG2 B;  2CN3 A;  3DXK C;  4FWW A;  2YNP A;  3PVW B;  4X63 B;  4H5J A;  5TF2 A;  3NVQ A;  4X61 B;  4ERQ A;  4QRJ A;  3CFV A;  2OIZ A;  4J81 A;  2P9N C;  3AL8 A;  4CI8 A;  1PEV A;  3OTT A;  1P22 A;  2UZX B;  1RI6 A;  3EI4 B;  1L0Q A;  3OW8 A;  1TYQ C;  2B5N A;  1OLZ A;  2PM9 A;  3UVL A;  3FRX A;  4L3G D;  4FAV D;  5HYN B;  2CN2 A;  2G9A A;  2EBS A;  4CI3 A;  2XU7 A;  1PGU A;  2I3T A;  3I7L A;  4GMB A;  3UVK A;  2OK4 A;  4A11 A;  2W18 A;  3GRE A;  4JSP C;  1GXR A;  3I7H A;  2B5L A;  3MKQ A;  4A0A B;  1XKS A;  4L1Q D;  5CXC A;  1SHY B;  4XEI C;  3I7O A;  2OVQ B;  2GNQ A;  2H14 A;  4ES0 A;  4JT5 C;  4JT6 C;  2OK6 A;  4FHL A;  4BH6 A;  4IA9 A;  4R7A B;  4J0W A;  2H3X A;  3SLE D;  4CI2 A;  3SFZ A;  3RLM D;  4D6V A;  4N14 A;  1U2V C;  3BG1 A;  3MKS B;  2AGZ A;  4CZV A;  3ULE C;  5FQD A;  4XYH A;  4JXM A;  4PC0 A;  3SWS D;  2OVR B;  5AJA A;  3BWS A;  1N6F A;  4AEZ A;  4A09 B;  1ERJ A;  5C2V B;  4G56 B;  4A08 A;  5A2Q g;  3J81 g;  5IC7 A;  4QL1 A;  5CXC B;  1U4C A;  5EAR A;  1FWX A;  3SVW D;  3NVN A;  5CYK B;  5EAM A;  3SXT D;  2J56 H;  3RN1 D;  2I0R A;  3I8E A;  1N6E A;  2PBI B;  4ESG A;  3SN6 B;  4PXW A;  2H6N A;  2IUQ A;  4J86 A;  5KDO B;  1S4U X;  2H6Q A;  3V5W B;  5THA A;  2H9L A;  2H9P A;  3I7K A;  4ZN4 A;  4ZOZ A;  4J77 A;  4KFM B;  3SBP A;  1VYH C;  3RSE C;  4BUJ C;  2Z2O A;  4O45 A;  2G99 A;  2XYI A;  4I79 A;  1PBY B;  4Z8L A;  2O9K A;  2XL2 A;  5I5M A;  2QC5 A;  1JOF A;  4PNK B;  3FM0 A;  2B4E A;  2H9N A;  4K3J B;  3KRX B;  4FA4 D;  4ERY A;  2BBK H;  5K1C C;  4E5Z A;  1XIP A;  4LG9 A;  4ERZ A;  4PSW B;  3RN0 D;  2AQ5 A;  5FKQ A;  5GXH A;  4GQ2 P;  4A0B B;  4OZU A;  3EI1 B;  5EAL A;  2H47 A;  4O3U B;  1JMX B;  3K27 A;  5EMK B;  5EML B;  3UKU C;  1MG2 A;  3JZN A;  3EI2 B;  2H9M A;  1GOT B;  3MZK A;  2YBA A;  2YB8 B;  3MXX A;  2AGW A;  2CO0 C;  2B5M A;  3JB9 L;  5IT9 g;  1A0R B;  5HE2 B;  5HE1 B;  4GQ1 A;  3VA6 A;  5FKS A;  3HFQ A;  4CY1 A;  4PBY A;  3P4F A;  4LG8 A;  5EMM B;  5H14 A;  1Q47 A;  5H1M A;  5HQG A;  3UVM A;  3EU7 A;  4E5Z B;  3SBR A;  4J82 A;  3OKY A;  3IJC A;  4U7A A;  3IJ1 A;  4FAN D;  3AL8 B;  1MG3 A;  4FB1 D;  2H68 A;  3EG6 A;  3JPX A;  4O1Q D;  4GM9 A; 
#chains in the Genus database with same CATH topology
 2Q7Q A;  4LGN A;  2CO0 A;  4GM3 A;  3ZDX A;  1B9Y A;  5TEF A;  5C9Z B;  1R5M A;  1GP2 B;  4WK0 A;  1I2M B;  3N0E A;  4A2M A;  1QNI A;  2XL3 A;  5M5V A;  1SQ9 A;  2HU8 A;  4BL0 A;  4QT8 A;  2PM9 B;  4FA5 D;  4JSX C;  3EMH A;  4ZOY A;  1NR0 A;  3ODT A;  5M5R A;  3OL2 A;  3AFC A;  4CZX A;  2J55 H;  3CIK B;  1A12 A;  3EWE A;  3ZDY A;  3GC3 B;  4AMY A;  4A11 B;  4JSN C;  4NBM A;  3EI3 A;  3AL9 A;  5TEE A;  5FXY A;  3E0C A;  2HKM A;  4Y5R D;  2VDN A;  4J8G A;  3I8C A;  3C99 A;  4MMZ A;  5IGQ A;  2YNN A;  1XHM A;  3A0F A;  4AOW A;  2EIC A;  3OKY B;  4BP8 A;  3PXS D;  1MDA H;  1K3I A;  2VDL A;  5M61 A;  4X60 B;  2IUP A;  3IVM A;  2HJ4 A;  4QQE A;  3KRW B;  3I89 A;  4A7J A;  3SMR A;  1N6D A;  4ZOX A;  2BCJ B;  2I3S A;  3JZH A;  1OMW B;  3CFS B;  1VZ3 A;  4K3I D;  4PBZ A;  5B4W A;  4GGD A;  4D0K A;  5GMK n;  3PXW D;  5IGO A;  2IWK A;  4AN0 A;  3IJE A;  3AH8 B;  2P9I C;  5IJ8 E;  3DSM A;  3I7N A;  3PXT D;  3EI3 B;  3L4M D;  5E6R A;  3BG0 A;  2HES X;  4A08 B;  3UVN A;  5HE3 B;  3N0D A;  3FGB A;  1B9X A;  4YVD A;  5HDB A;  4CC9 A;  3NVX A;  4E54 A;  4O3T B;  3EI4 A;  3IKO A;  4J84 A;  4Z7O A;  3L4O D;  1GOF A;  4CY3 A;  3MZL A;  3C9C A;  3IIW A;  5EM2 A;  5FKT A;  3PE7 A;  3DWL C;  5GSA A;  3T3P A;  3EQ7 A;  3I7P A;  3F3G A;  3IUL A;  5FKR A;  5IJ7 E;  1UOP A;  1H2Y A;  5FLX g;  5GXI A;  4G1M A;  3K6S A;  2WQ8 A;  4A0A A;  2HKR A;  4OWR A;  2CE9 A;  5FFO A;  2HYE A;  4FA9 D;  5K19 A;  2YNO A;  3V9F A;  4CZY A;  2I0S A;  2H6K A;  3K26 A;  4O9D A;  5C86 A;  3OKT A;  1JJU B;  5FA5 B;  2TRC B;  4J79 A;  4IMM A;  4A2L A;  3PSC B;  4J0X A;  5M5U A;  4E54 B;  4L3H D;  1VZ2 A;  3OKW A;  4O02 A;  3RMZ D;  3GD1 I;  4J87 A;  3RFG A;  1K32 A;  3I2N A;  3UR4 A;  1GOH A;  2H13 A;  2XE4 A;  3C5M A;  4BP9 A;  2VZ1 A;  5EM2 B;  3J80 g;  1TYE A;  2AH1 A;  2VZ3 A;  2VDO A;  3B7F A;  2P9U C;  4AMZ A;  2CNX A;  1VE7 A;  1H2Z A;  2J57 G;  5SXM A;  4A09 A;  4U1E I;  5TDH B;  2AGY A;  5FFG A;  4J73 A;  4TZ4 A;  3IIY A;  1TBG A;  2HJB A;  1JMZ B;  1UOQ A;  5M5S A;  2AH0 A;  2XDW A;  4MMY A;  2IAA A;  3K71 A;  1PI6 A;  3MUN A;  2PM6 B;  1YFQ A;  3JZG A;  2OVP B;  5EMJ B;  5CYK A;  3RRM C;  4JSV C;  3ORV D;  3UKR C;  3KCI A;  4CI1 A;  5AMS A;  4GQB B;  2JKX A;  3F3P A;  4GM8 A;  3FCU A;  2CE8 A;  3IJ0 A;  1SQJ A;  3GFC A;  3JAM g;  4Y7R A;  1H2X A;  3V4V A;  2Z2P A;  3ZE2 A;  2PM7 B;  5CXB A;  4CY5 A;  2UZY B;  2P9P C;  4Z7Q A;  4PSX B;  4NEN A;  3JRO A;  4GZ8 A;  2IUV A;  4MMX A;  1K8K C;  4CY2 A;  2HXC A;  3C75 H;  1C9L A;  4GGC A;  4AN1 A;  2IWF A;  4JD2 C;  4BCB A;  5I5J A;  2EIB A;  4ZOV A;  5JWZ A;  3ZWL B;  4EWR A;  2Z2N A;  2AGX A;  5E6U A;  5C2W B;  5EAP A;  3ZDZ A;  3O4I A;  3PSL A;  4BCC A;  4HDJ A;  3OL2 B;  3UVO A;  5I5I A;  4XYI A;  3F3F A;  3V4P A;  3JRP A;  3VH0 A;  1YR2 A;  3NID A;  3VGZ A;  2IUR A;  1T2X A;  2OJY A;  2YMU A;  5AFU 3;  2QR5 A;  2GC4 A;  4A0B A;  3MMY A;  3EI1 A;  4UI9 R;  5CXB B;  3DM0 A;  3SHF A;  2AGL A;  1E5T A;  2VDM A;  3W15 A;  3DXM C;  2I0T A;  4L9O A;  3PVU B;  1M1X A;  3U4Y A;  5HE0 B;  3MUO A;  3V7D B;  3SJL D;  3RFH A;  3SCY A;  4FA1 D;  2BKL A;  2MTA H;  2GC7 A;  3EI2 A;  4NSX A;  2P9S C;  4L1M A;  2P9K C;  3SBQ A;  4MK0 B;  5H17 A;  4H5I A;  2VDK A;  4X3E A;  4J78 A;  2QXV A;  4J8B A;  1NEX B;  4G55 A;  3EQ8 A;  4GGA A;  2P9L C;  1GG2 B;  2EIE A;  2CN3 A;  3VI3 A;  3DXK C;  4FWW A;  2YNP A;  3PVW B;  4Z7N A;  3IUJ A;  4X63 B;  4H5J A;  5TF2 A;  3NVQ A;  4X61 B;  4ERQ A;  4QRJ A;  1U8C A;  3CFV A;  2OIZ A;  1UTC A;  2P9N C;  3AL8 A;  4J81 A;  4CI8 A;  1PEV A;  3OTT A;  4DNV A;  1P22 A;  3ZE1 A;  2UZX B;  1RI6 A;  3EI4 B;  1L0Q A;  3OW8 A;  1TYQ C;  2B5N A;  1OLZ A;  4AX4 A;  2PM9 A;  3UVL A;  3FRX A;  4L3G D;  4FAV D;  5HYN B;  2CN2 A;  2G9A A;  3MVD K;  2EBS A;  4CI3 A;  2XU7 A;  1PGU A;  2I3T A;  3I7L A;  4GMB A;  3UVK A;  3ZE0 A;  2OK4 A;  4A11 A;  2HU7 A;  2W18 A;  3GRE A;  4JSP C;  4WJK A;  1GXR A;  2VC2 A;  2B5L A;  1H2W A;  3I7H A;  3MKQ A;  4A0A B;  1XKS A;  4L1Q D;  5CXC A;  1SHY B;  4XEI C;  3I7O A;  2OVQ B;  2GNQ A;  1QFM A;  1QFS A;  2H14 A;  4ES0 A;  4JT5 C;  3T3M A;  4JT6 C;  2OK6 A;  4FHL A;  4BH6 A;  4IA9 A;  3O4H A;  4R7A B;  4G1E A;  4J0W A;  2H3X A;  3SLE D;  4CI2 A;  3SFZ A;  3RLM D;  4D6V A;  4N14 A;  5E6S A;  1U2V C;  3BG1 A;  4WK2 A;  3MKS B;  4QAM A;  2AGZ A;  4CZV A;  2XZG A;  3ULE C;  5FQD A;  4XYH A;  3K72 A;  4JXM A;  4O2W A;  4PC0 A;  3SWS D;  2OVR B;  5AJA A;  3BWS A;  1N6F A;  4AEZ A;  4A09 B;  1O6G A;  2HU5 A;  1ERJ A;  5C2V B;  4G56 B;  4A08 A;  5A2Q g;  3J81 g;  4NC4 A;  5IC7 A;  1C9I A;  1L5G A;  4QL1 A;  5CXC B;  1U4C A;  4UM8 A;  5EAR A;  1FWX A;  3SVW D;  3NVN A;  5CYK B;  5EAM A;  3SXT D;  2J56 H;  3RN1 D;  2I0R A;  3DDU A;  3I8E A;  1N6E A;  2PBI B;  4ESG A;  4BCD A;  3SN6 B;  1GOG A;  4PXW A;  2H6N A;  2IUQ A;  4J86 A;  5C92 A;  5KDO B;  1S4U X;  2H6Q A;  3V5W B;  5M5T A;  5THA A;  2H9L A;  2H9P A;  3I7K A;  3NIF A;  4ZN4 A;  4ZOZ A;  4J77 A;  2VDQ A;  4KFM B;  3SBP A;  1BPO A;  1VYH C;  3RSE C;  4BUJ C;  1E8N A;  2Z2O A;  4O45 A;  3QHY B;  2G99 A;  2XYI A;  4I79 A;  1PBY B;  4UM9 A;  4RE5 A;  4JHN A;  4Z8L A;  2O9K A;  1JTD B;  2XL2 A;  3IUR A;  5I5M A;  2QC5 A;  1JOF A;  2VDP A;  3IUQ A;  4PNK B;  3NIG A;  3FM0 A;  2B4E A;  4DNW A;  2H9N A;  4K3J B;  1JV2 A;  3KRX B;  4FA4 D;  3VI4 A;  1VE6 A;  4ERY A;  2BBK H;  5K1C C;  4E5Z A;  4DNU A;  1XIP A;  4LG9 A;  4ERZ A;  4RE6 A;  3EQ9 A;  4PSW B;  3RN0 D;  2AQ5 A;  5FKQ A;  4D9S A;  3QI0 A;  5GXH A;  4GQ2 P;  4A0B B;  4OZU A;  3EI1 B;  5EAL A;  2H47 A;  4O3U B;  1JMX B;  1O6F A;  3K27 A;  5EMK B;  5EML B;  1E8M A;  3UKU C;  1MG2 A;  4WK4 A;  3JZN A;  3EI2 B;  2H9M A;  1GOT B;  3MZK A;  2YBA A;  2YB8 B;  3MXX A;  2AGW A;  2CO0 C;  2B5M A;  3IUN A;  3JB9 L;  5IT9 g;  1A0R B;  3OF7 A;  5HE2 B;  5HE1 B;  4GQ1 A;  3O4G A;  3VA6 A;  3O4J A;  4IRZ A;  5FKS A;  3FCS A;  3HFQ A;  4CY1 A;  4PBY A;  4JHP C;  2QZP A;  3P4F A;  4LG8 A;  5EMM B;  5H14 A;  1Q47 A;  5H1M A;  2VDR A;  3IUM A;  5HQG A;  3UVM A;  3EU7 A;  4E5Z B;  3SBR A;  4J82 A;  3OKY A;  3IJC A;  1UOO A;  4U7A A;  3IJ1 A;  4FAN D;  3AL8 B;  1MG3 A;  4NAA A;  4FB1 D;  2EID A;  2H68 A;  3EG6 A;  3JPX A;  4O1Q D;  4GM9 A; 
#chains in the Genus database with same CATH homology
 2Q7Q A;  4LGN A;  2CO0 A;  4GM3 A;  1B9Y A;  5TEF A;  5C9Z B;  1R5M A;  1GP2 B;  3N0E A;  4A2M A;  1QNI A;  2XL3 A;  1SQ9 A;  4BL0 A;  4QT8 A;  2PM9 B;  4FA5 D;  4JSX C;  3EMH A;  4ZOY A;  1NR0 A;  3ODT A;  3OL2 A;  3AFC A;  4CZX A;  2J55 H;  3CIK B;  3EWE A;  4A11 B;  4JSN C;  3EI3 A;  3AL9 A;  5TEE A;  5FXY A;  3E0C A;  2HKM A;  4Y5R D;  4J8G A;  3I8C A;  3C99 A;  5IGQ A;  2YNN A;  1XHM A;  3A0F A;  4AOW A;  3OKY B;  3PXS D;  1MDA H;  4X60 B;  2IUP A;  2HJ4 A;  4QQE A;  3KRW B;  3I89 A;  4A7J A;  3SMR A;  1N6D A;  4ZOX A;  2BCJ B;  2I3S A;  3JZH A;  1OMW B;  3CFS B;  4K3I D;  4PBZ A;  5B4W A;  4GGD A;  4D0K A;  5GMK n;  3PXW D;  5IGO A;  2IWK A;  3AH8 B;  2P9I C;  5IJ8 E;  3DSM A;  3I7N A;  3PXT D;  3EI3 B;  3L4M D;  3BG0 A;  2HES X;  4A08 B;  3UVN A;  5HE3 B;  3N0D A;  3FGB A;  1B9X A;  4YVD A;  4CC9 A;  3NVX A;  4E54 A;  4O3T B;  3EI4 A;  3IKO A;  4J84 A;  3L4O D;  4CY3 A;  3MZL A;  3C9C A;  3IIW A;  5EM2 A;  5FKT A;  3PE7 A;  3DWL C;  5GSA A;  3I7P A;  3F3G A;  5FKR A;  5IJ7 E;  5FLX g;  5GXI A;  4A0A A;  2HKR A;  4OWR A;  2CE9 A;  2HYE A;  4FA9 D;  5K19 A;  2YNO A;  3V9F A;  4CZY A;  2I0S A;  2H6K A;  3K26 A;  4O9D A;  3OKT A;  1JJU B;  5FA5 B;  2TRC B;  4J79 A;  4IMM A;  4A2L A;  3PSC B;  4J0X A;  4E54 B;  4L3H D;  3OKW A;  3RMZ D;  4J87 A;  3RFG A;  1K32 A;  3I2N A;  3UR4 A;  2H13 A;  3C5M A;  5EM2 B;  3J80 g;  2AH1 A;  3B7F A;  2P9U C;  2CNX A;  2J57 G;  5SXM A;  4A09 A;  4U1E I;  5TDH B;  2AGY A;  4J73 A;  4TZ4 A;  3IIY A;  1TBG A;  2HJB A;  1JMZ B;  2AH0 A;  2IAA A;  1PI6 A;  2PM6 B;  1YFQ A;  3JZG A;  2OVP B;  5EMJ B;  5CYK A;  3RRM C;  4JSV C;  3ORV D;  3UKR C;  4CI1 A;  5AMS A;  4GQB B;  4GM8 A;  3F3P A;  2CE8 A;  3IJ0 A;  1SQJ A;  3GFC A;  3JAM g;  4Y7R A;  2Z2P A;  2PM7 B;  5CXB A;  4CY5 A;  2UZY B;  2P9P C;  4PSX B;  3JRO A;  4GZ8 A;  2IUV A;  1K8K C;  4CY2 A;  2HXC A;  3C75 H;  4GGC A;  2IWF A;  4JD2 C;  5I5J A;  4ZOV A;  5JWZ A;  3ZWL B;  4EWR A;  2Z2N A;  2AGX A;  5C2W B;  5EAP A;  3PSL A;  4HDJ A;  3OL2 B;  3UVO A;  5I5I A;  4XYI A;  3F3F A;  3JRP A;  3VH0 A;  3VGZ A;  2IUR A;  2OJY A;  2YMU A;  5AFU 3;  2GC4 A;  4A0B A;  3MMY A;  3EI1 A;  4UI9 R;  5CXB B;  3DM0 A;  3SHF A;  2AGL A;  3W15 A;  3DXM C;  2I0T A;  4L9O A;  3PVU B;  3U4Y A;  5HE0 B;  3V7D B;  3SJL D;  3RFH A;  3SCY A;  4FA1 D;  2MTA H;  2GC7 A;  3EI2 A;  4NSX A;  2P9S C;  2P9K C;  3SBQ A;  4MK0 B;  5H17 A;  4H5I A;  4X3E A;  4J78 A;  2QXV A;  4J8B A;  1NEX B;  4GGA A;  2P9L C;  1GG2 B;  2CN3 A;  3DXK C;  4FWW A;  2YNP A;  3PVW B;  4X63 B;  4H5J A;  5TF2 A;  3NVQ A;  4X61 B;  4ERQ A;  4QRJ A;  3CFV A;  2OIZ A;  4J81 A;  2P9N C;  3AL8 A;  4CI8 A;  1PEV A;  3OTT A;  1P22 A;  2UZX B;  1RI6 A;  3EI4 B;  1L0Q A;  3OW8 A;  1TYQ C;  2B5N A;  1OLZ A;  2PM9 A;  3UVL A;  3FRX A;  4L3G D;  4FAV D;  5HYN B;  2CN2 A;  2G9A A;  2EBS A;  4CI3 A;  2XU7 A;  1PGU A;  2I3T A;  3I7L A;  4GMB A;  3UVK A;  2OK4 A;  4A11 A;  2W18 A;  3GRE A;  4JSP C;  1GXR A;  3I7H A;  2B5L A;  3MKQ A;  4A0A B;  1XKS A;  4L1Q D;  5CXC A;  1SHY B;  4XEI C;  3I7O A;  2OVQ B;  2GNQ A;  2H14 A;  4ES0 A;  4JT5 C;  4JT6 C;  2OK6 A;  4FHL A;  4BH6 A;  4IA9 A;  4R7A B;  4J0W A;  2H3X A;  3SLE D;  4CI2 A;  3SFZ A;  3RLM D;  4D6V A;  4N14 A;  1U2V C;  3BG1 A;  3MKS B;  2AGZ A;  4CZV A;  3ULE C;  5FQD A;  4XYH A;  4JXM A;  4PC0 A;  3SWS D;  2OVR B;  5AJA A;  3BWS A;  1N6F A;  4AEZ A;  4A09 B;  1ERJ A;  5C2V B;  4G56 B;  4A08 A;  5A2Q g;  3J81 g;  5IC7 A;  4QL1 A;  5CXC B;  1U4C A;  5EAR A;  1FWX A;  3SVW D;  3NVN A;  5CYK B;  5EAM A;  3SXT D;  2J56 H;  3RN1 D;  2I0R A;  3I8E A;  1N6E A;  2PBI B;  4ESG A;  3SN6 B;  4PXW A;  2H6N A;  2IUQ A;  4J86 A;  5KDO B;  1S4U X;  2H6Q A;  3V5W B;  5THA A;  2H9L A;  2H9P A;  3I7K A;  4ZN4 A;  4ZOZ A;  4J77 A;  4KFM B;  3SBP A;  1VYH C;  3RSE C;  4BUJ C;  2Z2O A;  4O45 A;  2G99 A;  2XYI A;  4I79 A;  1PBY B;  4Z8L A;  2O9K A;  2XL2 A;  5I5M A;  2QC5 A;  1JOF A;  4PNK B;  3FM0 A;  2B4E A;  2H9N A;  4K3J B;  3KRX B;  4FA4 D;  4ERY A;  2BBK H;  5K1C C;  4E5Z A;  1XIP A;  4LG9 A;  4ERZ A;  4PSW B;  3RN0 D;  2AQ5 A;  5FKQ A;  5GXH A;  4GQ2 P;  4A0B B;  4OZU A;  3EI1 B;  5EAL A;  2H47 A;  4O3U B;  1JMX B;  3K27 A;  5EMK B;  5EML B;  3UKU C;  1MG2 A;  3JZN A;  3EI2 B;  2H9M A;  1GOT B;  3MZK A;  2YBA A;  2YB8 B;  3MXX A;  2AGW A;  2CO0 C;  2B5M A;  3JB9 L;  5IT9 g;  1A0R B;  5HE2 B;  5HE1 B;  4GQ1 A;  3VA6 A;  5FKS A;  3HFQ A;  4CY1 A;  4PBY A;  3P4F A;  4LG8 A;  5EMM B;  5H14 A;  1Q47 A;  5H1M A;  5HQG A;  3UVM A;  3EU7 A;  4E5Z B;  3SBR A;  4J82 A;  3OKY A;  3IJC A;  4U7A A;  3IJ1 A;  4FAN D;  3AL8 B;  1MG3 A;  4FB1 D;  2H68 A;  3EG6 A;  3JPX A;  4O1Q D;  4GM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...