2HKMA

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with phenylethylamine.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
360
structure length
360
Chain Sequence
b'REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
molecule tags Oxidoreductase
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
total genus 95
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hkmA01
3OKYA 3IJCA 3DM0A 1S4UX 3IIWA 4L9OA 5EMLB 3EMHA 5THAA 3I7NA 2UZYB 4TZ4A 2J55H 3JB9L 3UR4A 2TRCB 1TYQC 4QQEA 4ZN4A 1MG3A 3EU7A 4U1EI 3I2NA 3MKSB 2BBKH 1GP2B 2YNNA 2I3TA 2HJ4A 3KRWB 4GGCA 4A2LA 2IURA 4JT6C 1MDAH 1TBGA 4R7AB 1OLZA 5CXCB 4J87A 5EMJB 4X61B 5EMMB 5FKTA 3PSLA 5AMSA 5HQGA 3MMYA 3SMRA 3IKOA 4O1QD 3SXTD 2OK4A 3I7KA 4Y5RD 3C9CA 1N6FA 3I7LA 4JSXC 5CXCA 1YFQA 3JZNA 3RN0D 2H9NA 1VYHC 2B5MA 3PXSD 4XEIC 4FAVD 4E5ZB 3ULEC 4GM9A 4A7JA 4J79A 4X60B 2H68A 4O45A 2UZXB 5GSAA 2AH0A 4J73A 3SJLD 4A0AB 5EALA 3AFCA 5JWZA 3VA6A 4J8BA 1N6DA 5IGQA 5AFU3 3UVLA 3MZLA 4G56B 2B4EA 2HJBA 2OJYA 4D0KA 1B9XA 1NR0A 3GFCA 2H9LA 2H3XA 3RN1D 2H13A 4J82A 1PBYB 5C9ZB 2QC5A 1Q47A 1MG2A 4FA1D 1PEVA 2IWKA 3F3PA 2GNQA 2BCJB 4J81A 4CZVA 3FGBA 1K8KC 3CFVA 4JT5C 5I5JA 2IUVA 3UVKA 3EI3A 2W18A 3A0FA 3JAMg 2CO0C 2QXVA 4ESGA 4OWRA 5HE3B 2XYIA 4PBYA 3CIKB 4GGAA 3UVNA 5K1CC 3OTTA 5GMKn 2P9UC 3FM0A 3SWSD 4ERQA 4CY1A 3RRMC 3VH0A 4E54A 2B5NA 5GXIA 3OKYB 2I0RA 5H14A 4J0WA 2IWFA 3EI4B 1L0QA 5C2VB 2I0TA 3SHFA 5EMKB 3UKUC 3EI4A 2J56H 3PVWB 3KRXB 4GMBA 2AGZA 3CFSB 3HFQA 4GQ1A 4FA5D 5CYKA 2AGLA 1A0RB 3UVOA 3OKTA 1GG2B 3EI1A 3EWEA 1U2VC 3SN6B 4JSVC 2YNPA 3DWLC 5CXBB 5IGOA 4LG9A 3PE7A 4GQ2P 2P9SC 4JSPC 5HE2B 5FXYA 4CY5A 3SBRA 4O3UB 3P4FA 4JXMA 4PBZA 2P9PC 3OL2A 4FHLA 4CC9A 2G99A 4MK0B 3V9FA 3AL9A 2CNXA 4ZOYA 4A0BB 4QL1A 5IJ7E 3JPXA 2PM9A 1XKSA 5TF2A 4GM8A 3PXWD 4E54B 4X3EA 4N14A 4AOWA 5GXHA 3SFZA 2CO0A 3PXTD 2AGXA 4O3TB 5EM2A 5FA5B 4J77A 3JZGA 4ZOZA 2PM6B 4UI9R 5EM2B 4LGNA 4A2MA 3EI3B 4LG8A 3OKWA 3BG1A 2YBAA 5HYNB 4A0AA 3PSCB 3I8CA 1JOFA 5AJAA 2IUQA 4KFMB 5EAMA 4Y7RA 2H6NA 3C99A 2XL2A 4IMMA 3J80g 1XHMA 4BH6A 3RLMD 3W15A 4FA9D 2I3SA 1SHYB 4AEZA 3L4OD 3SBPA 4EWRA 3V7DB 4A0BA 5EARA 4ZOXA 5SXMA 2G9AA 4CI1A 4XYHA 2CN3A 1XIPA 3EI2A 1ERJA 3SVWD 3ZWLB 4GQBB 3VGZA 4GM3A 5FKRA 3IIYA 3AL8B 1PGUA 3FRXA 4GGDA 1GOTB 2IUPA 2H9PA 4J0XA 2H47A 2OVPB 3I7PA 3ORVD 4ERYA 5FKQA 3UKRC 5I5IA 2MTAH 4A08B 4QRJA 2H9MA 5TEFA 4CZYA 3RFHA 3N0DA 2P9LC 3BWSA 2Z2PA 4CI8A 4JD2C 4CI2A 4XYIA 3RSEC 1FWXA 3ODTA 4JSNC 1PI6A 4A11A 3BG0A 1SQJA 4L1QD 2XU7A 4A11B 3UVMA 5FKSA 3K26A 4BL0A 2YNOA 1JJUB 5HE1B 5CXBA 3E0CA 3SBQA 4J8GA 4E5ZA 2PM7B 2YB8B 3JRPA 2GC7A 3AL8A 2P9IC 3RMZD 4L3GD 3U4YA 2H6KA 2HXCA 3I89A 5HE0B 2AGYA 3JZHA 2P9KC 3EG6A 2AH1A 2AGWA 4PSXB 3F3FA 2CE9A 3SLED 3JROA 2Z2OA 3I7OA 5KDOB 3DXMC 5IT9g 1NEXB 3DXKC 3MKQA 2HYEA 1N6EA 4PXWA 2IAAA 4PNKB 3GREA 5IJ8E 4ZOVA 2CE8A 1JMZB 4CY2A 3IJ0A 4ERZA 1K32A 2H6QA 3J81g 4J86A 2P9NC 4L3HD 2EBSA 4K3ID 5CYKB 3L4MD 4FB1D 5C2WB 2B5LA 5H1MA 3V5WB 5A2Qg 3OL2B 4PSWB 4H5JA 1B9YA 4HDJA 2J57G 1RI6A 4H5IA 1U4CA 2OK6A 2HKRA 2AQ5A 4PC0A 4BUJC 4GZ8A 4CY3A 4D6VA 2OIZA 2OVRB 3NVQA 3I7HA 4A09B 2PBIB 2HKMA 2H14A 2YMUA 2GC4A 4FWWA 5TEEA 3SCYA 3EI1B 1OMWB 4K3JB 2OVQB 2HESX 5I5MA 4ES0A 4CZXA 4A09A 3MXXA 3AH8B 3RFGA 5B4WA 2CN2A 4NSXA 3K27A 2Q7QA 3NVNA 4Z8LA 5EAPA 5K19A 1QNIA 1R5MA 5FLXg 2XL3A 3C75H 4YVDA 5FQDA 3PVUB 2PM9B 4FAND 4OZUA 2I0SA 3DSMA 4I79A 1P22A 3C5MA 1GXRA 4J78A 3NVXA 3IJ1A 4O9DA 3I8EA 4X63B 5IC7A 2Z2NA 4FA4D 3OW8A 3MZKA 4J84A 4QT8A 3F3GA 4IA9A 4A08A 4U7AA 2O9KA 5TDHB 5H17A 1SQ9A 3B7FA 3N0EA 3EI2B 4CI3A 1JMXB
chains in the Genus database with same CATH superfamily
3OKYA 3IJCA 3DM0A 3IUQA 1S4UX 3IIWA 4L9OA 5EMLB 3EMHA 5THAA 3I7NA 3EQ8A 2UZYB 3VI3A 4QAMA 4TZ4A 1C9LA 2J55H 3JB9L 3UR4A 2TRCB 1TYQC 4QQEA 4ZN4A 3ZE0A 1MG3A 3EU7A 4U1EI 3I2NA 3MKSB 2BBKH 1GP2B 3V4VA 2YNNA 2I3TA 2HJ4A 3KRWB 4GGCA 3K72A 4A2LA 2IURA 1VZ3A 4JT6C 1MDAH 1TBGA 3IVMA 1O6GA 4Z7QA 1GOFA 3ZDXA 3DDUA 4R7AB 1OLZA 5CXCB 4J87A 5EMJB 4X61B 5EMMB 1E5TA 5FKTA 3FCUA 3PSLA 4G1MA 5AMSA 5HQGA 3MMYA 3SMRA 3IKOA 4O1QD 3SXTD 2OK4A 3I7KA 4Y5RD 1TYEA 3C9CA 1N6FA 3I7LA 4JSXC 5CXCA 1YFQA 3JZNA 1K3IA 3IULA 3RN0D 2H9NA 2WQ8A 1VYHC 2B5MA 3PXSD 4XEIC 4FAVD 3NIFA 4E5ZB 3ULEC 4GM9A 4A7JA 4J79A 4X60B 4BP9A 3O4GA 2H68A 4O45A 2UZXB 5GSAA 2VDMA 4RE6A 2AH0A 1H2ZA 4J73A 3SJLD 4A0AB 5EALA 3AFCA 5JWZA 3GC3B 3VA6A 4J8BA 1N6DA 5IGQA 5AFU3 3UVLA 3MZLA 3IUJA 4G56B 1UOPA 3ZDZA 4D9SA 2B4EA 2HJBA 4JHNA 4O2WA 4AMZA 2OJYA 4D0KA 1B9XA 2VDLA 1NR0A 3GFCA 2H9LA 2H3XA 3RN1D 3IJEA 2H13A 4J82A 4Z7NA 1PBYB 5C9ZB 3MUNA 1E8NA 2QC5A 3OF7A 1Q47A 5M5UA 1MG2A 3IUMA 1PEVA 2IWKA 4FA1D 3F3PA 1QFSA 2GNQA 2BCJB 4J81A 4CZVA 3FGBA 1K8KC 3CFVA 4JT5C 5I5JA 2IUVA 3UVKA 3EI3A 2W18A 3A0FA 3JAMg 4WK0A 2CO0C 3O4IA 2QXVA 4ESGA 4OWRA 5HE3B 2XYIA 2VDOA 4PBYA 3CIKB 2EICA 4IRZA 4GGAA 3UVNA 5K1CC 3OTTA 5GMKn 3V4PA 2P9UC 3FM0A 3SWSD 4ERQA 4CY1A 3RRMC 3VH0A 1JTDB 4E54A 2B5NA 5GXIA 1H2YA 3OKYB 2I0RA 2BKLA 5H14A 2VC2A 4J0WA 3T3MA 2IWFA 3EI4B 1L0QA 5M5VA 5C2VB 2I0TA 4L1MA 3SHFA 5EMKB 3UKUC 5M5RA 3EI4A 2EIEA 2J56H 3PVWB 2VDRA 3KRXB 4GMBA 2AGZA 3CFSB 3HFQA 4NENA 4GQ1A 4UM9A 4FA5D 5CYKA 2AGLA 1A0RB 3UVOA 3OKTA 1GG2B 3EI1A 3MVDK 3EWEA 2VZ3A 1U2VC 3SN6B 1UOOA 4JSVC 2YNPA 3FCSA 2EIBA 3DWLC 5CXBB 5IGOA 4G1EA 1L5GA 3NIGA 4LG9A 3PE7A 4GQ2P 2P9SC 4JSPC 5HE2B 5FXYA 4CY5A 3SBRA 4NAAA 4AX4A 4O3UB 3P4FA 4JXMA 4PBZA 2P9PC 3OL2A 4FHLA 2HU7A 5M5TA 4CC9A 2G99A 4MK0B 3V9FA 3AL9A 2CNXA 4ZOYA 4A0BB 4QL1A 5IJ7E 3JPXA 2PM9A 4BCBA 1XKSA 1T2XA 2HU8A 3O4HA 5TF2A 4GM8A 3PXWD 4E54B 3VI4A 4X3EA 4N14A 4AOWA 4G55A 5GXHA 3SFZA 2CO0A 4NBMA 3PXTD 2AGXA 4O3TB 5EM2A 5FA5B 2VZ1A 3JZGA 4J77A 4ZOZA 4AMYA 1UTCA 2PM6B 4UI9R 5EM2B 4LGNA 4A2MA 3EI3B 4LG8A 3OKWA 3BG1A 2YBAA 5HYNB 4A0AA 3PSCB 4MMZA 1QFMA 3I8CA 1JOFA 5AJAA 5FFOA 2IUQA 4KFMB 5EAMA 4DNVA 3O4JA 4Y7RA 2H6NA 3QI0A 3C99A 2XL2A 4IMMA 1YR2A 3J80g 1XHMA 4BH6A 3RLMD 3W15A 4FA9D 2I3SA 1SHYB 2HU5A 4AEZA 3L4OD 3SBPA 4EWRA 3V7DB 4A0BA 5EARA 4ZOXA 5SXMA 5C92A 2G9AA 4CI1A 4XYHA 2CN3A 1XIPA 2XDWA 3EI2A 1ERJA 3SVWD 3ZWLB 4GQBB 3VGZA 4GM3A 5FKRA 3IIYA 3AL8B 4AN1A 1PGUA 3FRXA 1GOGA 4BCCA 4GGDA 1GOTB 2IUPA 2H9PA 2H47A 2OVPB 3I7PA 4J0XA 3ORVD 4ERYA 2VDPA 5FKQA 5HDBA 3UKRC 5I5IA 1U8CA 2MTAH 4A08B 3ZDYA 4WK2A 4QRJA 2XE4A 1VZ2A 2H9MA 2QZPA 5TEFA 4CZYA 3RFHA 1O6FA 3N0DA 2P9LC 3EQ9A 1GOHA 3BWSA 2Z2PA 4CI8A 4JD2C 1C9IA 4CI2A 3NIDA 4XYIA 3RSEC 1FWXA 3ODTA 4JSNC 1PI6A 3IURA 4A11A 3BG0A 1SQJA 1VE6A 4L1QD 2XU7A 5M61A 3KCIA 5E6SA 4A11B 3UVMA 5FKSA 3K26A 4BL0A 2YNOA 2QR5A 1JJUB 5HE1B 5CXBA 3E0CA 3SBQA 4J8GA 4E5ZA 2PM7B 2VDQA 2YB8B 3JRPA 2GC7A 3AL8A 2P9IC 3GD1I 4JHPC 3RMZD 4L3GD 3U4YA 2H6KA 3K6SA 3I89A 2HXCA 5HE0B 3JZHA 2AGYA 2P9KC 3EG6A 2AH1A 2AGWA 4PSXB 3F3FA 2CE9A 3SLED 3JROA 2Z2OA 3I7OA 3ZE2A 5KDOB 4UM8A 3DXMC 5IT9g 3MUOA 1NEXB 3DXKC 1M1XA 3MKQA 2HYEA 4BCDA 1N6EA 4PXWA 2IAAA 4PNKB 3GREA 5IJ8E 4ZOVA 2CE8A 1JMZB 4CY2A 3IJ0A 3ZE1A 4AN0A 4ERZA 1H2WA 1K32A 2H6QA 3J81g 4J86A 2VDKA 2P9NC 4L3HD 2EBSA 4K3ID 5CYKB 3L4MD 4FB1D 4DNUA 4O02A 4DNWA 5C2WB 2B5LA 5H1MA 3V5WB 3QHYB 4MMYA 5A2Qg 3OL2B 4PSWB 4H5JA 2VDNA 2JKXA 1B9YA 4HDJA 2J57G 1JV2A 1RI6A 4H5IA 1U4CA 2OK6A 2HKRA 2AQ5A 4PC0A 4BUJC 4Z7OA 4GZ8A 4CY3A 4D6VA 2OIZA 2OVRB 3NVQA 3I7HA 4A09B 2PBIB 4MMXA 2HKMA 2H14A 2YMUA 2GC4A 4WK4A 4FWWA 5TEEA 3SCYA 3EI1B 1OMWB 4K3JB 2OVQB 2HESX 5FFGA 5I5MA 4ES0A 4CZXA 4A09A 3MXXA 4NC4A 1H2XA 3AH8B 3RFGA 5E6UA 5B4WA 5M5SA 2CN2A 3IUNA 5E6RA 4NSXA 1A12A 2Q7QA 3NVNA 3K27A 4Z8LA 5EAPA 5K19A 1QNIA 1R5MA 2XZGA 5FLXg 2XL3A 3C75H 4YVDA 5FQDA 3PVUB 2PM9B 3T3PA 4FAND 4OZUA 2I0SA 3DSMA 4I79A 4WJKA 1P22A 3C5MA 1GXRA 4J78A 3NVXA 3IJ1A 4O9DA 4BP8A 3I8EA 4X63B 5IC7A 2Z2NA 3K71A 1BPOA 3EQ7A 4FA4D 1E8MA 3OW8A 3MZKA 4J84A 4QT8A 3F3GA 4IA9A 4RE5A 4A08A 2O9KA 1I2MB 1VE7A 4U7AA 5TDHB 5H17A 2EIDA 1SQ9A 3B7FA 3N0EA 1UOQA 3EI2B 4CI3A 1JMXB 5C86A
chains in the Genus database with same CATH topology
3OKYA 3IJCA 3DM0A 1S4UX 3IIWA 4L9OA 5EMLB 3EMHA 5THAA 3I7NA 2UZYB 4TZ4A 2J55H 3JB9L 3UR4A 2TRCB 1TYQC 4QQEA 4ZN4A 1MG3A 3EU7A 4U1EI 3I2NA 3MKSB 2BBKH 1GP2B 2YNNA 2I3TA 2HJ4A 3KRWB 4GGCA 4A2LA 2IURA 4JT6C 1MDAH 1TBGA 4R7AB 1OLZA 5CXCB 4J87A 5EMJB 4X61B 5EMMB 5FKTA 3PSLA 5AMSA 5HQGA 3MMYA 3SMRA 3IKOA 4O1QD 3SXTD 2OK4A 3I7KA 4Y5RD 3C9CA 1N6FA 3I7LA 4JSXC 5CXCA 1YFQA 3JZNA 3RN0D 2H9NA 1VYHC 2B5MA 3PXSD 4XEIC 4FAVD 4E5ZB 3ULEC 4GM9A 4A7JA 4J79A 4X60B 2H68A 4O45A 2UZXB 5GSAA 2AH0A 4J73A 3SJLD 4A0AB 5EALA 3AFCA 5JWZA 3VA6A 4J8BA 1N6DA 5IGQA 5AFU3 3UVLA 3MZLA 4G56B 2B4EA 2HJBA 2OJYA 4D0KA 1B9XA 1NR0A 3GFCA 2H9LA 2H3XA 3RN1D 2H13A 4J82A 1PBYB 5C9ZB 2QC5A 1Q47A 1MG2A 4FA1D 1PEVA 2IWKA 3F3PA 2GNQA 2BCJB 4J81A 4CZVA 3FGBA 1K8KC 3CFVA 4JT5C 5I5JA 2IUVA 3UVKA 3EI3A 2W18A 3A0FA 3JAMg 2CO0C 2QXVA 4ESGA 4OWRA 5HE3B 2XYIA 4PBYA 3CIKB 4GGAA 3UVNA 5K1CC 3OTTA 5GMKn 2P9UC 3FM0A 3SWSD 4ERQA 4CY1A 3RRMC 3VH0A 4E54A 2B5NA 5GXIA 3OKYB 2I0RA 5H14A 4J0WA 2IWFA 3EI4B 1L0QA 5C2VB 2I0TA 3SHFA 5EMKB 3UKUC 3EI4A 2J56H 3PVWB 3KRXB 4GMBA 2AGZA 3CFSB 3HFQA 4GQ1A 4FA5D 5CYKA 2AGLA 1A0RB 3UVOA 3OKTA 1GG2B 3EI1A 3EWEA 1U2VC 3SN6B 4JSVC 2YNPA 3DWLC 5CXBB 5IGOA 4LG9A 3PE7A 4GQ2P 2P9SC 4JSPC 5HE2B 5FXYA 4CY5A 3SBRA 4O3UB 3P4FA 4JXMA 4PBZA 2P9PC 3OL2A 4FHLA 4CC9A 2G99A 4MK0B 3V9FA 3AL9A 2CNXA 4ZOYA 4A0BB 4QL1A 5IJ7E 3JPXA 2PM9A 1XKSA 5TF2A 4GM8A 3PXWD 4E54B 4X3EA 4N14A 4AOWA 5GXHA 3SFZA 2CO0A 3PXTD 2AGXA 4O3TB 5EM2A 5FA5B 4J77A 3JZGA 4ZOZA 2PM6B 4UI9R 5EM2B 4LGNA 4A2MA 3EI3B 4LG8A 3OKWA 3BG1A 2YBAA 5HYNB 4A0AA 3PSCB 3I8CA 1JOFA 5AJAA 2IUQA 4KFMB 5EAMA 4Y7RA 2H6NA 3C99A 2XL2A 4IMMA 3J80g 1XHMA 4BH6A 3RLMD 3W15A 4FA9D 2I3SA 1SHYB 4AEZA 3L4OD 3SBPA 4EWRA 3V7DB 4A0BA 5EARA 4ZOXA 5SXMA 2G9AA 4CI1A 4XYHA 2CN3A 1XIPA 3EI2A 1ERJA 3SVWD 3ZWLB 4GQBB 3VGZA 4GM3A 5FKRA 3IIYA 3AL8B 1PGUA 3FRXA 4GGDA 1GOTB 2IUPA 2H9PA 4J0XA 2H47A 2OVPB 3I7PA 3ORVD 4ERYA 5FKQA 3UKRC 5I5IA 2MTAH 4A08B 4QRJA 2H9MA 5TEFA 4CZYA 3RFHA 3N0DA 2P9LC 3BWSA 2Z2PA 4CI8A 4JD2C 4CI2A 4XYIA 3RSEC 1FWXA 3ODTA 4JSNC 1PI6A 4A11A 3BG0A 1SQJA 4L1QD 2XU7A 4A11B 3UVMA 5FKSA 3K26A 4BL0A 2YNOA 1JJUB 5HE1B 5CXBA 3E0CA 3SBQA 4J8GA 4E5ZA 2PM7B 2YB8B 3JRPA 2GC7A 3AL8A 2P9IC 3RMZD 4L3GD 3U4YA 2H6KA 2HXCA 3I89A 5HE0B 2AGYA 3JZHA 2P9KC 3EG6A 2AH1A 2AGWA 4PSXB 3F3FA 2CE9A 3SLED 3JROA 2Z2OA 3I7OA 5KDOB 3DXMC 5IT9g 1NEXB 3DXKC 3MKQA 2HYEA 1N6EA 4PXWA 2IAAA 4PNKB 3GREA 5IJ8E 4ZOVA 2CE8A 1JMZB 4CY2A 3IJ0A 4ERZA 1K32A 2H6QA 3J81g 4J86A 2P9NC 4L3HD 2EBSA 4K3ID 5CYKB 3L4MD 4FB1D 5C2WB 2B5LA 5H1MA 3V5WB 5A2Qg 3OL2B 4PSWB 4H5JA 1B9YA 4HDJA 2J57G 1RI6A 4H5IA 1U4CA 2OK6A 2HKRA 2AQ5A 4PC0A 4BUJC 4GZ8A 4CY3A 4D6VA 2OIZA 2OVRB 3NVQA 3I7HA 4A09B 2PBIB 2HKMA 2H14A 2YMUA 2GC4A 4FWWA 5TEEA 3SCYA 3EI1B 1OMWB 4K3JB 2OVQB 2HESX 5I5MA 4ES0A 4CZXA 4A09A 3MXXA 3AH8B 3RFGA 5B4WA 2CN2A 4NSXA 3K27A 2Q7QA 3NVNA 4Z8LA 5EAPA 5K19A 1QNIA 1R5MA 5FLXg 2XL3A 3C75H 4YVDA 5FQDA 3PVUB 2PM9B 4FAND 4OZUA 2I0SA 3DSMA 4I79A 1P22A 3C5MA 1GXRA 4J78A 3NVXA 3IJ1A 4O9DA 3I8EA 4X63B 5IC7A 2Z2NA 4FA4D 3OW8A 3MZKA 4J84A 4QT8A 3F3GA 4IA9A 4A08A 4U7AA 2O9KA 5TDHB 5H17A 1SQ9A 3B7FA 3N0EA 3EI2B 4CI3A 1JMXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKY A;  3IJC A;  3DM0 A;  1S4U X;  3IIW A;  4L9O A;  5EML B;  3EMH A;  5THA A;  3I7N A;  2UZY B;  4TZ4 A;  2J55 H;  3JB9 L;  3UR4 A;  2TRC B;  1TYQ C;  4QQE A;  4ZN4 A;  1MG3 A;  3EU7 A;  4U1E I;  3I2N A;  3MKS B;  2BBK H;  1GP2 B;  2YNN A;  2I3T A;  2HJ4 A;  3KRW B;  4GGC A;  4A2L A;  2IUR A;  4JT6 C;  1MDA H;  1TBG A;  4R7A B;  1OLZ A;  5CXC B;  4J87 A;  5EMJ B;  4X61 B;  5EMM B;  5FKT A;  3PSL A;  5AMS A;  5HQG A;  3MMY A;  3SMR A;  3IKO A;  4O1Q D;  3SXT D;  2OK4 A;  3I7K A;  4Y5R D;  3C9C A;  1N6F A;  3I7L A;  4JSX C;  5CXC A;  1YFQ A;  3JZN A;  3RN0 D;  2H9N A;  1VYH C;  2B5M A;  3PXS D;  4XEI C;  4FAV D;  4E5Z B;  3ULE C;  4GM9 A;  4A7J A;  4J79 A;  4X60 B;  2H68 A;  4O45 A;  2UZX B;  5GSA A;  2AH0 A;  4J73 A;  3SJL D;  4A0A B;  5EAL A;  3AFC A;  5JWZ A;  3VA6 A;  4J8B A;  1N6D A;  5IGQ A;  5AFU 3;  3UVL A;  3MZL A;  4G56 B;  2B4E A;  2HJB A;  2OJY A;  4D0K A;  1B9X A;  1NR0 A;  3GFC A;  2H9L A;  2H3X A;  3RN1 D;  2H13 A;  4J82 A;  1PBY B;  5C9Z B;  2QC5 A;  1Q47 A;  1MG2 A;  4FA1 D;  1PEV A;  2IWK A;  3F3P A;  2GNQ A;  2BCJ B;  4J81 A;  4CZV A;  3FGB A;  1K8K C;  3CFV A;  4JT5 C;  5I5J A;  2IUV A;  3UVK A;  3EI3 A;  2W18 A;  3A0F A;  3JAM g;  2CO0 C;  2QXV A;  4ESG A;  4OWR A;  5HE3 B;  2XYI A;  4PBY A;  3CIK B;  4GGA A;  3UVN A;  5K1C C;  3OTT A;  5GMK n;  2P9U C;  3FM0 A;  3SWS D;  4ERQ A;  4CY1 A;  3RRM C;  3VH0 A;  4E54 A;  2B5N A;  5GXI A;  3OKY B;  2I0R A;  5H14 A;  4J0W A;  2IWF A;  3EI4 B;  1L0Q A;  5C2V B;  2I0T A;  3SHF A;  5EMK B;  3UKU C;  3EI4 A;  2J56 H;  3PVW B;  3KRX B;  4GMB A;  2AGZ A;  3CFS B;  3HFQ A;  4GQ1 A;  4FA5 D;  5CYK A;  2AGL A;  1A0R B;  3UVO A;  3OKT A;  1GG2 B;  3EI1 A;  3EWE A;  1U2V C;  3SN6 B;  4JSV C;  2YNP A;  3DWL C;  5CXB B;  5IGO A;  4LG9 A;  3PE7 A;  4GQ2 P;  2P9S C;  4JSP C;  5HE2 B;  5FXY A;  4CY5 A;  3SBR A;  4O3U B;  3P4F A;  4JXM A;  4PBZ A;  2P9P C;  3OL2 A;  4FHL A;  4CC9 A;  2G99 A;  4MK0 B;  3V9F A;  3AL9 A;  2CNX A;  4ZOY A;  4A0B B;  4QL1 A;  5IJ7 E;  3JPX A;  2PM9 A;  1XKS A;  5TF2 A;  4GM8 A;  3PXW D;  4E54 B;  4X3E A;  4N14 A;  4AOW A;  5GXH A;  3SFZ A;  2CO0 A;  3PXT D;  2AGX A;  4O3T B;  5EM2 A;  5FA5 B;  4J77 A;  3JZG A;  4ZOZ A;  2PM6 B;  4UI9 R;  5EM2 B;  4LGN A;  4A2M A;  3EI3 B;  4LG8 A;  3OKW A;  3BG1 A;  2YBA A;  5HYN B;  4A0A A;  3PSC B;  3I8C A;  1JOF A;  5AJA A;  2IUQ A;  4KFM B;  5EAM A;  4Y7R A;  2H6N A;  3C99 A;  2XL2 A;  4IMM A;  3J80 g;  1XHM A;  4BH6 A;  3RLM D;  3W15 A;  4FA9 D;  2I3S A;  1SHY B;  4AEZ A;  3L4O D;  3SBP A;  4EWR A;  3V7D B;  4A0B A;  5EAR A;  4ZOX A;  5SXM A;  2G9A A;  4CI1 A;  4XYH A;  2CN3 A;  1XIP A;  3EI2 A;  1ERJ A;  3SVW D;  3ZWL B;  4GQB B;  3VGZ A;  4GM3 A;  5FKR A;  3IIY A;  3AL8 B;  1PGU A;  3FRX A;  4GGD A;  1GOT B;  2IUP A;  2H9P A;  4J0X A;  2H47 A;  2OVP B;  3I7P A;  3ORV D;  4ERY A;  5FKQ A;  3UKR C;  5I5I A;  2MTA H;  4A08 B;  4QRJ A;  2H9M A;  5TEF A;  4CZY A;  3RFH A;  3N0D A;  2P9L C;  3BWS A;  2Z2P A;  4CI8 A;  4JD2 C;  4CI2 A;  4XYI A;  3RSE C;  1FWX A;  3ODT A;  4JSN C;  1PI6 A;  4A11 A;  3BG0 A;  1SQJ A;  4L1Q D;  2XU7 A;  4A11 B;  3UVM A;  5FKS A;  3K26 A;  4BL0 A;  2YNO A;  1JJU B;  5HE1 B;  5CXB A;  3E0C A;  3SBQ A;  4J8G A;  4E5Z A;  2PM7 B;  2YB8 B;  3JRP A;  2GC7 A;  3AL8 A;  2P9I C;  3RMZ D;  4L3G D;  3U4Y A;  2H6K A;  2HXC A;  3I89 A;  5HE0 B;  2AGY A;  3JZH A;  2P9K C;  3EG6 A;  2AH1 A;  2AGW A;  4PSX B;  3F3F A;  2CE9 A;  3SLE D;  3JRO A;  2Z2O A;  3I7O A;  5KDO B;  3DXM C;  5IT9 g;  1NEX B;  3DXK C;  3MKQ A;  2HYE A;  1N6E A;  4PXW A;  2IAA A;  4PNK B;  3GRE A;  5IJ8 E;  4ZOV A;  2CE8 A;  1JMZ B;  4CY2 A;  3IJ0 A;  4ERZ A;  1K32 A;  2H6Q A;  3J81 g;  4J86 A;  2P9N C;  4L3H D;  2EBS A;  4K3I D;  5CYK B;  3L4M D;  4FB1 D;  5C2W B;  2B5L A;  5H1M A;  3V5W B;  5A2Q g;  3OL2 B;  4PSW B;  4H5J A;  1B9Y A;  4HDJ A;  2J57 G;  1RI6 A;  4H5I A;  1U4C A;  2OK6 A;  2HKR A;  2AQ5 A;  4PC0 A;  4BUJ C;  4GZ8 A;  4CY3 A;  4D6V A;  2OIZ A;  2OVR B;  3NVQ A;  3I7H A;  4A09 B;  2PBI B;  2HKM A;  2H14 A;  2YMU A;  2GC4 A;  4FWW A;  5TEE A;  3SCY A;  3EI1 B;  1OMW B;  4K3J B;  2OVQ B;  2HES X;  5I5M A;  4ES0 A;  4CZX A;  4A09 A;  3MXX A;  3AH8 B;  3RFG A;  5B4W A;  2CN2 A;  4NSX A;  3K27 A;  2Q7Q A;  3NVN A;  4Z8L A;  5EAP A;  5K19 A;  1QNI A;  1R5M A;  5FLX g;  2XL3 A;  3C75 H;  4YVD A;  5FQD A;  3PVU B;  2PM9 B;  4FAN D;  4OZU A;  2I0S A;  3DSM A;  4I79 A;  1P22 A;  3C5M A;  1GXR A;  4J78 A;  3NVX A;  3IJ1 A;  4O9D A;  3I8E A;  4X63 B;  5IC7 A;  2Z2N A;  4FA4 D;  3OW8 A;  3MZK A;  4J84 A;  4QT8 A;  3F3G A;  4IA9 A;  4A08 A;  4U7A A;  2O9K A;  5TDH B;  5H17 A;  1SQ9 A;  3B7F A;  3N0E A;  3EI2 B;  4CI3 A;  1JMX B; 
#chains in the Genus database with same CATH topology
 3OKY A;  3IJC A;  3DM0 A;  3IUQ A;  1S4U X;  3IIW A;  4L9O A;  5EML B;  3EMH A;  5THA A;  3I7N A;  3EQ8 A;  2UZY B;  3VI3 A;  4QAM A;  4TZ4 A;  1C9L A;  2J55 H;  3JB9 L;  3UR4 A;  2TRC B;  1TYQ C;  4QQE A;  4ZN4 A;  3ZE0 A;  1MG3 A;  3EU7 A;  4U1E I;  3I2N A;  3MKS B;  2BBK H;  1GP2 B;  3V4V A;  2YNN A;  2I3T A;  2HJ4 A;  3KRW B;  4GGC A;  3K72 A;  4A2L A;  2IUR A;  1VZ3 A;  4JT6 C;  1MDA H;  1TBG A;  3IVM A;  1O6G A;  4Z7Q A;  1GOF A;  3ZDX A;  3DDU A;  4R7A B;  1OLZ A;  5CXC B;  4J87 A;  5EMJ B;  4X61 B;  5EMM B;  1E5T A;  5FKT A;  3FCU A;  3PSL A;  4G1M A;  5AMS A;  5HQG A;  3MMY A;  3SMR A;  3IKO A;  4O1Q D;  3SXT D;  2OK4 A;  3I7K A;  4Y5R D;  1TYE A;  3C9C A;  1N6F A;  3I7L A;  4JSX C;  5CXC A;  1YFQ A;  3JZN A;  1K3I A;  3IUL A;  3RN0 D;  2H9N A;  2WQ8 A;  1VYH C;  2B5M A;  3PXS D;  4XEI C;  4FAV D;  3NIF A;  4E5Z B;  3ULE C;  4GM9 A;  4A7J A;  4J79 A;  4X60 B;  4BP9 A;  3O4G A;  2H68 A;  4O45 A;  2UZX B;  5GSA A;  2VDM A;  4RE6 A;  2AH0 A;  1H2Z A;  4J73 A;  3SJL D;  4A0A B;  5EAL A;  3AFC A;  5JWZ A;  3GC3 B;  3VA6 A;  4J8B A;  1N6D A;  5IGQ A;  5AFU 3;  3UVL A;  3MZL A;  3IUJ A;  4G56 B;  1UOP A;  3ZDZ A;  4D9S A;  2B4E A;  2HJB A;  4JHN A;  4O2W A;  4AMZ A;  2OJY A;  4D0K A;  1B9X A;  2VDL A;  1NR0 A;  3GFC A;  2H9L A;  2H3X A;  3RN1 D;  3IJE A;  2H13 A;  4J82 A;  4Z7N A;  1PBY B;  5C9Z B;  3MUN A;  1E8N A;  2QC5 A;  3OF7 A;  1Q47 A;  5M5U A;  1MG2 A;  3IUM A;  1PEV A;  2IWK A;  4FA1 D;  3F3P A;  1QFS A;  2GNQ A;  2BCJ B;  4J81 A;  4CZV A;  3FGB A;  1K8K C;  3CFV A;  4JT5 C;  5I5J A;  2IUV A;  3UVK A;  3EI3 A;  2W18 A;  3A0F A;  3JAM g;  4WK0 A;  2CO0 C;  3O4I A;  2QXV A;  4ESG A;  4OWR A;  5HE3 B;  2XYI A;  2VDO A;  4PBY A;  3CIK B;  2EIC A;  4IRZ A;  4GGA A;  3UVN A;  5K1C C;  3OTT A;  5GMK n;  3V4P A;  2P9U C;  3FM0 A;  3SWS D;  4ERQ A;  4CY1 A;  3RRM C;  3VH0 A;  1JTD B;  4E54 A;  2B5N A;  5GXI A;  1H2Y A;  3OKY B;  2I0R A;  2BKL A;  5H14 A;  2VC2 A;  4J0W A;  3T3M A;  2IWF A;  3EI4 B;  1L0Q A;  5M5V A;  5C2V B;  2I0T A;  4L1M A;  3SHF A;  5EMK B;  3UKU C;  5M5R A;  3EI4 A;  2EIE A;  2J56 H;  3PVW B;  2VDR A;  3KRX B;  4GMB A;  2AGZ A;  3CFS B;  3HFQ A;  4NEN A;  4GQ1 A;  4UM9 A;  4FA5 D;  5CYK A;  2AGL A;  1A0R B;  3UVO A;  3OKT A;  1GG2 B;  3EI1 A;  3MVD K;  3EWE A;  2VZ3 A;  1U2V C;  3SN6 B;  1UOO A;  4JSV C;  2YNP A;  3FCS A;  2EIB A;  3DWL C;  5CXB B;  5IGO A;  4G1E A;  1L5G A;  3NIG A;  4LG9 A;  3PE7 A;  4GQ2 P;  2P9S C;  4JSP C;  5HE2 B;  5FXY A;  4CY5 A;  3SBR A;  4NAA A;  4AX4 A;  4O3U B;  3P4F A;  4JXM A;  4PBZ A;  2P9P C;  3OL2 A;  4FHL A;  2HU7 A;  5M5T A;  4CC9 A;  2G99 A;  4MK0 B;  3V9F A;  3AL9 A;  2CNX A;  4ZOY A;  4A0B B;  4QL1 A;  5IJ7 E;  3JPX A;  2PM9 A;  4BCB A;  1XKS A;  1T2X A;  2HU8 A;  3O4H A;  5TF2 A;  4GM8 A;  3PXW D;  4E54 B;  3VI4 A;  4X3E A;  4N14 A;  4AOW A;  4G55 A;  5GXH A;  3SFZ A;  2CO0 A;  4NBM A;  3PXT D;  2AGX A;  4O3T B;  5EM2 A;  5FA5 B;  2VZ1 A;  3JZG A;  4J77 A;  4ZOZ A;  4AMY A;  1UTC A;  2PM6 B;  4UI9 R;  5EM2 B;  4LGN A;  4A2M A;  3EI3 B;  4LG8 A;  3OKW A;  3BG1 A;  2YBA A;  5HYN B;  4A0A A;  3PSC B;  4MMZ A;  1QFM A;  3I8C A;  1JOF A;  5AJA A;  5FFO A;  2IUQ A;  4KFM B;  5EAM A;  4DNV A;  3O4J A;  4Y7R A;  2H6N A;  3QI0 A;  3C99 A;  2XL2 A;  4IMM A;  1YR2 A;  3J80 g;  1XHM A;  4BH6 A;  3RLM D;  3W15 A;  4FA9 D;  2I3S A;  1SHY B;  2HU5 A;  4AEZ A;  3L4O D;  3SBP A;  4EWR A;  3V7D B;  4A0B A;  5EAR A;  4ZOX A;  5SXM A;  5C92 A;  2G9A A;  4CI1 A;  4XYH A;  2CN3 A;  1XIP A;  2XDW A;  3EI2 A;  1ERJ A;  3SVW D;  3ZWL B;  4GQB B;  3VGZ A;  4GM3 A;  5FKR A;  3IIY A;  3AL8 B;  4AN1 A;  1PGU A;  3FRX A;  1GOG A;  4BCC A;  4GGD A;  1GOT B;  2IUP A;  2H9P A;  2H47 A;  2OVP B;  3I7P A;  4J0X A;  3ORV D;  4ERY A;  2VDP A;  5FKQ A;  5HDB A;  3UKR C;  5I5I A;  1U8C A;  2MTA H;  4A08 B;  3ZDY A;  4WK2 A;  4QRJ A;  2XE4 A;  1VZ2 A;  2H9M A;  2QZP A;  5TEF A;  4CZY A;  3RFH A;  1O6F A;  3N0D A;  2P9L C;  3EQ9 A;  1GOH A;  3BWS A;  2Z2P A;  4CI8 A;  4JD2 C;  1C9I A;  4CI2 A;  3NID A;  4XYI A;  3RSE C;  1FWX A;  3ODT A;  4JSN C;  1PI6 A;  3IUR A;  4A11 A;  3BG0 A;  1SQJ A;  1VE6 A;  4L1Q D;  2XU7 A;  5M61 A;  3KCI A;  5E6S A;  4A11 B;  3UVM A;  5FKS A;  3K26 A;  4BL0 A;  2YNO A;  2QR5 A;  1JJU B;  5HE1 B;  5CXB A;  3E0C A;  3SBQ A;  4J8G A;  4E5Z A;  2PM7 B;  2VDQ A;  2YB8 B;  3JRP A;  2GC7 A;  3AL8 A;  2P9I C;  3GD1 I;  4JHP C;  3RMZ D;  4L3G D;  3U4Y A;  2H6K A;  3K6S A;  3I89 A;  2HXC A;  5HE0 B;  3JZH A;  2AGY A;  2P9K C;  3EG6 A;  2AH1 A;  2AGW A;  4PSX B;  3F3F A;  2CE9 A;  3SLE D;  3JRO A;  2Z2O A;  3I7O A;  3ZE2 A;  5KDO B;  4UM8 A;  3DXM C;  5IT9 g;  3MUO A;  1NEX B;  3DXK C;  1M1X A;  3MKQ A;  2HYE A;  4BCD A;  1N6E A;  4PXW A;  2IAA A;  4PNK B;  3GRE A;  5IJ8 E;  4ZOV A;  2CE8 A;  1JMZ B;  4CY2 A;  3IJ0 A;  3ZE1 A;  4AN0 A;  4ERZ A;  1H2W A;  1K32 A;  2H6Q A;  3J81 g;  4J86 A;  2VDK A;  2P9N C;  4L3H D;  2EBS A;  4K3I D;  5CYK B;  3L4M D;  4FB1 D;  4DNU A;  4O02 A;  4DNW A;  5C2W B;  2B5L A;  5H1M A;  3V5W B;  3QHY B;  4MMY A;  5A2Q g;  3OL2 B;  4PSW B;  4H5J A;  2VDN A;  2JKX A;  1B9Y A;  4HDJ A;  2J57 G;  1JV2 A;  1RI6 A;  4H5I A;  1U4C A;  2OK6 A;  2HKR A;  2AQ5 A;  4PC0 A;  4BUJ C;  4Z7O A;  4GZ8 A;  4CY3 A;  4D6V A;  2OIZ A;  2OVR B;  3NVQ A;  3I7H A;  4A09 B;  2PBI B;  4MMX A;  2HKM A;  2H14 A;  2YMU A;  2GC4 A;  4WK4 A;  4FWW A;  5TEE A;  3SCY A;  3EI1 B;  1OMW B;  4K3J B;  2OVQ B;  2HES X;  5FFG A;  5I5M A;  4ES0 A;  4CZX A;  4A09 A;  3MXX A;  4NC4 A;  1H2X A;  3AH8 B;  3RFG A;  5E6U A;  5B4W A;  5M5S A;  2CN2 A;  3IUN A;  5E6R A;  4NSX A;  1A12 A;  2Q7Q A;  3NVN A;  3K27 A;  4Z8L A;  5EAP A;  5K19 A;  1QNI A;  1R5M A;  2XZG A;  5FLX g;  2XL3 A;  3C75 H;  4YVD A;  5FQD A;  3PVU B;  2PM9 B;  3T3P A;  4FAN D;  4OZU A;  2I0S A;  3DSM A;  4I79 A;  4WJK A;  1P22 A;  3C5M A;  1GXR A;  4J78 A;  3NVX A;  3IJ1 A;  4O9D A;  4BP8 A;  3I8E A;  4X63 B;  5IC7 A;  2Z2N A;  3K71 A;  1BPO A;  3EQ7 A;  4FA4 D;  1E8M A;  3OW8 A;  3MZK A;  4J84 A;  4QT8 A;  3F3G A;  4IA9 A;  4RE5 A;  4A08 A;  2O9K A;  1I2M B;  1VE7 A;  4U7A A;  5TDH B;  5H17 A;  2EID A;  1SQ9 A;  3B7F A;  3N0E A;  1UOQ A;  3EI2 B;  4CI3 A;  1JMX B;  5C86 A; 
#chains in the Genus database with same CATH homology
 3OKY A;  3IJC A;  3DM0 A;  1S4U X;  3IIW A;  4L9O A;  5EML B;  3EMH A;  5THA A;  3I7N A;  2UZY B;  4TZ4 A;  2J55 H;  3JB9 L;  3UR4 A;  2TRC B;  1TYQ C;  4QQE A;  4ZN4 A;  1MG3 A;  3EU7 A;  4U1E I;  3I2N A;  3MKS B;  2BBK H;  1GP2 B;  2YNN A;  2I3T A;  2HJ4 A;  3KRW B;  4GGC A;  4A2L A;  2IUR A;  4JT6 C;  1MDA H;  1TBG A;  4R7A B;  1OLZ A;  5CXC B;  4J87 A;  5EMJ B;  4X61 B;  5EMM B;  5FKT A;  3PSL A;  5AMS A;  5HQG A;  3MMY A;  3SMR A;  3IKO A;  4O1Q D;  3SXT D;  2OK4 A;  3I7K A;  4Y5R D;  3C9C A;  1N6F A;  3I7L A;  4JSX C;  5CXC A;  1YFQ A;  3JZN A;  3RN0 D;  2H9N A;  1VYH C;  2B5M A;  3PXS D;  4XEI C;  4FAV D;  4E5Z B;  3ULE C;  4GM9 A;  4A7J A;  4J79 A;  4X60 B;  2H68 A;  4O45 A;  2UZX B;  5GSA A;  2AH0 A;  4J73 A;  3SJL D;  4A0A B;  5EAL A;  3AFC A;  5JWZ A;  3VA6 A;  4J8B A;  1N6D A;  5IGQ A;  5AFU 3;  3UVL A;  3MZL A;  4G56 B;  2B4E A;  2HJB A;  2OJY A;  4D0K A;  1B9X A;  1NR0 A;  3GFC A;  2H9L A;  2H3X A;  3RN1 D;  2H13 A;  4J82 A;  1PBY B;  5C9Z B;  2QC5 A;  1Q47 A;  1MG2 A;  4FA1 D;  1PEV A;  2IWK A;  3F3P A;  2GNQ A;  2BCJ B;  4J81 A;  4CZV A;  3FGB A;  1K8K C;  3CFV A;  4JT5 C;  5I5J A;  2IUV A;  3UVK A;  3EI3 A;  2W18 A;  3A0F A;  3JAM g;  2CO0 C;  2QXV A;  4ESG A;  4OWR A;  5HE3 B;  2XYI A;  4PBY A;  3CIK B;  4GGA A;  3UVN A;  5K1C C;  3OTT A;  5GMK n;  2P9U C;  3FM0 A;  3SWS D;  4ERQ A;  4CY1 A;  3RRM C;  3VH0 A;  4E54 A;  2B5N A;  5GXI A;  3OKY B;  2I0R A;  5H14 A;  4J0W A;  2IWF A;  3EI4 B;  1L0Q A;  5C2V B;  2I0T A;  3SHF A;  5EMK B;  3UKU C;  3EI4 A;  2J56 H;  3PVW B;  3KRX B;  4GMB A;  2AGZ A;  3CFS B;  3HFQ A;  4GQ1 A;  4FA5 D;  5CYK A;  2AGL A;  1A0R B;  3UVO A;  3OKT A;  1GG2 B;  3EI1 A;  3EWE A;  1U2V C;  3SN6 B;  4JSV C;  2YNP A;  3DWL C;  5CXB B;  5IGO A;  4LG9 A;  3PE7 A;  4GQ2 P;  2P9S C;  4JSP C;  5HE2 B;  5FXY A;  4CY5 A;  3SBR A;  4O3U B;  3P4F A;  4JXM A;  4PBZ A;  2P9P C;  3OL2 A;  4FHL A;  4CC9 A;  2G99 A;  4MK0 B;  3V9F A;  3AL9 A;  2CNX A;  4ZOY A;  4A0B B;  4QL1 A;  5IJ7 E;  3JPX A;  2PM9 A;  1XKS A;  5TF2 A;  4GM8 A;  3PXW D;  4E54 B;  4X3E A;  4N14 A;  4AOW A;  5GXH A;  3SFZ A;  2CO0 A;  3PXT D;  2AGX A;  4O3T B;  5EM2 A;  5FA5 B;  4J77 A;  3JZG A;  4ZOZ A;  2PM6 B;  4UI9 R;  5EM2 B;  4LGN A;  4A2M A;  3EI3 B;  4LG8 A;  3OKW A;  3BG1 A;  2YBA A;  5HYN B;  4A0A A;  3PSC B;  3I8C A;  1JOF A;  5AJA A;  2IUQ A;  4KFM B;  5EAM A;  4Y7R A;  2H6N A;  3C99 A;  2XL2 A;  4IMM A;  3J80 g;  1XHM A;  4BH6 A;  3RLM D;  3W15 A;  4FA9 D;  2I3S A;  1SHY B;  4AEZ A;  3L4O D;  3SBP A;  4EWR A;  3V7D B;  4A0B A;  5EAR A;  4ZOX A;  5SXM A;  2G9A A;  4CI1 A;  4XYH A;  2CN3 A;  1XIP A;  3EI2 A;  1ERJ A;  3SVW D;  3ZWL B;  4GQB B;  3VGZ A;  4GM3 A;  5FKR A;  3IIY A;  3AL8 B;  1PGU A;  3FRX A;  4GGD A;  1GOT B;  2IUP A;  2H9P A;  4J0X A;  2H47 A;  2OVP B;  3I7P A;  3ORV D;  4ERY A;  5FKQ A;  3UKR C;  5I5I A;  2MTA H;  4A08 B;  4QRJ A;  2H9M A;  5TEF A;  4CZY A;  3RFH A;  3N0D A;  2P9L C;  3BWS A;  2Z2P A;  4CI8 A;  4JD2 C;  4CI2 A;  4XYI A;  3RSE C;  1FWX A;  3ODT A;  4JSN C;  1PI6 A;  4A11 A;  3BG0 A;  1SQJ A;  4L1Q D;  2XU7 A;  4A11 B;  3UVM A;  5FKS A;  3K26 A;  4BL0 A;  2YNO A;  1JJU B;  5HE1 B;  5CXB A;  3E0C A;  3SBQ A;  4J8G A;  4E5Z A;  2PM7 B;  2YB8 B;  3JRP A;  2GC7 A;  3AL8 A;  2P9I C;  3RMZ D;  4L3G D;  3U4Y A;  2H6K A;  2HXC A;  3I89 A;  5HE0 B;  2AGY A;  3JZH A;  2P9K C;  3EG6 A;  2AH1 A;  2AGW A;  4PSX B;  3F3F A;  2CE9 A;  3SLE D;  3JRO A;  2Z2O A;  3I7O A;  5KDO B;  3DXM C;  5IT9 g;  1NEX B;  3DXK C;  3MKQ A;  2HYE A;  1N6E A;  4PXW A;  2IAA A;  4PNK B;  3GRE A;  5IJ8 E;  4ZOV A;  2CE8 A;  1JMZ B;  4CY2 A;  3IJ0 A;  4ERZ A;  1K32 A;  2H6Q A;  3J81 g;  4J86 A;  2P9N C;  4L3H D;  2EBS A;  4K3I D;  5CYK B;  3L4M D;  4FB1 D;  5C2W B;  2B5L A;  5H1M A;  3V5W B;  5A2Q g;  3OL2 B;  4PSW B;  4H5J A;  1B9Y A;  4HDJ A;  2J57 G;  1RI6 A;  4H5I A;  1U4C A;  2OK6 A;  2HKR A;  2AQ5 A;  4PC0 A;  4BUJ C;  4GZ8 A;  4CY3 A;  4D6V A;  2OIZ A;  2OVR B;  3NVQ A;  3I7H A;  4A09 B;  2PBI B;  2HKM A;  2H14 A;  2YMU A;  2GC4 A;  4FWW A;  5TEE A;  3SCY A;  3EI1 B;  1OMW B;  4K3J B;  2OVQ B;  2HES X;  5I5M A;  4ES0 A;  4CZX A;  4A09 A;  3MXX A;  3AH8 B;  3RFG A;  5B4W A;  2CN2 A;  4NSX A;  3K27 A;  2Q7Q A;  3NVN A;  4Z8L A;  5EAP A;  5K19 A;  1QNI A;  1R5M A;  5FLX g;  2XL3 A;  3C75 H;  4YVD A;  5FQD A;  3PVU B;  2PM9 B;  4FAN D;  4OZU A;  2I0S A;  3DSM A;  4I79 A;  1P22 A;  3C5M A;  1GXR A;  4J78 A;  3NVX A;  3IJ1 A;  4O9D A;  3I8E A;  4X63 B;  5IC7 A;  2Z2N A;  4FA4 D;  3OW8 A;  3MZK A;  4J84 A;  4QT8 A;  3F3G A;  4IA9 A;  4A08 A;  4U7A A;  2O9K A;  5TDH B;  5H17 A;  1SQ9 A;  3B7F A;  3N0E A;  3EI2 B;  4CI3 A;  1JMX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...