1FWXA

Crystal structure of nitrous oxide reductase from p. denitrificans
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
591
structure length
591
Chain Sequence
b'ADGSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESVRIHERTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMKCDAILEIPNAKGIHGLRPQKWPRSNYVFCNGEDETPLVNDGTNMEDVANYVNVFTAVDADKWEVAWQVLVSGNLDNCDADYEGKWAFSTSYNSEKGMTLPEMTAAEMDHIVVFNIAEIEKAIAAGDYQELNGVKVVDGRKEASSLFTRYIPIANNPHGCNMAPDKKHLCVAGKLSPTVTVLDVTRFDAVFYENADPRSAVVAEPELGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIEDAIRAYAGEKVDPIKDKLDVHYQPGHLKTVMGETLDATNDWLVCLSKFSKDRFLNVGPLKPENDQLIDISGDKMVLVHDGPTFAEPHDAIAVHPSILSDIKSVWDRNDPMWAETRAQAEADGVDIDNWTEEVIRDGNKVRVYMSSVAPSFSIESFTVKEGDEVTVIVTNLDEIDDLTHGFTMGNYGVAMEIGPQMTSSVTFVAANPGVYWYYCQWFCHALHMEMRGRMLVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROUS OXIDE REDUCTASE
molecule tags Oxidoreductase
publication title Revisiting the Catalytic CuZ Cluster of Nitrous Oxide (N2O) Reductase. Evidence of a Bridging Inorganic Sulfur
pubmed doi rcsb
total genus 185
structure length 591
sequence length 591
chains with identical sequence B, C, D
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2000-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13473 Cupredoxin_1 Cupredoxin-like domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1fwxA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1fwxA01
4J82A 4JSXC 3UVMA 1JZEA 1MZZA 1PLCA 3NJMA 2PM9B 4YSEA 4A2HA 2IWEA 4GQ2P 4D6VA 3CDZB 4A2GA 2VMJA 4EF3A 2GBAA 1ZDSA 4GGCA 4FAVD 2YAPA 1WS7A 3EH4B 3IIWA 4E5ZA 4MFHA 5B1BB 2GB2A 1N6EA 2Z2NA 3WNIA 3X1GA 3EF4A 3JZNA 4FA1D 5HE2B 1T5KA 2PP7A 5A7EA 3MBWB 1SHYB 4ZOYA 1AG0A 3SQRA 5LDUA 4O45A 4N14A 2EINB 1ZV2A 4BUJC 4LG8A 1AOZA 4BXSV 4A2EA 4UANA 5PCYA 3V9CA 4BH6A 1ASOA 1OF0A 4BWWA 1JXFA 1BYPA 2XXGA 3C5MA 1KCBA 4NB7A 4GP5B 3MKSB 3GDCA 1E5YA 3TBCA 1GG2B 5IY5B 2I0SA 3IE9A 4J8GA 2CN2A 3AL8A 3AH8B 2EBSA 5B4WA 2YNNA 4G7QB 1GW0A 1A8ZA 2P9IC 4AX3A 2Y69B 2I7OA 3ABMB 3PPSA 1ET8A 1JOIA 2UXTA 1JJUB 5I6LA 3PXTD 3JB9L 5FKSA 4NAJA 1AS6A 4CSZA 2CO0A 3IJ1A 4J79A 4E9RA 2G99A 1SFDA 1BQKA 3T71A 1W6WA 3JTBA 1XMEB 2OK6A 1ZPUA 5KDOB 4A0BA 1NZRA 3UKRC 2H6NA 1J5DA 3HEIB 4UI9R 4A68A 2J56H 2PCFA 2H9NA 1SFHA 2BP8A 1BXVA 4HCGA 3ZIYA 2W88A 2BCJB 2IWKA 4BDVB 1GY2A 5THAA 3RFGA 4CY3A 4FA5D 4J73A 1U2VC 2IUQA 2QXVA 3DXKC 4MK0B 5HE0B 5CXCB 1M57B 4ENZA 3FPXA 1QHQA 3CVCA 4JSPC 3FRXA 5ANHA 1FWXA 1GSKA 3SBPA 2VSMB 4J81A 2H5UA 2BBKH 1NTDA 4O9DA 2CJ3A 1MG3A 4HCFA 1RZPA 4DP8X 3EG6A 2BZCA 4JHVA 1ADWA 1M9WA 4HAKA 2H13A 4A08A 1A65A 2AH1A 4ERQA 1QLEB 2HRHA 3TBBA 3ZX1A 2FT8A 1KBWA 1MZYA 2IDSA 2HLEB 3ABLB 4O1QD 1I53A 1J5CA 4HCIA 5AMSA 1NICA 1SHXA 2XUWA 5F7BA 1IKOP 3CFVA 3FYEB 4E9XA 1L9QA 2H3XC 1J9TA 2PBIB 4NSXA 2PPEA 1MG2C 5AJAA 9PCYA 3ODTA 3WG7B 1MG2A 2PP8A 3PAVA 4G7SB 3AL9A 1TBGA 3VA6A 4YSUA 2R7EA 2H6KA 1PI6A 2H14A 2DWTA 3NT0A 1A0RB 2UXFA 3K27A 2XV2A 3NJLA 1PCSA 3RMZD 4QQEA 4YSAA 2IDTA 3QQXA 1GOTB 3JAMg 2OVPB 4Q89A 3DWLC 4A0BB 4FWWA 3L45A 2YB8B 1M56B 3OKYA 2CCWA 1JXGA 4ZOVA 4FB1D 8PAZA 5IJ7E 3I7NA 5GXIA 3DTUB 2FQDA 1ILSA 2IDQA 1K8KC 2AGXA 5FKQA 1NIDA 1JMZB 2AGZA 4L1QD 2EIMB 1JXDA 4HDJA 3V5WB 2HZHA 2YARA 5B1KA 2UX7A 1AR1B 3T6ZA 3B7FA 4KO7A 2AH0A 4OWRA 3SXTD 2FQEA 4ES0A 2HYEA 2R7EB 2FNWA 4J86A 1TEFA 3FGBA 4HIPA 1AS7A 2I7SA 1L9OA 2VM3A 2WO3B 2P9SC 4E54B 3QJUB 4E9QA 3I7LA 1RZQA 1VLXA 2BW5A 2Q7QA 3OMNB 1PBYB 2MTAH 1AACA 2EILB 4CY5A 2IH9A 1E67A 2YAMA 5I5JA 4AKOA 4JD2C 2BZ7A 3QJRB 2IWFA 3OD3A 1W8EA 3PAZA 1NWPA 5FC9A 1WS8A 4YSCA 2P9NC 3L4MD 4J84A 1MDAH 1WA0X 2YXWA 3NP3A 2W18A 2FJSA 3UGEA 3X1BA 1VYHC 3SHFA 2AGYA 3EI3A 1HFUA 4XEIC 5EALA 4BXVA 4BWTA 4ERYA 1SJMA 2XV3A 5FA5B 5EARA 2PP9A 2YMUA 1N6FA 5FQDA 5TDHB 3K26A 2YNPA 3EMHA 1PNCA 4CY1A 2H47C 5B1AB 3F3GA 4AEZA 1YLBB 3FSZA 2QT6A 2Q9OA 2AVFA 3S3BB 4PXWA 3CG8A 4DPBX 2UZXB 3PVWB 5H1MA 2JKWA 3EI4B 4E54A 1BEXA 5F7AA 4NERA 4DP5X 1ET7A 2HX9A 2GNQA 5B7EA 3BG1A 3EH5B 5FKRA 2GSMB 5I26A 4A0AB 2YAFA 3NSCA 2VM4A 3NJGA 3SN6B 4DP2X 4YVUA 2OJYA 3AG3B 4ZOXA 1JVOA 4PCYA 4EWRA 3JZGA 2JFCA 3OMAB 3X2QB 4PC0A 4KNUA 4QLWA 3NVXA 4QRJA 2VSKB 1OLZA 1SQJA 1BQ5A 4U1EI 3ULEC 1WA1X 2EIKB 2IH8A 3F3PA 3GFCA 3WKQA 1N70A 2HX7A 3BVDB 5H17A 3MZLA 3PCYA 4KO6A 1SDDA 3UVKA 4ESGA 3SVWD 3N0EA 2H3XA 1E30A 1YFQA 4BL0A 3QJVB 1AZUA 2OV0A 3PE7A 3CIKB 3S8FB 4GQBB 4YSOA 4GM3A 4OZUA 4KO5A 3FSVA 2IURA 4DP7X 4N4YB 2QDVA 1V54B 4N8UA 3EWEA 4XYHA 1BQRA 2HXAA 1MDAA 2W8CA 2HXCA 2I3TA 1W6LA 3DSMA 3D12B 1MG3C 1NPNA 2XL2A 1P22A 5EMKB 4A2FA 4PAZA 3QPKA 2IAAA 1JZGA 1X9RA 3AZUA 2CBPA 2IAAC 1QNIA 1PGUA 1SNRA 1KDJA 2BO0A 4JSNC 3NSFA 3J80g 2GHZA 3UVLA 3NJFA 3AFCA 4L3HD 5I6OA 1KYAA 3ASOB 3TA4D 2J55A 1IUZA 3OQRA 4L0PB 3IIYA 1OMWB 2YAOA 2DYRB 2J56A 2G9AA 1OOWA 1AAJA 3FPYA 1PMYA 3FU9A 3F3FA 3MZKA 5C2WB 2ZXWB 4M4RB 2JXMA 3SCYA 5B7MA 3X1EA 2YBAA 4CZXA 2MRYA 3C75A 4KOCA 4P5SA 4AKPA 2I0TA 4GM8A 1PNDA 3CZUB 5FKTA 4W9ZA 3N0DA 4A2DA 3H4FA 4LG9A 3SMRA 4J0WA 3FQ1A 4E5ZB 4L9OA 3DKHA 1AZRA 2QDWA 4CZVA 3EI2B 3I7PA 4R7AB 3ZDWA 2J57G 3I8CA 2ZOOA 3QJQB 1AZBA 1XB8A 2XX1A 2YAQA 2YAHA 4G71B 4YL4A 5I6MA 3EI4A 3I7KA 4H5IA 1E65A 3FQYA 4QKTA 4E9TA 3NVNA 1JVLA 5EAPA 4CI1A 2BWDA 1IBZA 2P80D 1XHMA 2XU7A 4TZ4A 5B1JA 3GYRA 3NJIA 3NJKA 4YSDA 1NDTA 3FSAA 1V55B 1IC0A 2J57A 3NYKA 2FQFA 1JZHA 2CAKA 5B1JC 3H56A 1L0QA 3UAAA 2YNOA 4K3JB 4YSQA 1A3ZA 2BP0A 1PEVA 2CN3A 2EIJB 4H5JA 4L3GD 4FAND 2XXFA 1U4CA 4GMBA 3CVBA 3A0FA 5EAMA 2XYIA 1K32A 4YSRA 5HQGA 3SJLD 1NIAA 4GXFA 2B3IA 3HB3B 2CE8A 4PBYA 2XYBA 2ZONA 2H9MA 3AL8B 1GXRA 4KOBA 3G5WA 3P4FA 1V10A 5EMMB 1AZCA 3J81g 3X1FA 2FWLB 2P9PC 3C9CA 7PAZA 4YVDA 2I0RA 4CI3A 2VW6A 5B3SB 2B5MA 4U7AA 5IT9g 3ERXA 4JKNA 2XWZA 4ZK8A 4G7RB 4F2EA 4F2FA 5I5IA 4E9WA 3MXXA 2E86A 4BK5C 4Y5RD 5TK2A 4O3TB 2PPFA 4GP8B 4BWUA 2AGWA 2P9KC 4GQ1A 1NIFA 4J87A 4YSPA 2H47A 1CC3A 2AQ5A 2MTAA 1AQ8A 4YVNA 3GXUB 1PZBA 1ZDQA 5I5MA 3SFZA 1B9XA 3EI2A 1FFTB 4ZOZA 1HAUA 3VH0A 1GYCA 1JMXB 3EI3B 4XYIA 3C75H 1GS8A 1GP2B 2B08A 2P80A 1OCZB 3ABKB 4DP1X 4IA9A 5TEFA 1PY0A 2X87A 3MKQA 4X3EA 1KDIA 3T9WA 1J9SA 4W1TA 3UACA 3S3CB 3RSEC 2YQBA 4A67A 4CC9A 5IGQA 2BW4A 2WO2B 4K9JA 2CNXA 3TU6A 5CYKB 4A09A 1NINA 1PLAA 2YAEA 2FT7A 3GREA 3EU7A 6PCYA 4E9VA 4PNKB 2XLLA 4PBZA 4GY4A 4A0AA 3H4HA 4HHGA 2UXGA 1GY1A 6PAZA 5IGOA 3KW8A 4KO9A 3UR4A 2CALA 3JT2A 2AFNA 1N68A 2H68A 4ERZA 1Q47A 3IJ0A 3RFHA 3RRMC 4ZN4A 3DXMC 2FT6A 4AI7A 1TU2A 1SF5A 3FU7A 3ZBMA 2OVQB 2HKMA 2CO0C 2UX6A 3NSYA 1AANA 5CXBB 4FAAB 3OTTA 1EHKB 1L9SA 5PAZA 4J78A 3U4YA 1KCWA 1CYWA 3FU7B 2UZYB 1PF3A 4PSXB 3OKYB 2IDFA 2B5NA 1NIBA 3T6WA 2OJ1A 3WKPA 2AGLA 5I6PA 1FA4A 2IUPA 3C99A 3L4OD 4CY2A 5D4HA 3RN0D 1XIPA 3S8GB 3U25A 1R1CA 2PPAA 3RYMA 3IJCA 2WSDA 4DP9X 3PXSD 4A09B 1KBVA 2NRDA 3I89A 2FTAA 1KV7A 3BWSA 3PLYA 3I7HA 3BQVA 1XB3A 3OKTA 2OCCB 5IC7A 1JOFA 1NIEA 2PM7B 1AZNA 5GMKn 4KFMB 1A4AA 1DZ0A 1OE3A 4G70B 1TKWA 4G72B 5SXMA 4CI2A 4Z8LA 3N2JA 1OE2A 4J0XA 3TASA 1OE1A 2HESX 3BG0A 3IEAA 2H6QA 4JT5C 2A3TA 2FQGA 1N6DA 5HE1B 3JZHA 3IBOA 1B3IA 2TSAA 5I28A 1ERJA 3V9FA 2Z2OA 4A7JA 5EM2A 5B7FA 1L9RA 3FU8A 3JPXA 3X1NA 2BP0B 4UF7C 3PXWD 3PVUB 2AZAA 2XX0A 5TEEA 3V7DB 4YSTA 1SF3A 4GGAA 3UADA 4A11A 3NJHA 3WIAA 4UAHA 3IN2A 1PZCA 1ZIBA 2DYSB 1GS6X 3AW5A 3N55A 1BYOA 4RH4A 3MMYA 5CYKA 5H14A 4WTQA 3UABA 3OMIB 2H9LA 1NEXB 2P9UC 3OL2A 3EH3B 1ILUA 2AZUA 4GM9A 1A4CA 2H9PA 5C9ZB 2VW7A 3ABGA 5FXYA 1SHWA 5IJ8E 3KRXB 3UVOA 1KGYE 4IMMA 2PPDA 2RACA 1S4UX 2PPCA 3KW7A 4FA7B 2CE9A 3NVQA 2XV0A 1BXAA 4DP4X 4F7KA 4I79A 3FQ2A 4O3UB 1EZLA 1X9UA 4AKQA 1SQ9A 2GC7A 4A2LA 4CI8A 2XL3A 2XVBA 4KNTA 3ZWLB 5FLXg 1GS7A 7PCYA 1OCRB 2GC7C 1RCYA 3FS9A 3SLED 2LLNA 1B9YA 2BP8B 3JROA 1AIZA 1HAWA 4LGNA 2YXVA 2IUVA 1L9TA 3UAEA 3V9EA 2HJBA 5EMLB 1PZAA 5EM2B 1NR0A 3OKWA 5E9NA 4JSVC 5CXCA 5AFAA 4DPAX 5AFU3 4A66A 2BWIA 1UATA 2B5LA 5AKRA 3HFQA 3ORVD 3UVNA 3EI1A 4X63B 3FSWA 1ET5A 2CUAA 1NPJA 5TF2A 1IBYA 4CSPA 3OL2B 2GC4A 5HE3B 3WNJA 2QC5A 3SBRA 5D4JA 2I85A 4FHLA 1TEGA 1AG6A 2GC4C 2DV6A 3NP4A 4JT6C 2PCYA 3DIVA 4JHUA 1ASPA 2Y1AA 2Z2PA 4A11B 4AOWA 2O9KA 4GZ8A 4JXMA 2IDUA 5TK4A 5EMJB 5C2VB 2PM9A 4X4KA 2GIMA 5I6KA 2HKRA 4DPCX 1OV8A 3KRWB 5K19A 1DYZA 3S3DB 1CURA 3ASNB 4DP0X 5AZUA 2GI0A 2QPEB 2QPDB 3DM0A 3FYIB 2OVRB 2XU9A 3FT0A 3NJJA 3E0CA 3PSLA 2AANA 1JZFA 5GSAA 3PXLA 1XB6A 3RLMD 2J55H 1RI6A 1ASQA 4G56B 1J9QA 3JRPA 3UKUC 4X60B 1PLBA 1BAWA 4M3HA 1SDDB 1CUOA 2DY2A 1R5MA 1J9RA 3PSCB 2OK4A 3RN1D 4GGDA 1E5ZA 4E9SA 4FA4D 1F56A 3AG1B 1TYQC 4A08B 3T6VA 1BXUA 4WKXA 1OCCB 4FA9D 5JWZA 4YSSA 1JERA 2UXVA 4GYBA 3T6XA 2HJ4A 2HX8A 4D0KA 2OIZA 2P9LC 3AG4B 2J5WA 3CVDA 3CDZA 3QJTB 3I2NA 3AG2B 5I6NA 1AS8A 3QJSB 2Q5BA 4QT8A 2PM6B 4DP6X 1JZIA 3I8EA 1ZIAA 4K3ID 4HALA 4A2MA 4BDVA 3W15A 3VGZA 2PLTA 1WA2X 2TSBA 2VN3A 4J77A 4CZYA 4PSWB 3SWSD 1JZJA 5K1CC 1RKRA 4GP4B 3OM3B 5EHFA 2I3SA 5CXBA 5A2Qg 1L9PA 3FM0A 2B4EA 5GXHA 4QL1A 3WI9A 1A4BA 1GR7A 3AY2A 5D4IA 4HHWA 4Q8BA 4E9YA 4Y7RA 2DWSA 1ID2A 3NJNA 4AZUA 1CYXA 4P5RA 4KNSA 3I7OA 4HZ1A 3OW8A 1OCOB 4TXVB 1URIA 2BHFA 4X61B 3IKOA 3EI1B 3IN0A 1XKSA 1ETJA 1PAZA 2HRGA 3NSDA 2N0MA 3CFSB 2TRCB 2VW4A 1WAEA 2ZWNA 2X88A 4J8BA 3EHBB 3MX0B 5HYNB 1NWOA 3PAUA 3SBQA
chains in the Genus database with same CATH superfamily
4JPVH 4G7VH 5EBWB 2PM9B 4AT6A 3NJVA 2DLFH 4R4ND 1F3DH 4IQHA 1RZJC 3N42B 4OCYL 3ZT5A 1HXYA 3KPSD 1WH0A 1OZTG 3M45A 3EF4A 5HE2B 5SV3A 2Z91B 2PP7A 3CZLA 2I27N 1DJHA 4XXWC 1CD8A 1HXYB 1FO0B 3SDXA 1ITCA 4MCMA 4F9LA 1WGOA 2BSSA 2NSXA 1DQQB 3VFMB 3LYRA 3O3DA 4PJDE 4A2EA 2OULB 2ODHA 2R0ZL 4NB7A 3CSYA 3MN8A 5FOJA 3EBHA 5DU7A 4N2BA 2AVGA 4PPTA 3WFEH 3IE9A 43C9A 5LVEA 1FFNB 2YOAA 3GUTB 4AWJC 15C8H 4JNXA 3MV7B 5F7UA 2RCSH 5A2BA 4PWFA 4NZDA 2Y5TB 3BXNB 4CU8A 1SBSL 5HHQB 3EFDL 1RJCA 5FGCB 5FKSA 1X5XA 1SXAA 2XZAL 3NRPA 3ZKSD 4J79A 1SFDA 5EU4B 3JTBA 1KLUB 1LDPL 3QE5A 5HVGB 2H6NA 3MODH 4OV5A 3IS1X 5FO8B 3L1EA 5KYYA 2EEFA 2VJ0A 1WZKA 2W88A 3ZO0A 1D5ZB 1YN7B 4GW1B 4J73A 3CFBB 1D2PA 3HRPA 4G80B 1QI3A 4H40A 2MOQA 3CN3A 5ISZE 3WTSA 1BECA 2WZ5A 3FCUB 1FWXA 5FYJE 1IGYA 1U4EA 4FMKA 2DQJH 2F68X 3WLWC 1R3JA 4JO4L 5C0RL 1E9QA 4F93B 4MD4A 4DOHE 1T4KB 3L1OL 4N5EC 5AVWB 1NCCL 3CU7A 4LSRL 3GD1C 4NSXA 2I32A 1U36A 3MTRA 1OCWL 1UM4H 1TZHA 5LAXB 3T0ED 2I60H 3UDWA 2F74A 2OSYA 1A6WH 5FFOA 4NKDA 4HULB 3Q1EA 3UTTD 1OGSA 4UQ2B 4YSUA 1OB1B 2OSXA 3GRWA 3T3MB 4RMUA 2YFOA 1HINH 1A6ZB 3L6FB 4XVTH 3VM7A 2Y72A 4JDTL 4BD4A 4I3GA 1A6WL 3SKNB 1QFWL 3Q8EA 3F7YA 5IZ7A 3OKYA 3O6MH 2CCWA 1JXGA 1NCAL 1ILSA 2AGXA 2AI0H 1IGTA 2FX9L 4L1QD 2EIMB 4LFHD 4FQXC 2AEPH 2OTWA 1U3NA 4WU5A 3S5LA 2BY2A 3T3MF 4IRJB 4M5ZL 3KDMB 2RBLA 3FCGA 3RVXD 1FNHA 4K71B 4XHJD 1G7QA 2D7TL 3NFPA 2FX9H 2ZWLT 4DVBA 2O6EA 3G6AA 1PBYB 3MGAA 2EILB 1RL1A 3FFDB 1L3WA 3ULUC 2AK1H 4C56B 4LOUD 2WXJA 1W8EA 4OZIA 1NWPA 4MS8C 1MAKA 2AQ2A 2DBLL 5FV1L 1NOAA 1TVBA 3P02A 1A64A 4L5FL 3QZWG 1MF2H 2X3AA 1IGYB 1G7IB 3HRZA 1GZHC 4BWTA 2EEBA 3IPFA 1EUUA 4PJ9B 1MSPA 1OSPL 1A7OH 3GMOA 3UBXI 4KK8C 1UZ8A 5FGBA 3F62A 3THMH 5EBMB 3EO1B 4OI7A 3S88H 3I3DA 1F8TL 3FSZA 2OW6A 1UZ6E 3QCUH 3RDJA 2MHAA 4N0YH 5C0EA 3EI4B 4DP5X 1IIIA 3GEWB 3OX8A 4NZRL 2D31A 3W11C 2OJYA 3RWCA 3MRJA 7FABH 4AK1A 3IUNA 3QRGH 1JPTH 1WTLA 1XTLA 3EH1A 2ZPKL 5HHME 5EU5B 4PJEE 5HHNA 3UVKA 2XBZA 1JTDB 1UGKA 3V6ZB 1NCGA 5IFJB 3MRRB 2VLRB 4NKMA 1CD9B 3RUGB 1NBCA 5ACMA 1XZWA 5IBUB 4GM3A 4ZMWA 2VDQL 4JFZH 2WP3O 5DJCB 5F0PB 4WWPA 3QSKB 3FO2B 3FAWA 3DHJA 3LKSB 4XWOD 2XL2A 3CMOL 3DSMA 3EYQD 4LVEA 3LSOA 3B9KC 5L2KE 2IOMA 2XACC 1HEJC 5GZNA 3T6QC 4OB5L 4YN3A 3RBSA 4N6QA 3RY6A 1UT2A 1UVQB 2AJ3B 4I18A 4AIEA 1RHHA 1XQ4A 4BUGA 1JUFA 3VXUA 4PJ5E 3JWDC 4KMQA 5IF0B 5KSUA 5JW4R 1FVCB 4M6MH 4JR9L 5I1GH 3GXIA 2IQAA 2FNBA 3KLAB 3HN8A 1C12B 3X1EA 5IMMA 5TE7H 4BCXA 5IEHA 5AWNL 5DK2B 1SEQL 2HT4C 2EKJA 2I0TA 3N06B 3B3IB 4NP4H 3T0AA 3L3DB 4WK4B 1B4RA 5LO7A 4TVUA 3KYMB 4OZGA 4JR9H 1JJUA 3QULA 3THML 1Q9OA 1ZHNB 2VQ1A 2WV3A 1ED3B 5HVHB 3LZLA 1H5BC 1Q1PA 3VXNB 4KKCC 2CLVA 5EAPA 4QNPF 4FNQA 1NSNL 2Y2WA 3QIWA 5IB1B 2H41A 2R2EA 3D3VB 2PR4H 4I2XA 1TQTA 4IKJA 3NUKA 4K3JB 1BJ1H 3MLSL 5B1JC 2X0WA 1VAHA 4XP4H 1JG9A 2R51A 5T8IA 3GT6A 1QATA 4A6YH 3D3VE 3ECUA 3PWLA 4QI3A 1U8NA 4YWGH 3ZZSA 1V10A 1AO7E 1AZCA 2C9SA 4HC1H 4MYWB 2BVPB 3FJTA 4ADIA 1O6FA 2DLHA 1DLFH 3MUGB 3OKMB 5FDWB 3IFNH 1E9OA 5C08E 2XG4A 1UD2A 3CGTA 1G7MA 4AN1A 2BVOB 2P9KC 3H9HB 3KCPB 1ZA6A 1Y18A 4RDBA 1PZDA 3O3EA 4X5XA 4QF1B 3MKKA 1IO4C 3G7TA 4A04A 5EO9B 1WGVA 4LBAA 3V6OA 2B59B 5FECA 3HI1B 3IJSB 3FB8B 2Y6SD 1WPCA 3K8KA 1CTMA 1SQMA 3RU8H 3N0AA 1T1XB 1T2QH 1X5FA 3QIUB 4HUWA 3GIZH 3GBML 4O58L 5LNEA 1VKXB 1P4IL 5JQ6L 5GZND 1A3LH 1DFXA 4M7JL 1P4LA 2MEJB 4PRHE 2J1ZA 3QUYA 4MX7B 1PEZA 3DBSA 3IETA 2AXFA 5FUCE 5C6TH 4PBZA 6PAZA 1JDAA 4EKJA 5I8KH 2CE6A 3QUYB 5E4OA 5C0AB 4OF8A 3I3BA 2HFGH 3MRBB 3RWHB 4JG1L 2YPKB 4PTTB 5HHPA 3X11B 5K39A 1RFDH 1AYRA 5E9AA 1HXKA 3RWHA 1NEZG 3V2AR 4XPGH 4FKHA 3MUJA 2WM0A 3IFPB 3ESMA 4Q14A 4G8IB 3VCLA 2B5NA 1TYRA 3QNYB 3TV3L 2AJVH 3L4OD 3NABH 1XGRA 4LE8A 1FA4A 2KDYA 1H8OA 1FNEB 1XIPA 3JV6A 2LW3A 2ZCKH 5F21B 3RYMA 1IT9L 2P3YA 5I1JL 1WFTA 2YSSA 2NMSA 4WFGE 1E8WA 3SBWC 3T4AC 2CLRA 2R4SL 3IJHA 3ELAT 1HCFX 3KLQA 4CGUB 2XG4B 5D5ME 3CQPA 3AQZA 1IEHA 3R8QA 3U6RB 1IC1A 1RJLA 1DZ0A 3FZUD 2WXHA 3LQAL 1NEZA 3C6EA 3TO4A 4AM0Q 2GAZB 1EJ8A 3GJEA 2QFRA 2QSTA 3L3OB 3HB3C 1H3PH 2FYYA 5CMAA 3IBOA 1EJFA 2WIMA 3JZYA 1XHHA 4X9FA 1GZHA 2BVEA 3MLXH 4H8HA 4XMLL 5GGTA 3KVQA 4UAOC 4PGCA 4MB1A 1RUQH 3LQAH 4X2UA 5TDOA 4HIHB 1DQML 1P7KA 5JOFA 1N0LB 1ZY9A 4LAQH 4L9LC 1ZLSH 3QT2A 5EC1A 2DYSB 5H14A 1BYOA 4L8CA 1W91A 1X5JA 2RHEA 4HEME 2X4SB 4W9EC 5EA0L 3QZLA 3U7WH 1A4CA 4F92B 1HNGA 1OK8A 2GFBA 3Q13A 4JY4B 4WK2B 3MR9A 5L2JB 2DWEB 1CE6A 4DFIA 4IMMA 1DDHB 3QDHA 4WUUA 3KPMA 4F7KA 4ZQKB 2M8XA 2CDEB 1X9UA 3IRZA 1SEBA 4A6YA 3U0PA 2XA3A 1A7RH 2DKSA 3PHOA 2CO2A 3BYYA 5K93A 1CN4A 2OMWA 2HFGL 5E2JA 4NKOB 5ITFA 2CLVB 5FCUL 4KHXH 3PV6A 1PZAA 4QUOA 3G5ZB 1MXGA 3W0WA 2QGBA 5L8LB 3IGLA 1QMUA 4XBPB 4RMWA 3SYOA 3DSFH 2F7QA 3M17A 3NESA 3ZSTA 5ID1B 2BNRE 3H9YA 4R5TA 1CXKA 4XB8A 1DBJH 3MXVH 4DGYL 4OJEH 4ELME 2WLYA 5ABZA 3DOIA 4IKIA 1OP5K 1EHLL 1F4YH 2DV6A 2PO6C 2Y1AA 4M5SA 2HWZH 5HYEA 5ENWB 3VXMB 5C2VB 1AD9A 3EQ8A 1F3RB 4O4YH 3G08A 3L3JB 1NOLA 2DQHL 5HDQL 5BRZB 4EVNB 2LABA 4H8PA 4GKSB 3IJEA 2Q10A 2PCFB 1QLFB 3DA0A 3QA3A 4AGOA 4ZTPH 1BVOA 4N9GA 1JMZA 3FT2B 5T5FL 3S96B 1B4JH 3RURA 4G56B 4FKKA 3EGSA 3VRIB 4X60B 4WTZA 1U4FA 1R5MA 1CI5A 4Y2OA 3TBWB 1F56A 2EVFA 1QLEH 3LN5A 3VXUE 3HG1D 3HJEA 1ID5I 3G5XB 3LMJH 3RVXC 5JWZA 2NY0D 2MKWA 3IF1B 3UBXG 4ECNA 2NY5C 4G1EA 3I2NA 5F89A 1JDDA 1JZIA 2AABL 3NEXA 3N42F 4QRPE 2ADJB 3QI9C 3TFKD 1U3HD 3BRDA 4IDJL 3IDXH 5ADOL 4S11A 3LXAA 1G7JA 4GXUM 1HH6A 5E99L 4ZZFA 4Y1AB 4CMHB 3P11H 2BKLA 3I7OA 3OW8A 3EYVB 4XODA 3W9DB 2X05A 2KZWA 3EI1B 1DQTA 3APCA 4JLRA 4H0GA 5DFVC 3VGFA 4AMZA 2FO4B 4JFDE 4PS8A 4NZUH 4NRYA 5JOPE 4XN2A 3C6SA 4WKZA 3QS3A 3MO1B 1AQMA 4Z7NA 4KZEL 5EBMA 1IGFL 5KVDL 2G2RB 5J1AA 2E74C 1I1FB 5DGRA 4YSEA 2AJSL 4A2HA 2VR6A 4MQSB 3S37H 2GBAA 2P5WD 2H3KA 1AH1A 1IJNA 2G60H 5I15H 1X7QA 3VWJB 4ZMLA 5L7XH 4FA1D 1C8QA 1G1KA 5F7KC 1GYAA 1K5WA 3GXFA 1ULVA 4JL2A 4C54A 1X5YA 2GUOA 3D33A 4NQSB 4Y9CA 3ZKXC 4Y9GA 4OZIB 2ICWJ 2AHIA 3WXVL 2R2HA 5MEQB 5L4IA 3BEVA 4YE4L 4DZ8A 4HS6A 4Q2ZA 4G5ZH 4E41B 4UANA 4LP4A 1OF0A 5LKNA 5H94A 1EAPA 4GP5B 3ULSA 2HJKA 12E8L 2HFTA 4R5XA 3TCLA 4HDIA 4X5RA 5D55A 4Z3GA 3NEEA 3AL8A 5DD6A 1GGUA 3G5VB 3P73B 4G7QB 4HKJB 2YNNA 1W16A 3DOSB 2XWBB 5A2FA 5I73C 3TNMA 1OAXH 3JB9L 2X6MA 3IJ1A 2ZYHA 3S36L 2GYSA 1F11B 4RFNC 5MENA 3QRFM 5JW4N 2KBGA 4YPGB 3U4AA 4HAFA 1THCA 3FAXA 3QAQA 2BCJB 1GY2A 3LRSA 1QA9B 4PJFB 3WLBB 3ZKND 2WWMD 2R9HD 3ECWA 3FPXA 4ELMA 5A6LA 3ALWA 3T2OA 2FIRT 4ORZC 2OMZA 4AEIL 3PGCA 3ZQWA 2R29L 1NTDA 2UY7A 1AFVL 1Z9SB 4L8DB 2NDGA 5C71A 1T7XA 5E2WL 2FSEB 4YDMA 2C9QA 1AMXA 5AMSA 1CCZA 4NC4A 2WWMC 5IB4A 1MQKH 3O9WC 2XICA 3L2NA 5JPMC 2XZQL 2YN5A 3VI4E 4KITB 3GLDA 1BM3H 3MNWA 4MZRA 4M48H 1IGCL 3JUZA 4HT1L 2EE3A 3CUPA 3RX7A 1GYVA 1J8SA 3WAKA 4IRSD 4WV1B 2H14A 3KVDD 5DMGC 1GOHA 3K27A 2XV2A 1PCSA 3W56A 5L6YL 3O6ML 1HL8A 3WNMA 1SJHB 2ENYA 2WPGA 4OLXL 4Q89A 3JV5A 1NCHA 4G8FA 1RJZA 3BW9B 1E3XA 1JGUL 3G6JB 3QYMA 4P2OC 4W6WB 1OHQA 2DIBA 2V2WB 3DX4A 3OKOA 4P2RB 1D5IL 3KGRA 4R97C 2X4NA 2OCFD 2WB7A 3WDHA 3E3QC 2QZQA 1RUPH 3WJLC 4JCWA 5T1MB 2DQ6A 2YD2A 3A4EA 1GTNA 1OALA 4JPKH 1QR1A 3TN0B 4V33A 3X3FL 3NIDE 3FO9A 2MTAH 1DQQA 3GXDA 5IBUG 5FK9B 2YPLB 3B1TA 4L3EA 1MI5B 4K7PY 2C7UB 5T3XD 4H13C 5CJ8A 1HHGB 1MH5B 2QKIC 5BUAA 1WS8A 3TBYA 5D7JC 3B56A 4JRYB 1C5BH 5DJ2B 4FFTA 1YA5A 2CDFA 4ZW7A 1CXFA 4TS6A 3MC0A 2P5PA 2ZXDA 4NSKB 2WINB 5GGSA 2WLIB 4KVCH 5TDHB 1HE7A 1YY9C 5CKAA 3MRNA 2W59A 3EMHA 1ACCA 3C6LB 4UDUB 4WIQA 5DR5L 1VKXA 1RXLA 3O0RL 4ONHB 4OZHF 4PRHD 4B53A 1II4E 1PZ3A 1FRGL 2G2NA 4FCAA 4NERA 5C07E 2Q8BH 3BG1A 5LAPA 3PS6A 4G6AC 5EUKB 1Z7JA 3SOBH 1BW8A 5J6HB 3G04B 1LE9B 1IM3D 1MCRA 4W9HC 1W8NA 2GSGA 2P5ED 2CIKA 4OF0A 4PLKD 5KOMC 1F18A 4XWGL 3VD3A 1RUKL 4H1LA 3QZWB 1LD9A 3WSQL 3FO1B 2C4XA 4HPYL 2J4WH 3TM6A 1U8CA 2ADIB 3KPOA 1MELA 4Y1AD 4Y16A 3VWKD 3F01A 1ZA3B 3UYRH 2EP6A 3QJVB 2Q3ZA 3RPIA 1S3KH 5HGAA 3QQ4A 3WMQA 5KS9F 5FR3A 4PW4A 1D7FA 1NGPH 2X4RA 4RAUA 4DO6A 5FYJD 1E4XH 4FLHA 1CXIA 3FSVA 2XN2A 3S97C 2GTWA 5MENE 1DSWA 1MWAL 3IDMB 3EWEA 3QQ4B 2PKDA 3HE6A 3MRHA 5EBGA 4WNSA 4AQ1C 5FUCC 5I66A 1KSRA 2HXCA 2AQ3A 3HAEA 3D12B 4P3DA 3OZ9L 3D39E 4WF7A 5JHBA 4QAMA 4A2FA 2NQDA 1AHWA 1VF5C 4AW7A 4KKCD 1PD6A 2L7QA 3SE3C 4HUKB 1G7PB 5K59E 4HOXA 4PJIF 5CIPA 3VXTA 1JYWA 5EEZA 4P57A 2Z8RA 1HESA 1RULL 4XN8A 3FCUA 3UGUA 4KKBC 5T5NG 1B6UA 4IRZA 3RAJL 1OOWA 4YQXH 2X1OA 1PMYA 1SEQH 2WW8A 4HIQA 4HZAA 1N3NB 2ZXWB 5GQBA 3SB3A 4JFFB 3SCYA 4P57B 4CZXA 2H32A 3C6LA 4KOCA 3ZHLA 2XWJA 2WBJA 4ORGB 1CFSB 4BKLA 1Z9LA 5C7XL 2NXYC 1UGNA 3RWGA 5KANI 1EXHA 1D5BA 4FXKC 3QDAA 4X9HA 4EIUA 4MB5A 2R1WB 3FB7B 4EQ3A 4N26A 3A0OA 1L9NA 4KAQL 1YEIL 4M8QB 3S3PA 3L7FA 4UQ9A 1XCWA 2BNUB 3QUKB 3V4PB 4H5IA 3MCG1 4G43B 3L5XL 1XHMA 3W1ZA 4NQCB 5DSCA 3UG4A 3BSGA 1NGWB 3MCKB 4HIXH 2EC8A 4EZKA 4BZ1A 1B0RB 2K7QA 4HC1L 4NWTH 1L0XA 3JTTA 3OBAA 4MXWL 2VLKE 3MU3A 2NY1D 3BQUC 5HJ3A 1H6FA 4PBYA 4M62L 3PHQA 1GZQA 3MLYH 3G5WA 2Q7YB 5EDXA 1FZJA 1NFAA 4M9PA 3I75B 2PW2B 3GKWL 4K55A 2F08A 2GAZA 1ZLVH 5B3SB 1EO8H 4GXVL 4QXGH 5IMMB 4ZK8A 3H9SA 1LO3H 1A02N 4U1GC 1T1YA 2CBOA 3UAJD 1KJMA 3T8XA 3UZVA 3LKPA 2VT0A 4YHZL 1NIFA 4MMYA 1NC4A 1SY6A 4W9FC 3BP5A 2MTAA 4CC4A 4JFEB 5AVTB 2ZCHL 1OQOA 2J1KA 1FNEA 2WXIA 5LGKA 3UPAA 5IM7A 3EI2A 4M03A 4QAWA 1GYCA 4IJ3C 2VR5A 4HCRA 4PLJC 3QWNA 1U8LA 4LQFL 4ODVL 2CG9X 1D5MA 2A83B 3TBYB 2ADFH 1ZXQA 2NX5D 3ALPA 5GRUH 4CC9A 3MV9E 1MCKA 5DFAA 1AKJB 4R7NB 3Q9QA 2ZAGA 5FA3A 3IU4H 1TZIA 1FLRH 4PNKB 1MQ8A 1PVHA 2GQHA 2ESVE 4QRQA 4EN3D 1UT9A 3DGCR 3WD5H 5J1SC 4JEGB 2YLHA 5JOPD 2B2XL 4OLZH 3EGDA 2PO6B 1OGAD 3BT0A 1TTAA 4CC1A 2VDPL 4LVHB 4JFYA 1LEIA 3Q0HA 1RJZB 1AGCB 2H26B 2NUTB 4PI2A 1J8HE 3HA0A 1Z9PA 1MFCH 3WKPA 1O6VA 2ZOLB 4J4PD 5FYJH 4M5YL 3HG5A 3QEQB 5F7EL 2W60B 3JUYA 4XXDB 1TTRA 1BGXL 3QDME 1R1CA 4BV1A 3AFLA 2D3NA 4NN7B 5JHDB 2V8LA 4KPHH 4JDEB 4XZUA 4OF6A 3RVWD 3TBSA 1OAKH 2BP5M 2ROYA 2W95A 1Q9WB 2E7LC 1JNHA 3WIIH 1FUNA 1P1VA 1MFCL 3JZ7A 3QEQE 4MRBA 2WYIA 1M3IA 4Z7UE 4KFMB 4KXAA 3ZTNH 4EZLA 4ETQA 1G9MH 5SXMA 2VSDA 1TKWA 4YHMH 2BVPA 1J11A 4WGKA 2QHLA 5DRWA 3QUMA 5MEOB 1AQDB 4JT5C 2WLMA 1N6DA 4QO1B 4R4FL 2B14A 4IBZA 3CFJB 3FU5A 4UNUA 3LZRA 4N5ED 4XMWA 4PHXA 2GTZB 4Y1TA 1ZLUK 2WWNA 4WK0A 4OQTL 4M1DL 4OCRH 1NEPA 3VSVA 5B38A 3CFJA 3ZTDC 3I9AA 4L29B 1U8IB 5E5RB 5I17A 4JRYD 2IALB 3MLVH 4MD4B 3C6SB 3ILPB 2LTQC 4WKZB 1FN4B 1HSBA 1DLHA 3QUMB 1F8TH 2YUVA 2FB4H 1JPFA 3N9GH 2MQ3A 3EO9H 5E7BA 2PPCA 3VAEA 5FYLD 1LP9F 1ZTXE 4PJHF 4Z7VB 3B8SA 1WAPA 2VDLB 1BA9A 3BWZA 4IW4C 4XT1C 5FLXg 3LEXA 5L88H 1CR9L 1TTBA 1YEHL 7PCYA 2QQQA 2J1YA 2HFFB 2Q7NA 3CFUA 5KYYB 1FJ1A 3GWJA 3U7YL 2AQTA 4GSXA 4JSVC 3APDA 2DMKA 4XNQA 3Q8BA 4JANA 2MIZA 1TO5A 3D3VD 3DV4B 3MRIA 4NWUH 4Z9KB 2NXZC 3FF7A 3GLZA 2QSCL 4TRPL 5TF2A 3I9GL 5J4MA 2AV1B 5HE3B 1E8ZA 3BAXA 1NCDL 1FFNA 3CC5A 3VH8B 3GUTA 1AGEB 1UOPA 2WKLA 3DX7A 5I19L 3BPOB 4AOWA 2J71A 3MV01 1IC7H 3R4DA 2VR9A 4MTMA 4PJ7F 5JNYA 3BX7C 2FZ3A 3QS2A 5J8OA 1PZ5A 3N41B 5LGJA 3OV6A 2DQCL 3QNZB 5AZUA 4CRPA 4YH6A 3WJJC 2C3HA 1Q9KA 3II1A 1MJJA 3U46A 1PZ5B 3RLMD 3DUSA 4GO8A 1YZZA 4S2SB 1PJWA 2ZOWA 1CGWA 5DDHA 5FW7A 2WCPA 1G4MA 5I2IB 2ZYIA 4TUOB 3QNXA 1HI6A 3VU2A 3WKYA 5IJKC 2KPNA 3C09B 1JCKA 4P05A 2ZSWA 1BXXA 2EDJA 4OY9A 3K1DA 3QORA 4ODXB 4KKAD 5F8RC 4YHYB 5T5FA 3CNKA 3CSGA 4QT8A 3KVPA 1KIPB 4K3ID 3NACL 3W15A 1A2YA 1NFDB 1G6RB 3DV6A 4PGEA 3KS0H 2BXZA 2L04A 1ZANH 4LZKA 4HHWA 2OP4L 2CDEA 1DVQA 4OF3A 5CLXA 2WXQA 1CYXA 2VDOA 2F7IA 2FH8A 1B0RA 1J86A 1KT2B 4HKZA 4B9KC 2DWEA 3HC3L 4PV9B 1PAZA 3PV6B 4ANVA 2IMNA 4CVXB 4Q97A 2VLKA 3KJ6L 1WAEA 5D1XB 3DRQB 2MCPL 4ZXBA 4ZODA 5FF6B 4DO4A 3DURA 1HHIB 1HHKB 2NYZA 2QZ5A 5IFHH 2EDLA 2GIYA 2BS8A 3APNA 3SE4C 3NZHH 4JFSA 1T5KA 4GRWB 4L4JA 1JRHH 5KSBA 3TONA 5AOIA 3T04D 1QSVA 5TQ0H 4PJDA 3QUXC 4MHHG 1LO0H 1VZGA 1WUNT 4WEMB 4WZ9A 1DJSA 3A67L 2EVGA 4L5FE 3G3LA 1MHEB 4KJYA 4XNZC 1AC6A 3J2PA 1I8MB 5A6MA 1HK6A 1MW2A 4U4IA 2GITA 1BDYA 1EHNA 1PYWB 5D70L 2XA8H 4FXGA 4OIBA 3FQUA 4K8RH 2HU7A 2YRBA 5GRZA 2WQWA 3DK2A 1G9EA 4AX3A 5GZOC 1DBBL 1ET8A 2Y22A 1EV2E 1I31A 1I1RA 4NAJA 5IMOA 3R4RA 1F1GA 4XC1H 4AEHL 2ZUYA 1F58H 3VRJA 3IM1A 3K81A 3BCDA 2JNZA 3HEIB 4PJ7A 2VQTA 4Y2NA 4KRPC 1UYWL 3EDFA 2A73A 5D1ZA 5IB5A 1F6LL 5EIIB 5GZOD 5CXCB 4UAOB 2WQSA 1V3KA 5ANHA 3VGBA 2Y4SA 1N6UA 3TPUA 3TV3H 3LNEA 1ZKAA 2IGFH 4HWNA 1EGJA 5EZLA 1CL7I 4NFBA 4OLWH 1NCOA 4YX2H 1NBYA 4JQVA 1JI1A 4XP1H 5EMLB 5ANMA 1W0YT 5F7LB 5CD3B 1H3XA 2XUWA 4QXTB 1QFSA 2KYIA 2VXUH 3AB0C 1BLNA 3WY1A 4A66A 2PPEA 3GD1I 3D08A 4BK8A 1GOFA 1SYVA 3MCYA 4JDZB 4KI5C 5K9OB 4G6KL 5BQDA 3OAZK 4DHLA 2LFGA 3FRPA 5DTFB 2Q76A 5C0CA 1WAAA 1WWWX 3FN9A 1EBPA 2ZUQB 1SYVB 4KQ3H 4XAWH 5D1XD 1MNNA 2E46A 1CDCA 5BVPH 5DI8B 1WAAE 4AE0A 2OVPB 3MRFB 4BFJA 4DESA 2ADGA 3KPRD 1F02I 4PN6A 4LLDA 4R26H 1GCFA 2EDFA 3KPQB 3NIGF 2OZNA 4P0DA 5K5YA 4JPKL 1VE6A 3MXWL 2HYEA 2JQAA 3LXBA 2EUXA 3TBTA 1DVZA 3B2XA 4Z7NE 3FFOA 3UPCA 5EIVA 2WO3B 4FL4B 4E9QA 2XN9B 5AVZB 4NHCH 3WY2A 5FUOH 3D50A 1PSKH 2PYED 1U8JB 3DMMD 2CM6A 4TVPH 2Q7QA 1KYDA 4JD2C 2H0PA 5LBGA 1EANA 2BZ7A 3FRPB 1ZLWK 1UWEH 4PIBA 2ITDA 1F58L 1T7ZA 4HD9A 4HIEB 4MASA 1MRFH 4LL4A 1FCCA 2AABH 2L7UA 3EGXB 1CU4L 2GW5A 4FS0A 5IT2H 3V79C 3IJ8A 1TQWA 5ICZA 2W18A 1XF1A 1OPOA 2NYYC 5AVQB 4ERYA 1SJMA 2OMUA 1IGCH 4HF5L 1SJHA 4R5VA 2GJ6A 4N8VB 3SKJL 3P11L 4AMKH 2X0UA 4GJTB 2HU8A 3B83A 4M02A 2Q9OA 3S98A 1FC1A 4AYEC 4XOEA 4TN9A 4NZUL 2Y1ZA 2GNQA 3QZOA 4HG4K 4A0AB 1Z32X 1WK0A 4OQTA 2VQ1B 4G9FB 5D7HA 2VXUL 1P9MC 3T2LA 4PCYA 2QTEA 3JZGA 3U6XA 1QP1A 2AJ3A 4I18B 3TWCL 1OLZA 2DQHH 3TURA 1NCWL 1Q90A 4FQ1L 4MWFA 1A9VA 2W9EL 2DZEA 2OXHA 3SVWD 1XGUA 1CE1H 2YD6A 4NPYA 5J6SA 4K07A 4B27A 2BSDA 4HZLA 2D2CC 4F2ME 3MOAL 1GA2A 4ELMB 2QSQA 1PQZB 5L2KA 3S8FB 1WO2A 2XDHA 4ZZKA 3FU0A 1D9KB 1XH3A 5DD3H 3NQIA 3IFOA 4RGND 4KKRA 4N8UA 1U41A 2DIEA 3KPPA 2IPKB 1QFOA 3QQ3A 4FKEA 4L8SC 4M7KH 2HPTA 1ZHNA 1VFBA 2P8MA 1MG3C 3MUZ1 4HGWA 5AL0A 1WDAA 3QPKA 3TVMA 4N9OB 3DO4A 2F53E 1P7QB 5FYKH 3BUDA 2F8OA 1PGUA 2E9WA 2OMBA 4L8BB 4RGNE 4IDJH 4L3HD 2IIJA 3OSVA 1P1ZB 3OQRA 3IDJB 2J8UF 1OMWB 2JVUA 2DJ4A 4HH9B 1VFMA 1YEGL 5EBLA 3WNNA 3DX1A 5C70A 4OLVH 3SOBL 5D1XA 4PWJA 1NLDH 5IJVB 1E9PA 1I7UA 4GW5B 4AY0A 1AYOA 4OUUA 1WIOA 5JDJA 5HI5D 2ICCA 5GGSB 3CZUB 2P48B 1HX0A 4U4BA 5LUMA 4AMYA 3NCEB 1AGDA 1XBDA 2J2ZB 4MDJB 5E6RB 3RGBA 4LHJB 3RKDD 2VLLB 4EJ1C 2PWEA 2HLAB 3NH7H 3QWOB 1UWGL 3OXSB 4ODHL 1NC2B 4X7FC 4Z76B 3BP7A 3RZWA 3P0VL 5SWQB 3DGGB 2X9YA 3LCYA 4BH8A 1GTFA 3WIFB 1AO7A 2OYMA 1IFHL 4L3EE 2KQNA 4LHUB 4X8XA 2FATH 4YDVA 5DHYB 3V0JA 3GRWH 4BQBA 4YSQA 4KI1A 5KWYC 4PRDA 1KY6A 3RJOA 2A6KA 4Q52A 1E2WA 4UI2A 4P48A 4I9WE 5GZOA 4OF7A 1M7IB 2Z0UA 4ZX6A 3FT3B 1GXRA 1P4BH 1I7UB 1QASA 2FBJL 1HSBB 5DEGA 4A7SA 1IGTB 3MI6A 1MW1A 4KKNA 1MY7A 3ZZ1A 2FLBT 1TUPA 2P24A 3CTTA 2J73A 1UACL 2EDWA 3K7UA 5A7BA 3CQQA 3WEXB 1BQSA 1X5ZA 5FAAA 4PS7A 2IH3A 1FFOA 3ARBD 3DPDA 3LEXB 3WFDL 4J28A 1PZBA 4Z7QE 5E8DL 3HE7A 3NIGB 3L5JA 5KYXA 3OKEA 4LEBA 3BIBX 1KTBA 3FTVA 3HE6C 3MROB 4RLDA 5IW3A 4F9PC 1GP2B 2HH0H 3P4LA 2F5BH 3G5ZA 4IBLT 1DFBL 3W0WB 4Z3JA 1SMOA 2K0RA 1AHKA 4Q9CA 1MHHA 3SPHA 2K4WA 2ZOKB 3B34A 1NFDF 5SWSD 2WZPA 2PO6D 1FGNL 4F8LA 2V17H 2F2HA 2XPGA 4HYTB 1N68A 3IVKB 3SDYH 4QHMA 4Q9BA 4M48L 4NQDD 2FT6A 4ZTOH 3UP1A 4XBEH 3NGBB 4AVIA 4B0MB 4KKLC 4HIEA 4A6YL 1OTSD 1AANA 5HYJA 1AKJD 1DR9A 3H3BC 1U8IA 1KCWA 3U1QA 1HH9B 3OKYB 1HOCA 3I74A 3T6WA 3C99A 4G7VL 5JHMA 1WFJA 4OZIF 2DLIA 2DLGA 3MGOA 2HG5A 3D09A 1BIHA 1NH6A 2E4TA 2LU5A 4RESB 3WLWD 3FULA 3K3QA 3SGDI 3PWVB 4POZC 1KV7A 1MNUH 4NKDB 3PJLA 1UHVA 1LQSR 4TVPE 5JDSA 4X7TB 3FO0L 1DDHA 5D9SB 1OE3A 2FECI 2LOEA 1FYHB 1U8MA 3AXHA 3MCLL 3CDGA 1LE5A 4UT9L 2MCMA 3WOVA 5E8OA 1B3IA 5KJRH 4IDLA 3L5HA 2EUVA 2R0KL 5DTFA 1DL7H 3PF2A 2JCCF 4B9ZA 4A7JA 4RX4D 4Z7OF 4OUOA 1QRNE 4M7JH 1T66D 2OZ4L 4HEMA 5AW1B 2DQGH 1R75A 5JORB 2Y7QA 4HOZA 5CJXA 2ICWB 3UABA 4AW4A 2H9LA 3W39A 3OL2A 5IBTH 5E00A 3B6SA 4XC3H 2BVQA 2NYKA 2Q7YA 3PHQB 3UTZB 2CHZA 3JWNE 3VD1A 2WC7A 5DVNA 1KJVA 4PTUA 4P46A 5EORL 1CR9H 1GKOA 1YEHH 2O61B 4ZX4A 4JG0L 5AOKA 1BXAA 2WZAA 4LGRB 3UTQA 4AKQA 1QWHA 1HZKA 3V7AG 4M6NL 4U6YA 2E6PA 4WI7A 4XI5C 1GS7A 3KWWB 4N0YL 3HNVH 3FS9A 1XSKA 3GB7A 3UAEA 1B6DA 1F4XH 2Y2YA 3PWJA 4PB0H 1FNLA 1YPZE 3O3DB 3WFBH 2OI9C 1NR0A 3GFUA 1ZAGA 3IDIA 5CBAA 1FNAA 4UT6H 3T2NL 4ZW5A 4X63B 4XNBA 2ZIDA 3KL5A 2CUAA 2CH8A 3VD4A 2KI6A 4U1IA 1I9IH 2KH2B 1IILE 3BT2L 3QXDB 2OMTA 4NGHH 1N6QL 3GK8L 4JT6C 2YSTA 3BWAB 2PCYA 3KLSA 4FQPA 1A6PA 2P5EB 4LLWA 3IJ7A 4ADGA 3ZK0A 3UG3A 4JXMA 2IDUA 3T08A 5BOPA 3PHAA 5EBWA 5TQ2L 3F05A 4LVOC 2KPWA 4AGLA 1DYZA 4M6OH 3FT2A 1RZ7L 3KRWB 3OKMA 2D7TH 5E6YA 3ASNB 2EZ0D 3FQTB 3I2CL 1YR2A 5T1JA 5CSBA 5M95B 3MREB 2AANA 4C58B 1TETH 1PLGH 5J9PA 3E1ZA 3V52H 2R2BB 3CFKA 2YD7A 2X6CA 1EGJH 4BSVA 1JCVA 3OVUB 5J06A 2XVKA 5K69A 5EO9A 2ERJB 2V9UA 5KANG 2EDXA 2H1XA 4YHIB 3HZYB 4OI8A 4KKBD 4LSVL 4QRTB 5A2IH 3QDGB 4N8CL 4AXWB 3M6DA 3MX0A 2HX8A 4XCNB 4X5XB 4XO9A 2OIZA 1IM3B 4U3XA 1KB5H 2W1NA 3TPKA 5E94A 2GEQA 5JW5A 2HUHA 4XAKE 3BN3B 3X12A 3E1F1 5IHUL 4XNUL 1X4XA 2W0LA 4JFDA 5MI0C 1KIRA 1EUTA 4AVJA 3P1VA 4UYPA 5EHFA 4WTWA 1U6AH 3ZO9A 1NM4A 3ZYOA 3F7VB 1T0OA 3GDBA 3NJNA 4OKDA 1FYTE 4KK9C 4YZFF 4LP8A 5TGBA 4GSQA 3HNVL 4K0OA 1BEYL 4P9MH 2AGJH 1NSNH 2X5PA 3G6JF 4P46C 4HIXL 4R7XA 1FVCA 2CWRA 2HRPH 2KT6A 3HG3A 4XNXL 3RTLA 4TPRL 5DS2A 4ZFGL 4LCWA 4AXWA 2ZSWB 1BFSA 1MI5D 3V5KB 4BRJA 5JIHA 1FL5A 3NCMA 3DXAB 4HC1A 1PLCA 3D06A 3KL0A 2JKXA 4J3XA 3OLIA 4D6VA 2V2XB 4JO3L 1XCTB 1XAKA 3D48R 3D69B 4JREC 4NM8L 5DMKA 2ZG2A 3L3HB 2Z2NA 1RUAL 4M29A 4QTHB 5G5DA 4P5TB 4LBEB 5DVLA 3SKMA 1JZ3A 1IQWH 4N2FA 4F1ZA 2JKSA 2NXZB 4D3CH 3MBWB 4X4ME 3V6OC 3SSGA 1HNYA 4NIKB 4O45A 3LRLA 3BDXA 4K2UH 2CO6A 1A5FH 2N3JA 1ZV2A 1VIWA 2VMCA 2HSIA 2Q2LA 4IYKA 1A2YB 1NFDA 2ZE0A 3VXQB 4TOYH 3SJVA 1XD1A 3WN5B 1FVEB 5HI3D 1R47A 2B16A 1GGTA 1TJGL 3HNSL 3TF4A 1B90A 1EGJL 2AKRA 1R5WA 2I0SA 3OQ3B 5ICYA 3B9VA 3CC5B 3GLAA 2QV4A 3QUZB 3RDTA 3JV6B 3NCJH 1EEQA 5I2IA 3NOIA 4Y4HD 4I9XA 2D31B 5E99H 2QKIB 4CSZA 4XP5L 2BC4A 3MSPA 2G99A 3GM8A 1H3GA 5D7LB 1R19A 1HE8A 3QIBD 3ZQXA 2FBRA 2J56H 1BFVH 1QBLH 2HFFA 3N9GL 3BH8B 1UUNA 1U2VC 4LLVA 1JWMA 3ARUA 5CIPH 1QHQA 3BUPA 4JSPC 3FRXA 3DVNA 3VNZA 3IVMA 4DKFH 4YX2L 2K8QA 4IU2B 5J1TC 1I2MB 4GRLB 4MGXA 3SY6A 2CJ3A 4BFOA 5FOBB 4FZEH 1QQDA 3QAZB 3QIUC 2X4NB 2C9UA 2K9UA 2YLKA 3VH8A 3NZHL 3NAAL 2A4ZA 3OAYH 4UILH 4UZGA 4WI2A 1T1XA 4PREA 3TBBA 4I0KA 4FG6C 2NZ9D 1Z0MA 1KIUB 1SHXA 3DTDA 1IKOP 5F7BA 4XX1E 5D9SA 2EIEA 1MG2C 5E6IC 1RVFH 4HFWB 3VA6A 1EFXA 5T1DL 5GHWL 2EVHA 5BMFH 1KJ3L 4XO5A 1TCRB 2DKUA 3KS0J 3OKOB 2A4CA 2MFNA 3DI2B 2KMWA 3JAMg 4JGMA 3VGDA 4TL5A 5IVXF 3ALXA 2DQCH 1QRNA 1HH9A 2NY5H 4D9QD 5IB4B 4A7UA 4FULA 1OAXL 5I18L 5L4MA 4R83A 3B6SB 4J8RA 4JZNA 1S3RA 1G43A 3DO7A 3N41F 4FHBD 2VXQH 4WV1A 1MFAH 4UIMA 2OSLB 4KMTL 5LGHL 2GJZA 4GLRI 6TAAA 1VPOL 5EEVA 4GBXC 2OR8A 3IDNA 2W65A 3D5OF 2NR6D 3PP4H 2OMXA 2YZ8A 2ENQA 1Z66A 3QP3A 5I8CA 2GK2A 4CMMA 2VJ8A 3D3VA 3H9SE 3WKML 2N7AA 2QFPA 2R29H 3L9YA 4BYHA 1JK8A 3GS0A 5H35B 5I1LB 3HI6H 4XVUC 4LLMB 4UOQA 1PZ2A 2FJSA 4WSKA 2JKTM 1HQRA 3GS7A 1KEMH 2O4EA 3D25B 3JT0A 4I3SL 5CILL 2L7JA 5JW3L 2R27A 5DURB 2DLFL 4JO2L 1JN6A 5FQDA 1VGKB 1XR8B 2D3JA 3GSNH 4QRAA 1NLBH 2ZOKA 2QT6A 4OV5B 4UQ2A 1U3HB 3CG8A 2UZXB 4NRYB 2JKWA 4UILL 5BV7B 3VDBA 5EOCL 5CCHE 2IBBA 3EH5B 4Y9BA 2VM4A 3NJGA 5KYUB 1HJBC 1YUKB 2ALWA 3SKUD 3FN0L 5LXGH 1BQ5A 1G7JB 4LCYB 4KI5D 5DEJA 2ZKHH 4BIKA 1X7QB 4GI6A 2DM4A 3RI5K 3WMSA 5H17A 1T2XA 1IEBA 1BQHB 1J8RA 3W81A 5C09E 4TUJA 1EX0A 4ZSOB 5E6IA 2NY6B 3ARRA 1PX8A 1SLVA 4HS6B 4R96B 4YDIL 4DZ8B 1LO2H 1NDGB 3EJTA 5I75B 4AE1A 3FMGH 2WCGA 4POUB 4YXLL 5JPNC 2Z8VC 3HBGA 4L3ED 3ULSB 5D7KE 1BQLL 3LZOA 2WUCL 4R96A 2ZX6A 4NO3A 3EFFA 4A7GF 2EYSA 1G0YR 4I4WB 3TL5A 1P22A 5EMKB 1H3UA 2GCYB 4PAZA 4MAZA 5DHYA 4C59B 2W81C 1QUPA 5D7EA 2A9ML 2AQSA 1QKZH 3NSFA 5DFWH 1JBJA 3VWJA 2LR4A 1KCSL 3MLTA 5DJ8A 3LX9A 2E4FA 4WI3A 1IUZA 1CLYL 2BHUA 3OAUH 5FYLH 1I8UA 2A77L 3UJJH 4I0PD 1T89C 1CLOL 4CADB 4LNRA 1QSFE 3U9UB 1RU9L 1WAAF 2B9AA 3Q5TA 1KLFB 3QXTA 4PV1C 4Y5VA 3GC3B 1DDTA 4XHJC 3B9DA 4Y5VC 3OAUL 4PJCF 1JZ7A 4LCCA 2EDQA 2XWCA 3SMRA 5CGTA 3ZRSA 5GRXG 3VW3H 2ICWI 2Z7WA 1S7RB 5KYWA 3I7PA 3I8CA 5EWIH 3IFOB 1QFUH 4FQXD 4J3BA 5A1AA 5M5RA 3FQYA 2Q86A 1JVLA 1I1YB 3L3GB 2MPVA 4KRPB 2IH1A 3FTSA 1PQZA 4H8UA 3NJKA 5I74C 3V4PA 2KLRA 2ZYSA 3GM0A 5DLML 4BQ8A 4ENEC 2YD3A 2GTZA 4HMEA 4KX9A 2OXHB 1DE4B 2KLSA 3A0FA 3SHSA 3DPBA 4NUQA 2NPLX 1ORSA 4FF9A 2CR6A 2ODIA 1YECL 3QI0A 3KXFD 2BOLA 1MCJA 3PNRB 4ONFL 4YDJA 3C9CA 4OCSH 5DLMH 3JWNC 3WFCH 1QBAA 1I9JL 4JO1H 5L9DL 4Y5RD 5AW4B 1MHCB 2C34A 3MLRL 5ICUA 1Q72H 1O6SB 4XVJL 3INUL 2IADB 2FRGP 1YECH 3TVMD 2H47A 4WWKB 3PHOB 3STLB 4KTDH 3OKKA 1KZYA 5TDPA 1HJCA 3KYOA 2FYYB 2F5BL 5CMAB 4L48A 1KPVB 1P7QA 4BELD 2A9MH 3M46A 4XYIA 3HHSB 3DVIA 1Q72L 4JRXE 2B08A 1E7VA 2H32H 2Z4QA 3J7HA 3ISYA 5KBLA 5DHVH 4BSVB 4HWBA 1SJEA 1MREL 5F6IC 4Z7OE 1F00I 5H35A 4E68A 1KDIA 1INDL 2KZKA 4A67A 3D8MA 1XGTB 3TU6A 1XH3B 5JPMA 2R1YA 4MDIA 3CLEL 3QUYC 1HNFA 4Y19B 6PCYA 3LH2L 1IIKA 5C0AD 4QRPB 1KYUA 2Z93A 1EDHA 1KTLA 2P5WA 3V4VL 3FB5A 3DYMA 5TE4L 2H68A 4ERZA 4K3HA 4I1PA 4U1MB 3U7AA 3DXMC 4BH7A 4B9GA 1P53A 3V4VA 4PP1D 3JYBA 3DO3A 4MWFB 4Y4FC 1EEYB 3U4YA 2Z34A 1S5IH 3UC0L 1LWRA 2X09A 4S1SH 4U3SB 4HIHA 2AJZA 3O41A 3DJRA 5J6GB 3K0YA 4YAQA 3PABB 4WV1C 3KWXA 4XRCA 2BSEA 1V7MH 4UDUA 2AJVL 3K4DA 4EIBA 3O81A 2YBGA 5C2UB 1K6QH 3VFGH 4KNQA 4KVPA 3FH7A 3CV5A 3O3AA 2JIXB 1FG2B 2PTTA 5IBLC 3LNDA 4LSUL 4M3JA 5AVYB 5ID0B 2WXNA 4KQ3L 4WFEE 2VOTA 3U4KA 1OWWA 2K4AA 5T5NF 3TASA 4ETYA 4LPCA 1HHGA 1MJUL 2XWTB 5SX4H 2NYYD 1TT6A 3HG2A 4PG2C 2HLFC 3P0GB 4G3YH 4PYHA 3EH2A 2ID5A 1E27B 5EM2A 2EKSA 4M8UA 4YR6B 3QNYA 2AEWA 1UM5L 4AH2B 3QZNA 4GBXB 2P5EA 3NJHA 32C2B 4YO0A 3IN2A 5E08H 1ZIBA 4RH4A 3VVVA 4NPKA 5D5MF 4P06A 4YFEA 3IFLL 4LCWB 3K2IA 4KUCF 4W9CC 4J7RA 3VRLE 2NY2D 4BUQA 4KTEH 5C9ZB 5FXYA 2ARWA 2R9HC 4FERA 1YEFL 1L7TL 4KKZA 4X7TA 1JHTB 3NVQA 2CK0L 3H42H 3IKCB 4DCQA 3GSQA 3P4MB 4A2LA 2C9VA 4QHLB 5I5RA 3V6OE 2WXOA 4PJBF 2FJFA 2LLNA 1B9YA 3WN5C 5I23A 1TQVA 3CSFA 3V9EA 1H3WM 4RBPK 5HHOD 4PJIE 2MOVA 2WLLB 3WN5A 1E5CA 1IKNC 1MDTA 3VD5A 4XPBH 3CBJB 3RGVB 4PJIA 5C8JA 2EEAA 3FSWA 2VH5H 1M53A 3C8KB 3A5VA 3IJYA 4X4YB 5KVEH 3ARYA 4NQCE 5T3XL 5MERA 1AE6L 5DD6B 4MNQA 4FHKA 4FP8H 5D1QB 2TAAA 2Y3NA 5D1ZD 5T3ZD 5C3TA 3ZZLA 4HUVA 1Q94B 5AKVA 4FXTA 5DVMA 4XPBL 2VN5A 4NYLB 4C4UA 4EPSA 2CRZA 2FD6H 1E4XL 2FBJH 1FZMB 4FXGC 4U1JB 3U48A 1CURA 1QACA 1VEPA 4HLJA 5DJYA 1I1YA 1XGQB 2X3BA 3O4LA 4YNYA 3MNVB 1MCWW 2O6DA 3PXLA 2VTFA 1U8MB 4Y4KD 3V0WL 3MMEB 1ECYA 4BA0A 2XTJB 2DS4A 1JV5A 4MA8L 1KACB 2OJEA 4M3HA 1U8CB 2ADIA 2KZ1B 2FB4L 5CGBA 3M8OH 1KPVA 4UUJA 3SQBB 3V6FB 5KBPA 4OLVL 1ND0B 4LEOB 4TULH 1WC7A 4KV5F 5TFSL 2BSRB 3SQOL 2NY4B 5DUML 5AYUH 1I8LA 5DMIH 5CCKL 3TO4D 5C3IA 2F53B 4LFHG 3PXHA 3MRKB 2G9KA 3IPEA 4FOMA 3GB7B 2GK0B 4HJ0D 1PW3A 3CFEB 3U1SL 2VDOB 4Z78A 2JKNA 4GP4B 5HYJB 5A2Qg 4CW1A 3V4PL 4NC0B 4AJ0A 3FM0A 3AY2A 1QFWI 2JWYA 4IMLA 4N28A 1KBPA 4XOAA 2B4CC 4HKZB 3AS3A 4NNPL 3MRJB 1NMBH 1J0YA 2C9RA 2JH2A 1J05A 2VLJB 3GSRB 1CF8L 5C86A 3RIFF 3T1FA 1HHHA 1OARL 3TXAA 3C87A 2CUHA 4FA5D 3SBQA 3QHZL 4FI6A 4PJ8C 4JFZL 1RZ8A 1ZDSA 1G0DA 2OBGA 4XCFH 5CN2A 4YGVA 4FAVD 1QVOA 4Q6IA 1MUJA 1UEMA 3LQZA 1RHHB 4W68A 1UVQA 5EF2A 5FHBL 2WN2A 3ULUE 4CMHC 3B2MA 1KYOJ 4ZOYA 4XCYA 2QBWA 4JN2A 1Y0LB 3B7TA 5IR1B 1MCHA 3P2BA 2X4UB 2OFQA 3VXSD 4Y4KB 4LF3A 4JRXA 1X5MA 1P2CA 4WFGD 3UTTE 5IR1A 3GDCA 4ISVB 3HZVB 1MVFA 1UWXH 3MZTA 1UTDA 4LPYA 4TQ8A 4B3VA 3DUHA 1SUJA 3M8OL 2X89A 2KZBA 1T03L 4XP6H 2O61A 2QQLL 4FC3E 1P6WA 5CN1A 3MRGB 5E23A 3SE9H 1VFBB 2P8MB 4HGWB 3T71A 1BQKA 4Z7WB 5IJCC 3QDGE 3U0WL 3MJ8A 4OZFA 4HXBH 3WIFA 2F54E 4ERQA 3O6LL 2H9NA 2Z9TA 2ZWKA 5B38B 1CBVL 2L4OA 4N2AA 3FDWA 1M57B 2QV2A 4PJAA 4C4KO 4X4XA 1SJXA 1J1XL 1UT1A 1GSKA 2PN5A 4HIIB 2VSMB 3O4GA 4UM8A 4NJ9L 4CSSA 4YZWA 4IU3B 5KSVA 1MVYA 1N19A 3MLZL 5GGVH 2PNDA 4LRNL 3WO4B 3CXHJ 3MVSA 1DANT 1J8HB 1FN4A 3IU3B 4M62H 1JZ6A 3CHSA 1GAFL 4ERSL 4I18C 5A2LH 3KYKL 2BNQE 3G9VA 1G7QB 3NFPB 1TEYA 1LO0L 3GMLB 3T8VA 3GSVA 4K9EL 5AW5B 4B41A 3QHZH 5LNDA 5CINH 2JMRA 3HE7B 2DWTA 3TV8A 3GF8A 1OANA 1OB1A 4R4NC 4TNGA 3IJ9A 4IBUA 4KZDL 4DWHA 5BNXD 4YSAA 3GSVB 3B2PA 4K8RL 4WW2B 3K6FA 3OPUA 4WY7H 3WIHH 1QSFA 2J88H 4DNWA 3I7NA 5CP3A 4YZFE 4Q6IC 1K8KC 1X44A 5BUGA 3VXSA 1K4CA 1MFAL 3FHEA 4PG9A 1AR1B 1F90L 2NLJB 3OKDB 4HWUA 4EUPH 4P4KC 3MV8B 2AK1L 5B38G 4OWRA 1RV6X 5IBTL 4ETQB 4ZMOA 4AZ8A 1SDAB 5JMRA 1BQHG 1XD0A 3BIAX 1F86A 2VDPA 1Q9WA 3Q06A 1JWMB 1I1AC 1GC1H 1S7VB 4DVRL 3S4SA 1EJOH 5ITBL 1DVXA 2QZPA 4JPQA 2VL5A 3G9AB 3SDXB 3PAZA 4IK7A 4LLUB 3MYZA 3UIZA 3L4MD 3CLFH 3ZJAA 1QQDB 3R1GH 2ATPA 1S6NA 3MKGA 3NP3A 4K3EL 4LGPB 1QSEE 2BSCA 3GBDA 2CK2A 2BY3A 3S6CA 1FLRL 3ZYZA 3DX6B 3KLKA 1XWVA 1JHKL 3R7RA 1MFMA 3RIKA 3ARED 1YLBB 1L4IA 4X5WA 1WEJH 3K2UL 3PVWB 1XGRB 4HW6A 4YHYC 3VFVB 4PWKA 2GSMB 1KB9K 4GI8A 1VA9A 3EBIA 3C9NB 4YVUA 3ZVVA 3WFBL 2GSIB 5T1LD 4PC0A 5F88B 5LNGA 3D18B 4ABUA 1KB3A 2AQQA 2VDKH 4CL7A 4HBQA 2IH8A 3VXME 3VX0A 4LSPH 1SDDA 1PLGL 1I7TB 4AM0B 4IBVA 5IJKA 3DVNB 4DAGL 3QCVH 5E6UB 4PJAF 4Y7MA 5F9AC 2VDRL 4OZHE 5E24E 4D9LL 3WS6C 1DQMH 5GGQH 1KXVA 4XMUA 5B39A 4L1HA 2J8HA 4KX8A 4MNGB 1WCQA 2PUQT 4D8PB 4DP7X 3EOYG 2JI3A 3MBED 2Z91A 5L2KB 2LHAA 4DN4L 2BY1A 2EYRA 2K6ZA 4R4FH 4G8GD 3FB7A 3D51A 1FG2A 4UOJA 5ALCH 3W9EA 2VDMB 4AT6B 1DANU 1Q9LB 2A5UA 1AHWC 4CVUA 3UAJA 3L48A 4Q58C 1FE8L 2FWOA 1AGFA 1BVKA 1URZA 3FOLB 3X17A 5LJYH 5IESH 2B0SL 4D0DA 3FTUA 2WYTA 1A7NL 3EBAA 5DD0L 5EBLB 1KCKA 2XXCB 4GB9A 1I8MA 2E3VA 3QQDA 2XQYK 1I3UA 1P1ZA 1MHEA 4JB9L 3QUMH 4PQXA 3WEAA 1W9XA 4ZJ9A 2C1OB 5BXFA 3U0TA 3NCBB 5IV2B 4URKA 4Q74A 5ERWA 3AU0A 4LNVA 1XL6A 1PNDA 3OKLB 4U1MA 4FABH 5BXFB 4WUUB 3ARGA 2BSTA 5L88L 1Y1UA 3P30H 1BX2B 1F6AB 5HY9B 4JO3H 4ZNEA 1AZBA 4CKVX 1I8LC 1XR9A 3VFOB 3SD2A 1R6VA 3GSOA 5DK0A 4ZMAT 4DN3L 3N1MC 3FOLA 5SWSE 1IBGH 4X0NA 4QLRA 5CIPB 2X1QA 1TG8A 1I75A 5DWUH 2E27H 5BZZA 4WI9A 4MD5A 3HMXH 3UTSE 2BP0A 2VN4A 2NY7L 2NW3B 4H5SB 1U4CA 3HOGA 2B1HH 4HJ0C 4HUUA 2H8PB 5IVOA 1OAJA 4AENA 4FLSA 2MJWA 3P4FA 3IJYB 4X4YA 2MQGA 4RAVB 4HUUB 1WFOA 5EEXA 2VC2B 2JLLA 1Y07A 4TUKL 1TLMA 1WT5C 4C47A 5JHLA 1D7CA 2VDNH 1RIUL 3IDMA 4FTVA 4J87A 2Z64C 3KPOB 3LNGA 1E5BA 5C0IB 3GSOB 5DK0B 3QG7L 2Q76B 5IQ9A 5C0CB 1KXVC 5EU5A 2ZYRA 3FQTA 5HYSA 2G30A 4X6EB 1S7TA 2YN3A 3GIZL 4O58H 2GSGB 5GISL 4MNQE 4N90D 5TJWK 1AXTL 4Z77B 1UXSA 1ETB1 3HAEG 3FO1A 5I1KH 1GGYA 2X87A 4NN5B 4QHUB 4W1TA 2EO1A 5E03A 3VQLA 3LNFA 2Y7QB 4R7DA 3ZHKA 1FL6A 1JTPA 3OGOE 3X14A 4DPRA 2XN9A 4X7SH 4MKMA 5JNYB 1FPTH 4M00A 4P46B 1CQKA 3OXRB 3GRWL 4H1LG 5E70A 3WNPA 5E5LA 5E8OB 4QHKI 4C56A 5L7XL 4YXHL 3FFDA 1CYWA 4ZDHB 3TLRA 2ADGB 1NUFA 2WLKA 5T3ZL 3HB3D 3WFCL 2B59A 2V5RA 5I6PA 1HSAB 2IVFC 5SWZA 4BSJA 3BN9D 3FUHA 2CIIB 4JFHE 3FU6A 1E2ZA 1L6PA 2ICWA 2NZIA 3MV8A 3QI9A 1R3HB 4NXSA 2CRMA 3BMVA 4P2RA 1CG9B 1RMFL 3H6JA 2GCYA 4NXKA 3U9PL 5T3XE 1S7SB 1T1ZB 1VFOA 4CJ0A 3O2WH 5FKAA 3Q01A 3BG0A 4LLUA 3FT1A 3JZHA 3KGUA 4J12A 4JM2C 4E36A 4XGZA 1RI8A 1D9KC 7CGTA 5FK9A 2Y6TE 3FB5B 5L4JA 1LEGA 3L1OH 3QG7H 1KPRB 4FQHB 4K23H 5IMKA 1YQVH 2QR0A 4F7CA 1J5IA 4Z18A 5D7IF 4KGJA 3ZPDA 3O2WL 2VERN 4FL4C 3AW5A 3SOTA 2F7RA 2B15A 35C8H 1Q0EA 3DRQA 1S46A 3OMIB 2IGFL 4IS6B 4X9YA 3R0NA 3T0EE 4Z8FL 5J5EA 4GM9A 4WCYL 1OSZB 2VW7A 1N5YL 4HKBA 5M5TA 4R0LC 1YN6A 4KFMA 4HJGA 3QYCA 2FGWH 3NSXA 2FSEA 4KXBA 1JF1A 2GC7A 1B2WL 3CZJA 4OT1H 5F7WC 1OY3B 4Y1AE 1S7VA 1OCRB 2J21A 4FQLL 4QXUH 1RCYA 4PGEB 4H0IA 2ZCLL 3ECBA 4J3OH 3UBGA 5FO8A 4V1DD 5DZLA 5L8JB 4FRWA 3RTQC 3GKWH 2VC2L 4M7LL 2HWZL 2VDLL 5KSUB 5DD1L 2BWIA 1RK0B 1MCPL 3N5AA 1Z9MA 1HCVA 3FKUS 3SDDC 2C3VB 4WO4A 1IBYA 2XN1A 1SMDA 3UZQA 3UTOA 5D72H 2YD9A 1YC7A 4JHUA 3ZIMA 4IRZL 3S7GA 2D9QB 4C55A 2XWEA 4IJTA 4ZOCA 1UXMA 2A6IB 8CGTA 2GIMA 3AU1A 2ZP8A 2FJHA 1C1EL 4EOWL 4WI6A 5FXCH 4W4OC 5DRXB 2D9CA 3P9WB 3STLA 2I9TA 3CFBA 1KXTA 3MOBL 3P3UA 3EJYC 1L9MA 1NC2A 1UWEL 3TYGH 5DRWB 4UNVA 1M7IA 4FYQA 2HUEA 5EEWA 3PJNA 3OR6A 5ABAA 3IDYB 3KH3A 5EU4A 2J55H 4JN1L 3VE0B 2WUBL 2A6KB 1DO6A 4FFWD 43CAB 3KPRE 6FABH 3UZEC 2DY2A 3K6IA 3NIDB 1HYSD 4OUUB 3FQWB 1E9PB 2OTPA 3SDDB 1MWAB 1GKEA 3LZFL 4Z7NB 4QDGA 2IOOA 1MUJB 2UXVA 1NCCH 4Z95H 5E5MA 4J39A 2IH3B 2BNQA 4X6BB 1GIGL 1IEAB 1OCWH 5HYIA 3O2VH 1G5AA 4PW3A 2Q5BA 1MIMH 4AIOA 5GGVY 4KTYA 4JY6A 1OL0A 3LQAC 4OFQA 3S35X 4YJZL 4BH8B 4QGYA 5SWQA 3STZA 4J3WA 2XXMB 4OQ1A 5SX4I 3H7BB 1UXWA 3P3SA 1MCQA 2GHWB 3O2VL 4NI6A 1PJ9A 2XTJC 4P4RA 1QFWH 1REIA 4X6CB 4E5ZA 3SDCD 1OCOB 4XMTA 3IKOA 4JX0A 3AXLA 3P3RA 3NSDA 4XB7A 1YAIA 2HVKB 1IKFL 2N0MA 1ZT1A 2ZWNA 4NO5A 4XWOC 4MMZB 4F5CE 2Y3AA 2APSA 3EHBC 4Q9RL 1DQVA 3OXSA 4RAHA 2E9JA 4OJYA 2A6IA 5I30H 4M7KL 2QKIA 3F83A 3MRMB 3A22A 3LXCA 2OCJA 1M4KA 2QTVA 2QHRL 4MFHA 1N6EA 2R1WA 2AEIT 1QSEA 1J12A 3MLWL 1K5NA 3HPLB 2BIQA 4FFYA 4KFZC 4KQ4L 4FXKB 3QB7C 5F1NB 4HS8L 5GRYA 2XN0A 3RFRA 3EJJX 4O4YL 5BV7L 1VCBC 4N14A 2LAGB 3NIDF 4LKCA 4BUJC 2X4PA 4AVHA 4TSAL 2AK4D 1KY7A 1N6VA 1KGCE 3PRZA 5EZPA 5TQ0L 4BWWA 3KPSE 1E6OH 3UBXA 1JNJA 3ARQA 1SN0A 3VD0A 4W4OA 1GG2B 3KPSA 4J8GA 2P8PA 3F04A 4OLUL 3RILA 3S88L 2F9BT 1FZMA 4KJPD 3BAIA 2DDQL 5HJ3B 1R17A 4HS3A 4ZMXA 3VXMA 2YMXH 5AVSB 5I6LA 5LAXA 1AS6A 3FTXA 4JDVA 4L4TA 2JQMA 1KN4L 4P3DB 4QAMB 4E9RA 1NJ9B 4JFFE 3MMEA 1OSZA 1PPIA 4H8VA 4JMXA 4HFUH 3NH7L 4LGSB 1UWGH 4P9ML 5E2TL 4F57L 1FV1B 2PCFA 1OT2A 2VMFA 3QA3B 4YNYB 4PGBA 1MCWM 3W82A 1VGEL 2CO1A 3U0PB 4A6YB 4HQQH 1ZCRA 3CVCA 2KUTA 3BZ4A 4ZTOL 4DUWA 1QLRB 4N2MA 5D6DA 1ZA3A 3PUCA 2OMWB 4P3CL 3W5MA 2JCCE 1C9LA 3ECBB 5G2NA 4O9DA 2W5PA 4D9SA 3MJ6A 3F8UB 3QZBA 2F58H 4ZQKA 2FCBA 2WXLA 3F58L 3KLLA 1A7QL 3AS0A 1UA6L 2XOTA 5GRJH 2EXWC 4GRWF 1CE6B 1QWNA 5L2JA 3F64A 4WK2A 4FNLH 2DN7A 2PMZA 4N2GA 3O4LB 5I0ZA 1I9RH 2KLTA 1LNUB 5TD4A 2NY4C 4CMMB 3GS4A 5EU6B 3PWNA 4L3CA 1BVKB 4QT5A 1G7PA 1FZKB 1OTSC 2G60L 3FRPG 5JO5B 2FX8H 2VLJD 2IDTA 3LXUX 3RDTD 1A3LL 3NIFE 3Q6FA 4MA7L 2JKJA 4A0BB 2UVEA 4PJGA 4ELKA 2G75A 3VXRB 4WI0B 4PJ8A 1KIUA 5DA4A 5J9PB 2PW2A 1RZIB 3QR0A 4GINA 1J5HA 1JXDA 3IJHB 4KK8D 5GS2D 2ZOUA 5EZLB 3WFZA 2EADA 2O6PA 1DVTA 3EOBB 4D0CB 5AWNH 4NOBA 4KVNL 4O2FA 3ZHDA 4CDHA 4ZMVA 1TEFA 1AS7A 2VM3A 3VFWA 5E2VH 4DVRH 4E54B 1Z5HA 1X9LA 5MHSE 3EUDA 5I1CL 5A3IC 1TCRA 1XSIA 4ANKA 3H0TB 5D1QD 5FFLA 4B60A 1AACA 3X3GH 1E67A 1WFIA 1XZ0B 2UWEF 1XF2B 5DYOA 4WAFA 1JTTA 5D2LE 2CCLA 4LU5L 1M7DA 3DX9A 1R0AL 1VZ2A 4Y2DA 4U3SA 2XQBH 5GJTL 2YXWA 5C0DB 2FIKB 2VDQA 3UGEA 4EBQH 3GSUB 4M6NH 4WI0A 1OKEA 1RUMH 5ANMB 5DQDL 3PUUA 1P7BA 5F9JA 1NBYB 3EG9B 3R7QA 5MI0B 1IFGA 5IOKA 5JIIA 1B0WA 1CGUA 1CDUA 3QUXD 5CJQH 5FM5O 5EB9A 2XQBL 4H88H 2N7BA 1Q0XH 2ZNXA 4PJ7B 5D1ZC 3RKPA 1KCRL 3S3BB 5F9JB 4JM0A 4NQXA 4DPBX 5TF0A 4E54A 3VG0H 5F7AA 3X14B 3U6XS 3LNHA 4E5XB 1A4KA 5EIIA 3GXPA 3PXJA 1R3LB 4HCRL 1JZDC 2G4GA 4Y2DB 5C09A 5LXVA 3PY9A 1N6QH 3SN6B 1MRCL 5CEYB 3KE0A 2DJUA 4WFFD 4BFFA 2EE2A 2ZKWA 4P5TA 5E6ID 2H8PA 3PQYA 2BY0A 4KO6A 5BVJA 1XGPB 2HJLB 3I02B 4FQJL 2OMZB 1KCUH 1O9ZA 1S7UB 3PAYA 1DJIA 1E8NA 4FYRA 5GSRA 3E6HA 3PE7A 4MA8H 1DBBH 3KAAA 3D9AL 3MUHL 5G4NA 3AMKA 3DK0A 3IS0X 4D94A 3EOBA 5CZRA 1XXDC 2J8OA 5HI5C 2H6UA 4J6RL 3OB0H 2BVOA 3BSZH 3PWLB 3QXUA 4QCIA 4B5ZA 1G6VK 3L5WA 1Q9OB 5F6IB 3BZFB 3PWPA 4LLYA 2LE9A 4Y9FA 5EORH 2I26N 1KDJA 4WW2C 4HJSA 2CIKB 1K4DB 2SEBB 4LBEA 3SKMB 2NT0A 2IV9A 4OBSA 3X3GL 1EHLH 1QWUA 3TCLB 3T09A 1ZA6B 1S5HB 2V37A 5I6XC 3OG6B 2J56A 1D2OA 3IUMA 4D2NA 5F1SA 2ZKYA 3KPTA 3C2AH 3MJ9L 4M61B 3CQFA 4HWBH 4Q2ZB 2AS5M 1CO1A 3NZ8A 4JHBA 3C5ZD 5E1AA 3RY5A 5LDSA 3SIKA 4NBYB 3T2NH 1D6EB 2BCKB 4LVHC 1FIGH 3J27A 4L1BA 5CHNA 3TX4A 4W9ZA 1NCUA 4LG9A 4RWHA 3JVFC 1TQBC 1LTXA 1JI2A 4BCYA 5C0JA 3HAEB 3NTCL 4ABWA 5HHMB 4QR7A 8FABA 1AZRA 5KW9H 4XX5A 1DUYA 2Z7ZA 5BVPL 3UEQA 3TA3D 3L13A 4NNPH 5I6MA 3AY4C 3PYCA 1DQIA 1KFAL 1H3PL 1OQXA 3ARDD 4PRNB 4WWKA 2C7UA 2IH1B 2E27L 2NNAB 3B2VH 3O9WD 1JRHI 5CBEA 1DSFL 4H8QA 1G6RA 2ZTBA 3DV6B 3I2CH 4OCNC 1A4JA 4JHNA 4WU7A 3PL6B 4JL1A 4MCZA 4WHTA 3NYKA 1S2EA 5B22A 3TC9A 2Z1KA 3OAZH 2GJ6E 3N44B 3T2QA 5AAWA 4H5JA 2R56L 4RQQB 1WBYA 3N1FC 1RUQL 5D7IA 3L3OC 3G5VA 5T1KD 1MJJB 3F6LA 4OVUA 4WWKD 5FUZH 3U46B 4AQ8C 1GW6A 2VDNL 3VGGA 1CL7H 4TSCL 2ZAHA 2GSIA 1SUHA 4AG4L 2VDMA 1EIBA 1W15A 4GUPB 3D0AA 2VWEE 4GKZB 1RQ5A 1N64H 2X4TB 4X6DB 3TEUA 5C0EB 5D6CA 4GAGH 3T4AB 4UIKH 3SPJA 4BWUA 4GQ1A 1CMOA 3LRGA 4X5QA 5IWLC 2BDNH 1CC3A 3KXFB 3OZ9H 4XNYH 3HE7C 4ODXA 4YVNA 1DJXA 1ZDQA 1RH8A 2JB5L 3KDPB 4UQEA 4XVOA 4CN4A 1QZNA 5D7IB 5A3ID 1B4TA 1HL9A 4WRLA 1TR7A 3V6ZA 3ZE0E 4DP1X 1AI1L 3ESOA 5TEFA 3RSEC 2K3TA 2XKUA 3ARDA 3S3CB 1UOOA 1KGXA 4TUUA 2BW4A 2R23A 2YD4A 3SCMD 4AQ1B 5DO8A 4B9IA 4AL8H