1FWXA

Crystal structure of nitrous oxide reductase from p. denitrificans
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
591
structure length
591
Chain Sequence
ADGSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESVRIHERTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMKCDAILEIPNAKGIHGLRPQKWPRSNYVFCNGEDETPLVNDGTNMEDVANYVNVFTAVDADKWEVAWQVLVSGNLDNCDADYEGKWAFSTSYNSEKGMTLPEMTAAEMDHIVVFNIAEIEKAIAAGDYQELNGVKVVDGRKEASSLFTRYIPIANNPHGCNMAPDKKHLCVAGKLSPTVTVLDVTRFDAVFYENADPRSAVVAEPELGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIEDAIRAYAGEKVDPIKDKLDVHYQPGHLKTVMGETLDATNDWLVCLSKFSKDRFLNVGPLKPENDQLIDISGDKMVLVHDGPTFAEPHDAIAVHPSILSDIKSVWDRNDPMWAETRAQAEADGVDIDNWTEEVIRDGNKVRVYMSSVAPSFSIESFTVKEGDEVTVIVTNLDEIDDLTHGFTMGNYGVAMEIGPQMTSSVTFVAANPGVYWYYCQWFCHALHMEMRGRMLVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NITROUS OXIDE REDUCTASE
publication title Revisiting the Catalytic CuZ Cluster of Nitrous Oxide (N2O) Reductase. Evidence of a Bridging Inorganic Sulfur
pubmed doi rcsb
total genus 185
structure length 591
sequence length 591
chains with identical sequence B, C, D
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2000-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13473 Cupredoxin_1 Cupredoxin-like domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1fwxA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1fwxA01
5AJAA 3EH4B 3FSVA 3T71A 3BG0A 1A4BA 4RH4A 2H9NA 2J55H 3EI4A 4XEIC 3EU7A 3NSCA 4JSPC 5IJ7E 3IJCA 1J5CA 1JXFA 5K1CC 2ZXWB 1XB8A 3NVXA 3OL2A 4GGDA 4J78A 2PPAA 4JXMA 3FQ1A 2QT6A 5I6PA 1OF0A 1U2VC 3V9FA 2GC4C 2PCYA 2P9UC 1BQ5A 1V10A 2FQEA 4J79A 2H9MA 3UVKA 3D12B 2TRCB 1I53A 2UX6A 1OV8A 2PPEA 2YAFA 4G71B 6PCYA 1U4CA 4NAJA 2CN2A 3I2NA 1P22A 3K27A 5D4IA 3NVQA 5IGQA 5K19A 3EI3B 3DTUB 3A0FA 1KCWA 2G9AA 1NIEA 1GW0A 1IBZA 2XVBA 3FU7B 3WKPA 3X1EA 4F2FA 3JPXA 4X61B 3SN6B 5CYKA 3OMIB 1XKSA 4A0AB 1CC3A 3TBBA 1BYPA 1ETJA 1OCCB 2VSKB 1AS6A 1A4CA 4PXWA 4E9VA 1ASOA 4K3ID 1AZRA 2AZUA 2QPEB 3AFCA 1ET7A 2JXMA 4A67A 4W1TA 1AOZA 2PM9A 3QJUB 1AR1B 1GS8A 5I6NA 2H6KA 1MDAA 2VM4A 1ID2A 1JXDA 4GP5B 2H13A 4GZ8A 1ET5A 4IMMA 1SF3A 2MRYA 1J9SA 2YAQA 2ZWNA 1NIAA 3P4FA 2YAHA 1JZFA 4A2LA 5ANHA 1E65A 4DP4X 2DYSB 1CYXA 1SFDA 2PCFA 4HHWA 4AEZA 3BG1A 1DZ0A 4GGCA 3EI4B 2Y1AA 5EMLB 5D4JA 1JERA 1IBYA 1EHKB 3V9CA 3DXMC 3MKSB 3FPXA 2FQGA 1HAWA 4DP7X 5HQGA 1GY1A 4JHUA 4CY5A 3OL2B 3N2JA 2IDUA 1A65A 2TSBA 1AG0A 2N0MA 5B1KA 4DP9X 4A2MA 2P9NC 4HDJA 1NEXB 4A2GA 4A0BB 2HXCA 4HCIA 1BQKA 3I7PA 3KRXB 4JSVC 4FA1D 3PXLA 4HIPA 1SDDA 5I5MA 5EMKB 5AFAA 3GXUB 2AH0A 2PP8A 1BXVA 1ERJA 1R5MA 3JRPA 3ZBMA 4HAKA 2DYRB 2XV3A 4YSCA 1B3IA 3DIVA 3TASA 4AKQA 4Y5RD 2HRGA 3FSAA 4DP6X 2YNNA 1FWXA 3GREA 3AG1B 2IH9A 3N0DA 2Q9OA 1XIPA 1SHWA 4YSEA 4ES0A 4PAZA 2AGLA 1JZEA 3AZUA 2I0RA 1JZGA 3SMRA 5EMJB 4PC0A 1JJUB 4G7SB 1K8KC 3FS9A 3NJIA 5AMSA 3EH5B 1URIA 3OM3B 3UACA 3WG7B 5TEEA 5B7FA 1W6LA 4WTQA 4O45A 3H4FA 4G7RB 2HJBA 3RRMC 5D4HA 3UGEA 4FB1D 2EINB 1V54B 3SLED 2UX7A 3L4OD 1PEVA 5AFU3 5H14A 5B1JC 3SBRA 2DV6A 3T6VA 2J5WA 4D6VA 2PPCA 4MFHA 3ABKB 1HAUA 4XYHA 1WS7A 2VW6A 3ABGA 1W8EA 5F7BA 3IKOA 1PLAA 1WA2X 5I26A 1OCZB 1NTDA 2B3IA 2CAKA 1NIDA 2PP7A 3QJTB 4J8GA 4A08B 1AS8A 1MG2A 2P9SC 3NJLA 4KO9A 3QQXA 5EMMB 2CO0A 5CXCB 2IURA 3NJNA 2HZHA 2G99A 1PAZA 1CYWA 5FKRA 3WNJA 3I7HA 1JOFA 1M57B 4HCGA 4KNTA 4Y7RA 1ZV2A 2NRDA 4EF3A 2OVRB 3MMYA 3GYRA 4UI9R 3FQYA 3HFQA 5GMKn 4L1QD 2WSDA 2XU9A 1KBVA 4WKXA 5I6LA 5AZUA 3CVDA 3SFZA 2IAAA 4CI3A 3FYIB 1NWOA 1NPJA 4KFMB 1IUZA 1VYHC 2EILB 4H5IA 2XL3A 4PBZA 5THAA 4ZOZA 2PPDA 2XV0A 1SQJA 2O9KA 2J55A 4DP5X 3QJSB 2IUVA 1TEGA 2B5NA 3AG3B 5EALA 3IE9A 3FU9A 3FGBA 1YFQA 3S8FB 2GI0A 4KO5A 3GDCA 2DWTA 2IAAC 2QDVA 1AQ8A 3VA6A 4P5SA 1JZJA 3CVCA 5I5JA 1EZLA 2B08A 3L4MD 3SCYA 3BWSA 1SFHA 4UF7C 1L9TA 3UKUC 4GYBA 3AL8B 3JTBA 3C75H 4YSOA 2J57G 1PLBA 2GHZA 2GC4A 1KCBA 4UANA 2I0SA 2P9IC 1NICA 3ODTA 4LG8A 3PE7A 1NINA 5HE2B 2PM7B 4G72B 1PMYA 1OMWB 4E9XA 5B4WA 2BO0A 3CZUB 4CSPA 1WAEA 1GG2B 2R7EA 2UXFA 4FWWA 3RFGA 4M3HA 5B1AB 2XX0A 5GXHA 3OKTA 4H5JA 2YBAA 4F2EA 2BWIA 3JT2A 4BDVB 3SWSD 4A0BA 2QXVA 1CUOA 3NP3A 4K9JA 4A2DA 2CCWA 1ADWA 4G56B 4JT6C 1MZZA 3J80g 2VSMB 2H9PA 4F7KA 3PSLA 2IWEA 2AZAA 3ASNB 2LLNA 1GYCA 2XXGA 2VW4A 4KOCA 2FT8A 2IWKA 3GFCA 5EAMA 2XYIA 3C99A 2UZYB 3OD3A 1M9WA 4NERA 4AKOA 3OKYA 1BAWA 2PPFA 2PLTA 2Y69B 5TEFA 3G5WA 9PCYA 4K3JB 5SXMA 4GM9A 4W9ZA 2Q5BA 5IJ8E 3MKQA 4CI1A 3UR4A 2AANA 3F3PA 3NJMA 3MXXA 2I0TA 4KO7A 2HYEA 2X87A 4ERZA 4YSSA 2UZXB 5F7AA 1XHMA 1WA0X 2EBSA 3NT0A 3ZIYA 4CZXA 1JZHA 2AGXA 3T6XA 1AZBA 5FLXg 3AG2B 3FQ2A 3KW8A 4XYIA 4AI7A 3JAMg 2XWZA 2CN3A 2CUAA 4FAAB 4GM8A 4J86A 3ULEC 3CVBA 3KRWB 2H9LA 4L3GD 3J81g 1RZQA 3ABMB 4KO6A 3ZX1A 2HESX 3JZHA 3UVLA 2FTAA 2CBPA 3NVNA 2UXTA 1TKWA 1OE2A 1KDJA 1W6WA 5AKRA 2IDQA 2A3TA 3PVWB 4OWRA 1NPNA 2FWLB 1BXAA 4CZVA 5HYNB 4NB7A 1X9UA 1ILUA 1E67A 2VW7A 2R7EB 2BCJB 3C9CA 5FC9A 3CG8A 3QJRB 4BWWA 5I28A 2XXFA 2I85A 4HALA 5HE1B 3PVUB 4CC9A 4A08A 4ZN4A 4D0KA 4YSAA 4J0WA 3I7NA 4QKTA 2WO3B 3JROA 5CXCA 4FA4D 5B3SB 4AX3A 1A8ZA 5EAPA 4E9RA 1NR0A 4J84A 1ZIBA 3MBWB 3FU8A 2BWDA 3K26A 1NZRA 1R1CA 4MK0B 2B5MA 4LGNA 3OKYB 4A09A 2B5LA 4DP1X 4GXFA 4A66A 1J9QA 2EIMB 2IWFA 3EI2B 4Q89A 4EWRA 4J8BA 3S3BB 4PSWB 5C2WB 3TU6A 1E5YA 4JHVA 1PZBA 1B9XA 2OJYA 3AH8B 5B1JA 2J56H 1JOIA 4PSXB 2FQFA 3EHBB 3FSWA 2QC5A 5GXIA 4AKPA 1QHQA 5IY5B 1WS8A 1N6EA 3EWEA 5FKQA 2BHFA 2MTAH 4FHLA 2UXVA 3AL8A 4J82A 1N70A 2HXAA 2XV2A 4HZ1A 4AZUA 3N0EA 7PCYA 3PAUA 4JSXC 3PSCB 4BXVA 4GGAA 1L9SA 1ZDQA 1MG3A 2IDSA 2YMUA 2XUWA 2CALA 3OMAB 4NSXA 2VMJA 2YQBA 1CURA 4ZK8A 4YSUA 1L9PA 3NSYA 3NJHA 2AGWA 2BP0A 3PXTD 2AGZA 3TA4D 3QJQB 5HE3B 3JZNA 2ZOOA 4CY3A 2AVFA 1MG3C 2XX1A 4BDVA 3MZKA 4FA5D 2AFNA 1HFUA 2YXVA 2YXWA 4G7QB 1L9QA 3S8GB 3CFVA 3CFSB 3QJVB 4Z8LA 2P9PC 1KV7A 2Z2PA 3SJLD 4A68A 3OW8A 1FFTB 1AZCA 5I5IA 3IN0A 1NWPA 1OLZA 5IC7A 3IN2A 1M56B 3T6ZA 2BZCA 2Z2NA 2BP8B 3FRXA 3ABLB 2AGYA 1BEXA 1GS7A 4DP2X 2W18A 4O1QD 1ASPA 3V5WB 2FJSA 4BUJC 2B4EA 1GSKA 3RLMD 4IA9A 4A09B 3UADA 3SVWD 3C75A 3SQRA 4BK5C 3SHFA 4TXVB 1XB6A 4GQBB 4ZOXA 4HCFA 3I89A 2HKRA 3ORVD 2AH1A 4E9YA 4TZ4A 3HEIB 3SBPA 5E9NA 4E54B 5CXBB 4ESGA 4E9QA 1OE3A 3X1NA 1K32A 3EH3B 1KYAA 4DPCX 4A11B 3UVOA 2H47C 3WI9A 4CI2A 1N6DA 1XB3A 4FAVD 1SF5A 3PCYA 3NP4A 5LDUA 3V7DB 3T6WA 3KW7A 1UATA 4G70B 5I6OA 2H3XA 4L3HD 5FKSA 2BW4A 3EI1B 1N68A 2IDFA 3RSEC 2YAEA 2XU7A 1PI6A 2XYBA 4YSPA 3PPSA 3UAEA 1AACA 3BVDB 1F56A 2BZ7A 1Q47A 1QNIA 2I3TA 1BXUA 4ZOVA 4U7AA 2H3XC 2BP0B 1JVOA 2J57A 3T9WA 5A7EA 2PBIB 4O3UB 4PCYA 2JKWA 2OIZA 3NSDA 4CI8A 4E5ZB 3S3CB 3X1BA 1KBWA 1V55B 4GY4A 3FSZA 1JMZB 1PZAA 1PBYB 1PLCA 7PAZA 2HJ4A 1NIBA 1AZNA 2OCCB 3AL9A 2OV0A 4DPBX 1AS7A 5B1BB 3H56A 1OCRB 2CJ3A 2P9KC 4KOBA 2BW5A 3AW5A 2YAMA 4L0PB 5TF2A 3PAZA 3MZLA 4J0XA 2GSMB 3NJJA 2OJ1A 1KGYE 1SNRA 2I3SA 1MZYA 1L9RA 4M4RB 3I8EA 3EI2A 3PXSD 3FPYA 3DM0A 1PCSA 4YSRA 2DWSA 2TSAA 1NDTA 4J73A 3MX0B 2HLEB 5I6KA 2P9LC 4AOWA 3VGZA 1SHXA 3N55A 5B7MA 2EIKB 3UKRC 4P5RA 3V9EA 2IUQA 4X3EA 5KDOB 2RACA 4N4YB 3S3DB 2YNOA 3DSMA 4A7JA 4BXSV 1BQRA 4GM3A 4YSQA 2OVPB 2BBKH 4GP4B 3DWLC 2PP9A 5EM2A 1GP2B 5HE0B 2P80D 1PNCA 2OK4A 1TYQC 4O9DA 2VM3A 2YAPA 3NSFA 1QLEB 1OE1A 3NJGA 3ERXA 4KNUA 2YB8B 4QQEA 2IUPA 1TBGA 5H17A 4GP8B 1KDIA 3NYKA 2AQ5A 3EF4A 1ZPUA 4Q8BA 4ERQA 4ERYA 3IBOA 5PAZA 3ASOB 1BYOA 4FA7B 1NIFA 4GMBA 4R7AB 5IGOA 2OVQB 1TU2A 3NJFA 2YNPA 2UXGA 1L9OA 3UAAA 4A2HA 1AANA 4YVUA 8PAZA 2HKMA 3WIAA 4CY1A 4YSDA 4O3TB 5EARA 4FAND 2QPDB 3CDZB 1PZCA 4N8UA 5PCYA 3WKQA 5I6MA 2IDTA 3ZDWA 4QRJA 1VLXA 4QT8A 5TK4A 2GNQA 3X2QB 2H14A 2BP8A 3UABA 2J56A 3L45A 1MDAH 3I7OA 3OMNB 4FA9D 1B9YA 1TEFA 4YVDA 5FA5B 2GBAA 3SXTD 2MTAA 5FXYA 2W8CA 4X60B 5IT9g 3H4HA 3BQVA 3E0CA 3C5MA 1ET8A 1A3ZA 4J81A 3IEAA 4BWTA 1RCYA 1AAJA 5A2Qg 6PAZA 2HX7A 2GC7A 1ZDSA 4E54A 5CXBA 1FA4A 5FKTA 4BH6A 3OTTA 1JZIA 4A11A 3QPKA 3F3FA 1GY2A 4E9SA 4CZYA 1J9TA 2JFCA 4X4KA 4X63B 3UVNA 4BL0A 5C9ZB 2Z2OA 3SBQA 4JD2C 3OKWA 2YAOA 1J5DA 1N6FA 1RI6A 5C2VB 5EM2B 4L9OA 2XLLA 4DP0X 3EI1A 2GC7C 4LG9A 2FQDA 1IKOP 4QL1A 3F3GA 5CYKB 3CIKB 3AY2A 2CNXA 3AG4B 1OOWA 2FT7A 3EG6A 3UVMA 4KNSA 2FT6A 1E5ZA 5TK2A 1AG6A 2PM9B 1YLBB 1A4AA 4DPAX 2CE8A 2PM6B 1GR7A 1XMEB 1J9RA 3EMHA 1GS6X 4PBYA 3IJ0A 4ZOYA 1ASQA 1PF3A 3NJKA 1AIZA 1JXGA 3B7FA 4E5ZA 1JMXB 1S4UX 2H6QA 4PNKB 1ILSA 1L0QA 5GSAA 2VN3A 1RKRA 2OK6A 3VH0A 3X1FA 1WA1X 4JSNC 4GQ2P 4YVNA 2DY2A 4HHGA 3DKHA 4GQ1A 3DXKC 4E9TA 4J77A 4J87A 3RFHA 4E9WA 4CY2A 4JKNA 3IIYA 2E86A 3FYEB 2H47A 2CE9A 3I7KA 2GIMA 2XL2A 4U1EI 1SQ9A 3RMZD 2HX8A 2QDWA 1ZIAA 3IJ1A 3RN0D 1JVLA 3W15A 1PY0A 3OQRA 4JT5C 2W88A 2I7OA 2H68A 3FM0A 5B7EA 1IC0A 3PLYA 5H1MA 4DP8X 5EHFA 3FT0A 1RZPA 1SDDB 3JZGA 1AZUA 2YARA 2X88A 4YL4A 3EI3A 4UAHA 2H5UA 1SJMA 1PGUA 3FU7A 4YSTA 5FQDA 3ZWLB 2EIJB 1MG2C 1GOTB 4A0AA 2GB2A 2HX9A 2CO0C 5TDHB 3I8CA 4A2EA 3U4YA 3HB3B 3PXWD 3RN1D 1E30A 2WO2B 4QLWA 2I7SA 1A0RB 4CSZA 1GXRA 2HRHA 3TBCA 3I7LA 3JB9L 1OCOB 3PAVA 5JWZA 4A2FA 2H6NA 4BWUA 4N14A 3U25A 4OZUA 1T5KA 2ZONA 3CDZA 2Q7QA 1DYZA 4I79A 3RYMA 2IH8A 1SHYB 2P80A 1PNDA 3IIWA 1X9RA 3X1GA 4ENZA 3WNIA 2FNWA
chains in the Genus database with same CATH superfamily
3VXTB 2YMTA 4BSWA 3KYKL 5C08D 3KLQA 4NQDA 2J55H 3MRKA 4G59C 5DHEA 3EOTL 2MMXA 3IU4H 5GGVL 2OJEB 1BWMA 2GSIB 2X44D 1M05A 2F74B 2P45B 2PPAA 3QJHB 4MCZA 1FPTH 2GYSA 3ALWA 2AK4B 3BN9C 3DURB 4PJ9C 1K8IA 3LY6A 5AL8A 4XO5A 4A7GF 4JY5H 1OIOA 5C6TL 3D12B 2WHVA 3IWUA 2PPEA 3PWJA 3QULA 1XGTA 3QIUC 4RESB 3G5VB 5IGQA 4OFVA 1MWAH 4DGWC 1BZ7B 4ZUSA 2EO7A 4MA1B 4X6DE 2OTPA 4LEBA 3SN6B 5IB3A 2VQ1A 3R06A 4EN3C 4N9GB 5BQ7A 4LSVL 5D7KE 2QVTA 1IAOB 4A0AB 1OCCB 3Q8CA 1YA5A 3F85A 1BLNA 4L8BB 1J12A 4MMZC 2DYPB 1MCIA 4RAHA 3RAJL 1AY1L 2BOBA 3PL6D 5C9JA 4GIAA 2MCPH 4W1TA 5IZ7A 1IGCH 2WVVB 4RISL 2PM9A 3QNYA 1XR8A 4G8GB 4PP1C 3HFML 3RQ3A 1CXHA 1N0LA 4YQXH 4HU8A 2WYIA 3SDAD 2XWJA 4XN2A 2L7JA 4ZFOL 3PDDA 4HHWA 4S1SL 4FLRA 3D39D 4O4YL 5KJRH 3NQKA 3M1BA 3SDDA 1VADB 1XO8A 4H8WL 4H26A 2PMZA 2EH7L 3PL6B 1HAWA 3T4AB 4W9LC 4AJ0A 1T7XA 5K9OB 2JF1A 5B1KA 4L1DA 4XP6H 4HDJA 4ZFZA 1XGZA 1RQ5A 1EAJA 2HXCA 5K33A 1S9YA 3A4FA 3H2QA 1Z5LA 1LD9A 3TL5A 4K5NA 5F1OB 3D39B 1DEDA 1BXVA 2PCPA 3KJ4C 3JRPA 1CQKA 4ZTOH 4WEBH 4Z9KB 3LRGA 3GLEA 2BS9A 2AKRB 3L3DB 2Y7QA 3PQYB 5KVDE 3TF4A 4LESA 4DKEL 3HC3H 5C0BB 5JW4N 1PJ9A 2VLJE 4NC1C 4ISVB 3WJLA 4ONHA 5CSBA 3SE4A 4OCNC 2DM2A 1QFSA 1A6AB 5J11C 1MRDL 1SRDA 4M5TA 4YO0B 3CVIL 4WNJA 4Z7UE 3IJYB 4M5SA 5IQ7L 4A7QA 4AM0Q 4AMXA 1IFGA 3HMXH 2PTTA 3HR5B 1QFUH 5I8CA 3ILEA 3L08A 5CFHA 1KB5A 3FT2A 1B6UA 1UH2A 3LPGA 3BH8B 5DJAB 4I4WB 4NGHH 3VXQA 3V52H 1R34A 5HHXH 3WXWH 3PFUA 4MA8H 3VXNA 3QQXA 4P5TC 2IURA 4E42A 2ZP0T 1EZUA 3UEQA 5AW5B 3SKMA 3CQFA 3RL2B 3U30B 1WC7A 2MPAH 3CCHB 3MR9A 4JQXC 4NC1E 3F6JA 5E23A 4J5VA 2ROXA 3UBHA 1J88A 3KYNA 2EDOA 4JM2A 4ZUWA 3NRQA 4MA3A 4U1GC 4HSCX 3C2AL 1XIWB 3OJVC 3VSTA 3LQZA 3AG3B 5KOMC 5E5LA 3VA2C 1D5IH 2YPVL 3FUIA 3UMNA 3SOBL 3UKUC 2W07B 1L9TA 4UTAA 1NDGA 1AO7E 5IMLB 3QHFL 2B9AA 3MRMA 4HGKC 6FABH 2I0SA 4XCCH 1L5GB 1LEIA 4XX1E 4W9GC 1L6XA 4RMTA 3LNIA 3I6LD 3NFSH 4PSRA 4ERSL 5H35B 2MFNA 2B39A 5LBSH 5HVWA 2N01B 2Z91A 1FVEA 4M3HA 3SQBA 3X3GL 4U2YA 3S88L 4TQHA 2BWIA 2AJXL 2GSGB 1PL3A 5H2BB 4J3XA 4C59B 1GGIL 4I3RH 4WUUB 5DJXB 2PF6A 5DD5H 1MFAL 5CINH 1WZLA 2IWKA 4DN3L 5E6SB 5J5EA 4NCC1 1TYJA 2OXGB 3ESNA 3F8UB 1CGYA 4Y7MA 4WW2A 5CHNA 4GAYA 4XB7A 3F58H 1JJUA 5MEOA 2P8LB 3CC5B 4JG1H 5JHDD 4KO7A 1P6FA 5AVUB 1MVUB 4GAGH 5B38B 5EU3B 2AGXA 2J4WL 4XC3L 3FQ2A 2FLBT 3T0BA 5HGDB 3IAQA 1AXTH 1ZVSA 2NSQA 2B4CH 4WJKB 2J3SA 1RZQA 3JZHA 2F61A 2FTAA 2E7BA 1P7KB 1RPUA 1UYWL 3QUYC 2QBWA 2R0ZH 3DMMB 4JGNA 4NO0A 4CGTA 2F68X 4P5MB 4W6WB 2BIPA 4X0KB 3VG9C 1A14L 2A1WL 1M71A 2XXFA 2GG1A 4N0UA 4S11A 5DHVB 3MJ9H 4CC9A 2ZYSA 4J0WA 4D0KA 3Q6GH 1Z3RA 3QDJD 4KKQA 4APQA 2VERA 4FZEL 3T8MA 3K8KA 5HDQH 3NIDA 3FU5A 5EUOE 4C8XA 4J3UA 5FAAA 4JVPA 3OB0H 4PJXA 4MGXA 2X4OA 4R0LC 3U48A 1TO5A 2FUQA 4IEFB 2ATKA 1AHWB 4L9DA 2H41A 3LKOA 4XNUL 3Q2VA 5DVNA 5F97E 1S7XB 3QEGH 4AC4A 2PO6A 4ZYKA 3EI2B 3QAZC 4EWRA 1XR9B 2VN4A 4GO8A 4PTTA 3GSVB 1QASA 3E9UA 3OKLA 4RLDA 1FNSH 5J3HC 1E4WH 2J56H 1JOIA 2QSTA 3UROR 4BCBA 2W0PA 4Z7QB 5FGBC 1OPOA 1HL5A 3Q2LA 3QPXH 4HPYH 2X1OA 1V3KA 2WQ8A 3MLRH 3VMPA 3LKNB 4LPXA 3L9RB 2VWEC 2YD2A 4BXVA 3ULUC 4JO3L 4GGAA 5E2JA 2CR6A 4R5VA 4CNIA 4LSTL 4U49A 3QXVA 4C4BA 1DQQB 4X9IA 2AGZA 3A6CH 1OK8A 2WXNA 4OV6F 4DERA 3BKMH 1WEJH 3B37A 4A7GA 3RPBA 1OTSD 3LV3A 4O02A 4Z23A 3ECBA 1EJ6A 1JHLL 5DDHB 4XWGH 1TQBC 4WTZG 3EADA 4HIJB 4XRCA 1J0HA 2HTKC 3GIVB 2BVUA 1CE6B 3O6FB 4NRXA 5CLTA 3T3MA 5I66A 4GO6B 3SVWD 4IBYA 25C8H 4FNPA 1T5WA 5IJVB 3C75A 1JF1B 3PV7A 1UUSA 3V0VB 4Y16A 1FC1A 4IU3B 2ZUYA 3DUUB 4ESGA 4HWEH 3K5RA 1G7HB 2VWEE 4PV8B 5FUOL 1FVDA 1IQWL 4L8SA 2HLFC 3V4PA 3T6WA 1I2MB 3O6ML 3P9MA 4LDLB 5I6OA 1S9XB 2WQAA 2XU7A 4G3YH 2UUDH 3S6CA 3IDMA 5JOPD 1TOXA 2QSVA 3IMTA 3QJOA 2WB1A 3A6BL 1I7ZB 3EGDA 3GBMH 4MNQA 4QHKI 3PWUA 4HH8A 2EIEA 3FFDA 1QKZL 4IK6A 5HGGS 5K39A 3ZE1F 5CFAA 4FQCL 4Z7WE 1KBWA 5JLZA 1Y1DA 3MRJB 2CWRA 1RP9A 1VPOH 1R75A 5IHUL 4I2XE 1U93B 4Y88A 2VUOA 2WTRB 1S7VA 3I84A 4PI0A 4PLOB 4GO9A 5E4AA 1NMAL 2MPVA 3QBTB 4GS7B 3VXMB 3WFCL 2OPCA 4J39A 4HCRL 2OXHB 2A9DA 3CAFA 2QHRH 1U4EA 2JLPA 3DX6A 4AOWA 5AVWB 4XMLH 1DQML 1RJYA 3VGZA 2F9BT 5F6IB 4P5RA 5KDOB 2F19L 2RACA 2H2PC 2CBOA 2OTWB 5IFJA 2JJUA 1WCBA 2BNQB 2OVPB 1AKJD 4RMWA 2DWDA 2XETA 4KDVA 3QGVA 4KX7A 5INCA 1RUPL 4Q6IA 5FO2A 3APFA 3BEVA 4NAAA 2XPZA 4XN7A 1OSPL 1QBLH 3F5WA 3KVDD 1COBA 1OGAE 3QDGD 5FYJH 4EO5A 3WO4C 5I5RA 1MCRA 4U1JB 3NCWA 1T6VN 2XWBB 4FAND 4MDIA 3QO1B 2YC1A 1H15B 4FOMA 1HNFA 4XPTL 1PZCA 4JJ5B 2HP4A 2YXFA 3IDGA 1QVOB 4N8UA 5DS8B 4ZD3L 5IR1B 2NX5B 3QEQA 3WTWA 1N59B 1PX3A 3HG4A 4F8TA 1G7IB 1KNOA 2J6EL 3SKUD 3S37L 4YWGL 3VI3F 1KIUB 3OMNB 4LRNL 2HUHA 4IGBB 1NSNH 4XE5B 1QSEE 2C3GA 3BZEA 4GG6F 3FT4B 4XH2B 2V6HA 3QDGB 4DUWA 2XN9A 4J81A 1RCYA 4BUHA 3D51A 4ODHH 2WNGA 5IMKB 2DQ6A 4FI6A 4JFEB 3O9WD 3QPKA 4E9SA 1J9TA 1I31A 4F9PA 3HBQA 3B3BA 2ZCLL 4LLVB 4NHUB 4PJEB 1EUUA 1DFXA 5TGBA 2JKTM 2XFXA 1QFPA 4NRZB 3KPMB 3QG7H 4WUKH 4FQQB 5ICXA 3PQYE 1OB1B 4DKDC 1NCDH 3UVMA 3CXFA 2VQTA 3W38A 3TCLB 5D2NA 4TTGA 1XMEB 3O9WB 2ZCKH 3BWZA 3VFGL 4OAWB 4OGAD 3GXPA 2Z31C 5EOCH 3Q44A 4JRYE 1F58H 1E27B 4XN8A 4JKKA 4PJ5E 3S37X 1UCTA 2DY2A 4WEMB 2BNRA 4LAQH 4YDZA 4F8NA 1BJ1J 5D6CB 3DXKC 4GQ1A 4OY9A 4K7FB 3TFKC 4KNQA 3WFBL 4GSDH 1ZTMA 1PX4A 2H47A 1VFBB 3ARDC 3PDGA 4QJ3B 1UXMA 4GQRA 4WEUD 4KKRA 2QDWA 2AXHA 1AC6A 1G1YA 2VXVL 1R5VA 1XDTT 1M3IA 5D1QB 5K93A 2QHLA 1D9KD 4FFZA 1W91A 1RIUH 5CEYA 1R19A 4YBLB 1PEZA 4N2NA 4MJIB 4LLUB 5E6IB 3RNKB 1WG3A 3QUZD 4M62H 2EIJB 3PGCB 2YGNA 2G30A 4XPAL 3U4YA 1NFAA 4BA0A 4PRHB 2IH1A 2O5YL 4U1NA 2ARWA 3B3IB 2R4RL 3WEXB 1KC5H 4DK5A 3LHAA 3SKOA 1QO3B 1UD8A 2I26N 1M7IA 3F12A 4Z0BH 5T1MB 2IH8A 1QPPA 5FA3B 3DGGB 4GI6A 3GMNB 3FCBA 1E4KC 1N26A 4HG4K 4RH4A 3TZVA 1D7CA 4JE0A 3VSVA 4W9JC 5BRZA 3FB7B 3F65A 4AXWA 3EGSA 4M93B 4KJYA 4ZW8A 5I1AB 2MQGA 2CD0A 2FQEA 3QCTH 2AXFA 1NFIA 2FEJA 2VR3A 3CNKA 3D85A 3O4LA 3QRGH 4JFHE 1EAQA 2FECI 5TE4H 2ADIB 3MBEC 3I2NA 3D0LB 2GJ6E 3TPKA 3ILPA 2P24B 5F44A 3EI3B 4WUUE 1RVFH 3SE8H 3ZHFA 3STZB 1H5BB 1CGXA 4UOW0 1SJVA 3MREB 1JRHI 4JCLA 4QJ4B 1T1YA 1AS6A 2DQCH 4DZ8A 4FNLH 2D3LA 3NFPA 1FZJB 2VRAA 3LIUA 2EC9T 3CK0H 1GS8A 2V4LA 2F7QA 3UZQB 1XH0A 5FKAA 3PP3H 3GSOA 1NCHA 1OQXA 2DPKA 4ENEC 3MFFA 1C12A 4IDJH 3G5XA 1EGJH 4LLQA 2K6YA 4RRPA 5LCVA 1W0WB 3RBGA 4XE0A 3SPHA 4FQ2H 2YZ1A 4U6XA 4M48L 4MWFA 5KVGE 3T0WA 4HUVB 2EP6A 1IJNA 2EEAA 3NEEA 3QUXB 3W0WE 5JR1H 1Q1JH 3O4JA 1IC5H 4A6YH 4KRPD 1Q9LA 3UX9B 1LLAA 3VRLE 2HFGL 2QQKL 3ULVC 4XNXL 2N7SA 1A65A 2ZXCA 3EO1A 3KPRE 3AM8A 1FORL 2C9VA 3P2TA 3S2AA 4F37K 5IHHA 3EOBB 1BQKA 2Z8WC 4KUZH 2O1AA 3KRXB 4FA1D 4JN2B 4I7ZC 1NA8A 1QG3A 1IAKB 5J7CC 1QLRB 1WPCA 1YDPB 5GS2H 2EE6A 1NCCL 3ECQA 5I15H 4ALAC 4L4TE 5L2JB 5DK0A 1FCCA 4AMZA 4QRTB 1OHQA 1J1XL 1JZEA 2XT1B 5SWQA 1WAAE 2JVUA 3Q2WA 3RGVB 5EMJB 2F54A 3V7MA 5CILL 4AYFB 1M7DA 3KPQA 5HY9B 3ET9F 2OZ4H 4HLZG 1CK0H 3EYVA 1BXXA 1W80A 3OB0K 5HHOA 4WU5A 3ZE1A 4MQ7A 4FYSA 1V3LA 4Z7QE 1KCSL 1MVFA 2BIOA 2VLKD 1QPXA 3ULVE 4ABWA 3PPEA 4EIZC 2PN5A 3II1A 3WJMA 1K8DA 3ULUH 3DX8A 4MFHA 1ICTA 1QR1B 3BO8B 1INDL 1M7XA 2GFBB 4ANXA 1CI5A 3F7YA 2KDYA 4C56B 1MEXL 3AREC 1U8QB 3ZL4L 3NIFA 4W4OA 1YQ2A 2C3HA 3RU8H 2CRIA 3GUTB 3QJTB 2CPCA 1AQDA 4ZSOE 5FO9A 4DAGL 4A08B 3NJLA 3GC3A 4OD2A 1R6VA 2YEVB 1DEEB 1RJZB 3QQ9C 5DHYB 4HQQL 4JPVH 5I6XB 2ZYRA 1UJTA 2ICCA 2B9BA 3I3EA 4NOFA 2A74B 2WOYA 4MCYA 3OZ9L 5C0ND 3VFMA 2ZPKH 5C2BH 1HILB 1MHEA 2P5ED 3D6GA 3L81A 4OLWL 5GS1B 4Z1PA 4AT6A 4OSUL 2AVGA 3Q6FB 1VYHC 1XCQA 5FS5A 4K8RD 2XL3A 1AYOA 1AQHA 1R3IH 4U4IA 3PNWA 4K71B 5EALA 3EH1A 3FGBA 2APVA 5T1KA 4QGTA 5SX4I 3C5ZC 3VRJB 2Y07L 3NJVA 1KWKA 3AS1A 2B1AH 5LBSA 3MNDA 2XWTA 4LBAA 3OC5A 4U3XA 3QNXB 4BH7B 2XWRA 1AD9A 2K7QA 4BA8A 4UANA 4PG9A 1AP2A 4WO4C 4UT7H 1JZ7A 5J1AB 3K6SB 3K81A 1QA9B 4JPKL 3VI3A 5BUPA 4QRRA 5EO0B 1ZOXA 2HH0L 3SCMB 5JW4M 1HK6A 3IDNA 3WUWB 5FKPA 2YBAA 3JT2A 1UB5A 2Q7NA 4M7KH 3FB8A 1TQSA 3MC0A 4P2OB 4YLQT 2GJZB 5DLML 5FDYA 1OTUC 4G56B 3W11C 3KPPB 5DJZA 5ANMA 3VXSA 4PWEA 2VC2B 2UUDK 4S1RL 5I71C 2CLRA 5JXEA 5TJWK 4MAYC 4UT9L 1MIEH 3O6KH 1DSYA 1S5HA 1ZS8A 4MS8C 4MMYA 1MCLA 1YY8B 2ZSVA 5AVXB 5GZNC 1IGML 2OX5A 2RFXA 5DUBA 5JIKA 3VXME 1IQDA 4HUWB 1IAIL 4CVXB 3K72B 4PLKD 1Q38A 3P4LA 1E5TA 3QZWG 2X4UB 1GYVA 1OSZB 1A7QL 3LXCA 5F9OH 5IMOA 5HYQB 3NT0A 1XTLA 4XPHL 1UT2A 4FF9A 1NAMA 5H94A 1ES0A 4P3CL 3GHBL 2QKSA 3QO0B 3MMEA 3LH8A 3HLAB 2YD3A 3BUYA 1KCRL 1II4E 1ORSA 1W6WA 2IDQA 3QZLA 3M1CA 4QNPE 1UXLA 3BCDA 5DURB 1X9UA 1TVBB 1ECYA 3CG8A 3O0RL 4RMBA 4S0SD 1E6OH 1SM3H 3U36A 3NK3A 3BZ4B 4NQCE 5FW7A 1THAA 1HT6A 5AOIA 3UAJC 2A77H 2B2XL 1ZANL 1YEJH 4OB5H 5MEQA 3D3VA 4F7MA 1W2KT 4PG2A 43CAA 4J84A 4XBMA 5CM1A 3AS2A 3BEWA 4NFCA 4Y5XC 4PGDA 4KROB 4MK0B 1CICD 2KC0A 2MOGA 3OKYB 1YEHH 3S35L 4AQAA 1KGXA 2BSBA 2OMWB 4LGPB 3E8VA 3MRRA 4JHVA 4ZFFB 5F88A 5JPMB 4TQEH 1O6TA 3BAKA 3WHXB 2A4ZA 2YD9A 3B9EA 2XTJD 4JFEE 1BSIA 4K55A 2VDKA 4R26L 4PJ8D 4B97A 3AL8A 1N70A 2F58L 1CICB 3GZOA 4PJEE 1DFBL 1TQUA 2OK0L 5KSBB 4G42A 3EDFA 2YMUA 1O9ZA 4KPHL 4JQIL 3HE6D 3PGDB 1K5WA 5D93C 1CURA 1Q9KA 1Z9SB 3QJQB 3CZFB 3QT2A 3STLB 3BISA 3E8UL 3ESOA 3KPSB 2XTJB 1R3HB 2A83B 3BPNB 4FA5D 1QSFD 2YS4A 4QRSB 5E7FA 3MACL 4YGVA 3QJVB 4KI5C 4GXUN 1FFTB 1NWPA 4HDIB 4CUCA 1E6JH 2VZVA 2VCOA 5JWZA 1BAGA 4DP2X 3AQXA 1A1MA 1W9XA 4FQHB 4FQXC 3IUQA 5D7JD 5BZDA 3CQQA 4IS6B 2I60L 2MEJB 5HJ3A 3X3FH 3BN3B 4EIGB 2MQCA 2JKSA 1QSFB 3HEIB 1UCBL 3L3HA 1OP5H 5D7LB 1WTLA 2QGDA 2YO3A 4U1KA 3P2DA 4YHKH 1T6WA 3GB7B 3NP4A 5CIPH 1I9RL 3WSQL 1JGDB 1UATA 5T5FH 2H3XA 3OKOB 2YGOA 1IGFL 2E4FA 1CDUA 4MJIE 5AWNL 2ENSA 4J1UB 5DJ8B 5D7JB 3WLWC 3HCVB 2JIXB 3LB6D 3WFEL 2NNRA 1B4JH 5KYXB 4C54A 3QIBA 4XMTA 3BDYH 3CSPA 1CU4L 5KBMA 3VH8G 3IFPB 1BVKB 4PRHE 4KI5E 4X6CE 2QTEA 3ARBC 2H7WA 2KQNA 3NFNB 4E5XA 2AJUL 3TT1H 1A6TA 4HMEA 5IESH 1AZNA 4ZUUA 3L5WA 2E9GA 5FX3A 2DICA 3H56A 3ES6A 2X70B 2ADFL 1CBVH 2ZKWA 3WENA 2QQLL 4UT6H 1YYML 4X6FB 5DD3H 3U79A 4B9ZA 5I30L 3PXSD 3OR6A 2RQ8A 1TUPA 5TPWH 2IQ9L 1KXQA 4YDJB 1NDTA 1I4FB 1UWGL 3KYMA 1IIKA 4FI8A 3E6HB 2WGXA 3INUH 2D0GA 2NY0C 4G8FB 1XV8A 2P80D 3QP3A 4CN1A 4OV5B 1YUHA 5KAQG 1BVNP 1FHNA 4Y9CA 1RXLA 3NJGA 2Q7YB 4NQDD 2BDNH 5JPNB 1SJEB 2FJHA 3LQAH 3P4MB 5KTEL 5F0PB 1ZA6B 1U8JA 3RTQA 3EIFA 2WBJC 3SDDD 3JTTA 2W9EL 3PHAA 1IC1A 3QORD 1Q0XL 1Y07A 5PCYA 3K71B 3FAXA 4QT8A 3RGVC 2YK1L 2GIYA 4HD9A 1RZKC 3NA9H 4BSWB 2AEPL 1JE6A 3JWDH 4Z3EA 3MRKB 3U0TA 4KK9C 2W0KA 4NKOA 1R33A 3TVMA 1UKQA 2OL3A 3BMVA 3HPJA 3DYOA 4RA0C 1M05B 3BQVA 4L1SA 2H1XA 4TVPD 2AAAA 3PP3K 3BESR 4HU2A 4JY6B 5E8EA 1K8IB 2EO1A 3BLPX 2WYTA 3KGSA 3OR7A 1KTRL 6PAZA 1MI5E 4Y5VA 3PWJB 2EUVA 5L7XH 5C6WH 3F3FA 4CZYA 1XGTB 1FFPA 2VL5B 2BSCA 1D2OA 4IIQB 5C2VB 4QHPA 4FFZL 2GC7C 1QWHA 2VQ1B 4LCVA 4HXBH 4J8RA 4ALAH 4AEHH 1BLNB 4AGLA 5FYLL 1HWHB 4ZW7A 5KEZA 2Z7UA 2PM9B 1QLEL 4D9QE 4E36A 1B4RA 3FCSA 1XR8B 4ZOYA 3UEZA 1JXGA 3L5XL 2KT6A 3U2SA 2MNWA 2NXZC 4HIHA 5C07A 2DBLL 2YD8A 3M1BB 3HC2A 1P5UA 1RUML 3IDYB 4H26B 4CBZA 4TKWA 5C0AA 3Q1SL 4AE0A 4U1EI 5J9PB 1E28A 2FATH 4LBEA 4Y89A 1U3HA 4LPCA 5DC9B 4C56E 1OAKH 4P07A 2W88A 2X5PA 4KK5C 2I7OA 2CG9X 1S9YB 2BS8A 5EHFA 5IUSA 5J1TC 1Z5LB 1LD9B 2QGBA 3NJXA 3CN3A 5DMGC 4YSTA 4DGVL 1MG2C 2WZPA 1GOTB 2WQUA 2Y7QB 4GUOA 2FWSA 5LKNA 4WI6A 4OZIE 2G60H 4MXQD 1E30A 2H6PA 3V6ZB 1A0RB 1GXRA 4CSZA 2X28A 3T2PA 4ONHB 4CMHC 4HIIA 1R9FA 3UTSE 1WITA 4LLMA 4TL4A 4UTBA 2X12A 2UZIL 2C9XA 3G04A 6PCYA 1JGIA 3IFLH 3TA3C 1OOAA 5JORB 4B95C 2HFFA 4YDMA 2FIRT 4JSPC 3H9ZA 1NBYA 3D0VA 5I8CB 1T03H 4AQEA 3FT2B 1EXGA 4NX0A 2D3JA 1JXFA 1VCBC 4JM2D 1EERB 4KDTA 3GSXA 3WTSA 1OF0A 4G8EB 1ADQA 3VXQB 2GC4C 4BZ2H 1P1VA 1A66A 2VR7A 2GCYA 1NMBH 4E42B 1PD6A 1UJ3C 4ELDA 4FXLA 1J48A 3RIAF 3T04D 4N2EA 5LLIC 3SKMB 2EH8L 5FM4A 3WKPA 2GT9A 1WC7B 1KYFA 3GK8L 2JCCA 3MR9B 4WSKA 4XGZB 4R7DB 2AQTA 2R1XB 3DJTA 4B9PA 3KYNB 4JM2B 4ZUWB 5KJ7E 4NWTH 3L3IA 4MA3B 4PWJA 5J89A 1KN4L 2LE9A 4FG4A 1HHJA 3LQZB 1MDAA 5B39A 2I5YH 5L0QB 3GMOB 2ZWNA 3IJHA 5CJOL 1PIGA 3KDPB 1JFQL 5KVEE 2V8MA 4HAFA 3JSSA 3U83A 3MRMB 4YN3A 1ZEAL 5BRPA 2Q3XA 1LEIB 1A6UL 4IRZL 1X5KA 3V9CA 4PJBB 2X10A 5HDBE 3TIDB 3MRIA 3MV9A 4CAGA 1YQVH 2Y2TA 1PTZA 2IDUA 4U33A 4K73A 4M1DL 1CLYL 1FVEB 2RTTA 2Z91B 4XCYA 5AZEH 3SQBB 1M2VA 3H8NA 5ADPL 3CDYA 4H88H 2NQ3A 4WDIA 3DX2A 1YEGH 3THML 3RVVD 4HBCH 5E51A 3LZQA 1HCFX 3VD9A 1VZIA 3EJYC 4RFOL 2XV3A 2E7HA 3DIVA 4TUKH 5DJ2A 3FTWA 2NYYC 2JJVA 3C5SA 1J0YA 4PW3A 4WW2B 5CHNB 4TQIA 5ES4B 3ZRSA 1JJUB 5MEOB 1WFTA 3SE9L 3MRPB 3UACA 5E70A 1I9EA 4PJFE 3UBXA 1HHHA 1E4XL 1A7RH 2NY1D 2XQ0A 5FGSA 4GIOA 3C2SA 3FQ4A 4ABQA 4G7RB 1ZVSB 4QD2E 2CK0H 4JPSA 2X4NA 5DJYA 5IW6A 3VFTB 2CIKA 3NGBB 4HAGA 2AMGA 1BWWA 2CO1A 3QJZA 1YMHA 4NO0B 5AQ0A 2FBJH 4QGYA 3RFZC 1BF8A 1I1AC 2PO6D 1M71B 1MQ8A 4AH2B 4N0UB 4JHZA 4XMKL 1MCSA 2NY2B 2PXYB 3KPSE 4APQB 1A1OA 4RGNC 3MLYH 1OARH 1OAUH 3MRNB 1FDLH 4M7JL 2G99A 1DHKA 2ZP8A 4K94C 3BQUA 4PJXB 1D5ZB 5AZ2L 2OVRB 2CR3A 1KXTA 1RIVH 2ATKB 3U7WL 1S3KH 3QR0A 1WH0A 3LKOB 4PH8A 4FTDA 4DW2H 4XP1L 2PO6B 1KPVB 4OT1L 3BZFA 2LU3A 1WJ3A 1G1KA 3OKLB 4PTTB 3VI4F 3L48A 1UM4L 3X11A 2EECA 2IAMC 1MFUA 4D0CA 5KSUA 4X9GA 3WV0A 3SYPA 4DO5A 1TFHA 4G8AC 3IFNL 4GIPD 4GYBA 5IB2A 3PWNA 4N2OA 3PUUA 2P9IC 3L7EA 4FTVD 4G6JL 2V0AA 4ZUTA 4D8PA 5TDOA 3DUSB 2EXTA 4NUJA 3IDXH 3C6LA 3SN6N 5B8CC 3MU3A 4CNIB 2CRMA 4U0RC 4F20A 4RGNE 1ZTXH 1OP5K 3H6JA 5J12B 3EJPA 4PGEA 3GLDA 3V0JA 4IOFC 1LO0H 2V5YA 4Y16D 1DVSA 3CIQA 3LV3B 1FNAA 3NG5A 4N6RA 4ZAKC 4OGQC 2YA1A 2IWEA 3CFUA 5DR5H 7CGTA 4XRCB 4HPOL 4J7RA 3QUHA 4G6FD 1SJXA 2LAGB 4NRXB 3T3MB 4FL4B 4LF3B 1I9JL 5I66B 3ZKNC 1MFEL 3S36X 2F8OA 3WYRA 3LOWA 1D5XA 4FDWA 1T5WB 4Y4KC 1C5DA 1EEQA 2DEWX 2AANA 4MNQD 5GS0L 3KGRA 3DYMA 4DWHA 4YSSA 3D34A 1WWWX 1WA0X 1KIPB 4F5CE 2O6EA 4OLVH 3UTTA 1FVDB 4L8SB 4QRUB 4H0GA 2EE9A 3P9MB 3P3SA 3J81g 2CO2A 1PD0A 2AQPA 5E56A 1W8OA 3NVNA 2P5WE 3IDMB 4X4ME 3WS3B 1WD8A 4ECNA 1VA9A 4ZMZA 2Y3NA 3MKKA 2DTML 3LKRA 2VW7A 3MRBA 3PWUB 4KAQL 5ETUB 4LDOB 3FFDB 1FNFA 2WWKO 3HA0A 5K39B 1BIIA 4BWWA 1VZHA 2R8SL 5HE1B 2WIMA 4OZ4A 3A22A 1Q9WA 3TWYA 2Q8BL 2YEZA 2A9NH 5JQIB 2JK5B 4NPYA 1EXHA 2I9TA 4QRQA 1OAZL 5KSAB 2CUHA 1F00I 4LHJB 5LBGA 4FGMA 1S7VB 3UP6A 5BNXD 4F7CA 1NZRA 3ZOAA 2CMRL 4EDWH 4LKCA 4LNVA 2ETWA 5D1XA 5TD4A 1FIGL 4PSWB 3KWWB 3SO3C 1E5YA 2UY6A 3DX6B 4AV0A 4G43A 4WI5A 1N5YH 1RJYB 3MA9L 4K3JL 3VNZA 4EPSA 2FR4B 4KTGA 3VFOA 1YMMA 1G9HA 1DQKA 2WCSA 2BHFA 2Z92A 1AQKH 4LHUA 1WCBB 2AJSH 2XA3A 3CZGA 4G7YH 5DA0B 3MV01 1N6QL 3QEQD 2Y4SA 1WWCA 1OCWH 4M7LT 4DQOL 1D5BA 1RFDL 1H3GA 1XH2A 1HYSC 2SODB 3PE9A 3LH2L 1ZT4B 4ZK8A 4Q6IB 5E03A 2OSLA 2VIRA 4IBSA 3TV3L 3QYNA 3BZDA 4FLSA 3F5WB 5HE3B 3BP4A 1T66C 2XX1A 3PFQA 3VU1A 4BUQA 4MDIB 2YC1B 4BCCA 2H3NB 3QFJE 3H2PA 3IDGB 5CU5A 3ECUA 3QEQB 3JWOH 1B0GA 1KNOB 4JFZH 5ALCH 1GIGH 3SO5A 1GS7A 3BH9A 4WZ9A 3VWKD 3H53A 3V7AG 3BZEB 3US1A 5E1AB 2XZGA 3BUPA 2QGEA 1U91A 1M42A 2XN9B 4HCFA 4P46A 4XPFH 5I1IL 1LE9A 4ORGA 2EE2A 1BX2B 2B3RA 1GZQA 1I8LA 4CI2A 1H6UA 2FYYA 1YEFL 1VKXA 5BOPA 1G9NC 2ZUWA 3FFCE 3UIZA 1V05A 4PJDF 2F53A 5TGBB 3GMPA 1NUDA 2DQUH 4NZDA 5TDNA 2BNRD 2ZCHL 2R2HA 3NTCH 4R5TA 4UQ3B 5ICXB 1ZHBA 4K3HA 4EUPB 1C8PA 5I74B 3X12A 4ZOVA 3EKCA 1JVOA 4YHYC 3HHSA 5D2NB 1IEAA 1KTKE 3LVTA 4CGUB 1OLLA 2XPGA 3QXUA 3UDWA 3CN0A 1NLDL 4TVUA 4IMLA 3ZT5A 1GZPB 5AB0A 1EO7A 4U2ZA 1AS7A 4GMTL 2NPLX 4LPWA 2BNRB 1OD7A 3IXAA 4YL9A 4YHZH 1CYGA 2W38A 5T33H 1OM3H 5LGHL 5C0CD 4JY4A 4FXKA 1QLFA 2Z34A 3L95B 4UV4L 2I3SA 4QUOA 2XKUA 5EWIH 5C0RH 4X5RA 3B6SA 3KR3L 2DQJH 1R5VB 1QWUA 4H0LC 4MB5A 1BECA 1EBPA 3HKZA 2DD8H 4FZ8H 2WQVA 3FN0H 4L48A 5CEYB 3Q0HA 4GM3A 4YSQA 5FB8A 3AS0A 2J8UF 2XG4A 3EAKA 4YX2H 5HXMA 1XF2A 5L4JA 4GXUM 1PNCA 4A1RA 1TYQC 1FLRH 4IKNA 1PZ3A 4P2YA 1QLEB 2FX7L 5GIRA 1OPGH 4C58B 4PLJC 4QQEA 3NYKA 1XT5A 4OLZH 4ERQA 4KQ3L 1BYOA 4U1NB 5BRZD 4N8VB 5GQBA 1K85A 4QWWD 5IGOA 1HL9A 4PS4L 4L5FH 3UPRB 1SN0A 2ESVA 4L3EE 3L1OL 1NBVL 4ZMXA 2EC8A 1M7IB 4BGDA 1KCUL 3D85D 2B14A 3O4LD 2HLAA 2IDTA 2VDOA 5DUPH 3OPUA 3EYSH 5BV7H 5JNYA 5F0JB 5KYNA 3GF8A 1SVCP 3TZVB 1KB9K 4WSJA 4AIOA 2WP3T 2V3DA 3LEVH 5AAWC 5BRZB 2CJUH 4KK6D 1LEKA 4X60B 4PJBE 3WIHA 2YD0A 1ET8A 3EGSB 4AXWB 4KJYB 2AXFB 1N9PA 4NQSB 3ARWA 3DI2B 4R7NA 4V1DA 1UEYA 3EJZC 3H7BA 5BXFA 4JM0A 4R5XA 4D9LL 1MW0A 1BVZA 4IRSA 2J6WA 4ATWA 2VDLH 1H8NA 1KUMA 1GJUA 2VR6A 3N1PC 4P99A 4UU9A 4Q9RH 1SMOA 1D6EA 1QACA 2PW1B 5I24A 4YHLH 2V2XA 1XAUA 4DZ8B 3UYRH 3QI9A 3NFPB 1VESA 1U6AL 4S1DC 4OZFG 4X80H 1GS6X 4G11A 1HSAA 3HS9A 4N2BA 5FKAB 4E5ZA 1WLHA 3GSOB 3KD4A 3WXVH 3MO1A 5KG9A 4XMVA 4XNYH 1O5DT 3ARSA 5DRNA 3G5XB 4LLQB 1OT1A 5CBEA 4FG6D 5KBLA 5BOJA 3DIFA 3ARYA 4U6XB 2GK2A 4XTRD 1X4ZA 2DMBA 4LT7A 4MWFB 4E9TA 4H1LA 1YECL 4UTBL 2CXKA 1Q9LB 3I2CL 3OPZH 2Z6FA 3CIAA 4X4XB 5F1SA 3RB5A 2BRQA 3EO1B 2P1YA 4MNGB 1BEYL 1QBMH 1O6SA 1AYRA 3M8OH 4N0UE 4D7PA 4GKZA 5D96C 3E3QE 1K5NA 1AZUA 1ADQL 4J3OD 3VUAA 1ORQA 4YL4A 4ADIA 4UAHA 3LHPH 3K2UH 1KYOK 1SJMA 1LMKA 1MUJA 2FH6A 2X0WA 3LNHA 3OLIA 3OQ3B 2H6UA 4PJXE 5DU7A 5AALA 4HA1A 1EMTH 3QEHA 3FTXA 5SWQB 2ITEA 3IMBA 4AGMA 2F54B 1QFHA 3VGFA 1DP0A 1ZSDA 5DJDA 3HNVH 3I3DA 4ZO7A 1CXLA 1ECZA 1MCJA 3TBCA 3KPQB 1A3QA 2QQNL 3VG0L 2H6NA 3EYVB 5HHOB 4I0CC 1T5KA 3CU1A 5FYKL 4WU5B 3ZE1B 4MQ7B 1IGIH 4PBWD 2NY4D 3RYMA 5I1CL 4HWBA 3GSNH 4BFBD 4YNYA 2H0FA 1A4BA 5L6YH 2YRLA 5BVPL 2HJFA 5T3ZD 2CKNA 4XEIC 2CJSA 2QVFB 1EV2E 2KYIA 3P73A 3WJMB 3DYPA 1P7HL 1K8DB 5DC4B 3DX8B 1MCCA 5K5YA 4OR1A 1I85A 9CGTA 1BQSA 3F7YB 5JHBA 2JV6A 5SV4A 3NIFB 1T0PB 2CSPA 4ZO6A 1BQ5A 4POZD 4LCYB 5FO9B 1PZUB 2UX6A 1OV8A 4OD2B 4P23C 1P5VA 2ZIDA 5C2UB 2H32A 1KYDA 3AFLA 3FN9A 3L2MA 4LVHB 1BOYA 3A0FA 3VFMB 2EDFA 2KLSA 1MHEB 3P30H 2ZSWA 5CYKA 4TLUA 2NT0A 1ETJA 2ADJB 4HKJA 1DUZA 3C5JA 5E4EC 1J1OL 1XCQB 4Z7VF 4EI5A 2VISA 1AZRA 3E80A 2WCPA 3MV11 2AEWA 2JXMA 2VDRH 4A67A 4QRRD 1G1CA 3PNWB 4HJIA 5IFAH 1AR1B 1PZ2A 4JKPH 3VJ6A 5I6NA 4PRDA 2BP5M 5MI0C 1CFTA 4H20L 5T1KB 3ZZQA 2BZDA 1CLOL 1JMXA 4N1CA 2EUWA 4POUB 4ZW3A 1DJZA 5GJTL 4DP4X 5EF3A 5LGJA 3SD5A 2AK1L 4FABH 1AD9B 1DZ0A 1LO4L 4PG9B 1JTDB 2PYEA 4QO1B 5JXED 3V4VH 4JFUA 2XIBA 1GKOA 4TUOA 2VH5L 3VI3B 3HUJA 2R27A 4HJUA 1CXKA 2TSBA 4DP9X 3CH8A 4GG6B 3Q9PA 5HGAB 4POYA 1X9LA 3FB8B 3K6FA 5IBUG 2O93L 1G4MA 1GOHA 2Z4TA 3UH8A 1W15A 5GGQL 5DJZB 3VXSB 1MFNA 1PX8A 2BFVH 4HAKA 3VSQA 3FF8A 2CLRB 1FL3A 5E2VH 2ODIA 1UGKA 1S5HB 3BWUF 4U1HA 3CTTA 3O2DA 4MMYB 2ZSVB 2OI9C 3O8XD 2OX5B 2AGLA 1T1XA 2ARJQ 4PJDA 1IQDB 2XJKA 1S5IL 2PKDA 4U3HA 1SGKA 1HU8A 4P2QA 1VENA 1WBZB 1ONQA 2E74C 3L5IA 4PJGF 1FBIH 5E6ZA 1NAMB 1VGKA 2DLIA 3FOLA 5H94B 4ICXA 1ES0B 3MMEB 1V54B 4W6XB 4W70A 1V7NH 2R0KL 2XA8H 3RUGF 3D3VD 2AJZA 2ZQKA 4OM1H 2F0CA 1PEVA 4LIQL 3BMWA 5DK3A 1OGSA 4ZMAT 1ORSB 1IB5A 2K70A 4KTEH 3V5HA 2Q1EA 3ABKB 4L05A 2QSCH 5LXVA 5HD8D 5HI3C 4PREB 5I26A 3L1EA 5IM7B 2B3IA 1BVLA 3ARUA 4GKSA 4M1CC 4AW4A 2V5TA 4Q9QL 3WTXA 2FLMA 3CE1A 2KDGA 3NACL 3VW3L 2P5PA 4HXAL 3ARFD 3D3VB 4Y7RA 3EYUH 43CAB 1A7NL 1QFWI 1WBYA 2B77A 3GYRA 3TO2A 3PHSA 3ROLA 5GMKn 4PGDB 4LDCA 5D1ZC 1MAJA 1N4XH 3MKGA 1I8IA 4CI3A 1EFXA 3ARZA 1DQIA 5THAA 3PS6A 3L9YA 3RY4A 4F57L 2OM5A 3NCYS 3I50L 4AGPA 4RAVA 1QMUA 2QDVA 4Y2DC 4AK1A 4IJ3C 3WFHA 3RVXD 2OMBA 3AL8B 4O58H 2VDPH 1N18A 1G5AA 5D72L 1H9DA 1EZSA 2FWOB 4AY0A 2XZCL 4G42B 3ODTA 1T20B 2ZWLT 2CJTA 4KZEL 1EUTA 3U9PL 4U6YA 4K7PH 5LG6A 1NAKH 4KJPD 1VGEH 1Q9OB 4NJAH 4EQ3A 5DT1L 3CBRA 4JRXE 1TQVA 4XMZA 2EAEA 2IANB 3GHEL 3HRZA 1N10A 5EOCJ 4Y4HA 4BFNA 5F21B 4HS3B 4YGVB 2HMID 4DHLA 2R4SH 3MOAH 1XGYL 5AVTB 5CEZD 3MDJA 3ASWA 4YDVA 4Z95L 3ZDZA 2FB4H 4AL8H 3NSJA 3QQNA 3K2MC 3FO9A 2C8NA 4QLRA 2APTA 4NOBA 3SDAC 4CU7A 5CBAB 4AKOA 2YKLH 2H4EA 2KS0A 3SKNA 4WGVB 3TN0A 4K3JB 4FFVD 2Y22A 3T2NL 5BZDB 3QIBD 5HJ3B 3S9DB 1JWMB 3X13A 4LRIA 5DD1L 4ERZA 2VLRA 1HXKA 1TIUA 2EBSA 4DNLA 2E0PA 3DV6B 2V7NA 5MENA 4U1KB 1DVFA 3MLXL 1OAYL 3SGKA 3DO4A 4J86A 1UGNA 4B9CA 1O6VA 4NYLA 4K5LA 4TSBH 4L3GD 3ZMEA 1KTCA 1Q0YH 2XY1A 3FU6A 3G9AB 1FFOA 3OLGA 4N5EC 5FYLE 3REWB 2HVJB 4I0PA 4MAZA 3KDMA 3QIBB 5HYNB 1HNYA 1YNTF 3LRHA 4P4KC 3GXMA 2DI8A 2WXGA 3RWEA 4MLIA 4WV1C 3BHBA 3P54A 3U9UA 5C09A 2IBBA 4NFDA 4WFFD 2VITA 4ZUUB 3L5WB 1DQVA 1SLXA 3ES6B 1S9WB 5BRQA 4F37F 2BWDA 5EDSA 5DJ0A 5IWLC 2CHZA 5ESVA 1VEPA 2C26A 5DTFA 5AL0A 3H2WA 4GXFA 3GRGA 1S78D 4R8WH 3OR6B 5D7IF 1PSKH 4J8BA 3EOYG 3B9KA 4YDIL 4QOKE 4ELMF 2OJYA 3RTQD 2IPTH 2VQUA 3KYMB 3MLUL 4TLKA 3ENEA 4IBWA 5EZJA 1BZDA 4KHXH 1HJBC 4AKPA 4NIKB 3V6OC 2Q8AL 2UXVA 4OFQA 2P43B 1YUHB 2B5IC 3TBVA 5DZ9A 3DDFA 4LCCC 1YNKH 4OZIB 3TVMD 2FX8H 1QFOA 3TWCH 1L9PA 3NSYA 4X7SH 1FGVH 3TCTA 4UCFA 3ZIMA 4ZTPH 3EZ8A 4L8CA 3JTTB 2W65A 4KV5F 4AWJC 2WSPA 1HH6A 2R15A 1TVDA 2AFNA 4GSQA 2PTUA 1I3GH 4TPRH 5AAMA 1G6RL 1AZCA 5I5IA 3QC6X 3KCPB 2F5BL 3P0GB 5TFSL 3ARRA 4NKOB 4FA8A 2OL3B 1X5LA 2H0EA 1BVOA 3S5LG 1XGUA 3KL0A 4OZGA 3HB3D 5E8EB 1RMFH 1E8ZA 3V6OE 4Z7VA 3OR7B 3WU1A 4CN6A 4MNGE 3PNRB 3VD4A 2EVJA 3EH3B 5DRZB 1WZKA 3ZL1A 1DN2A 1FN4B 1FFPB 3SYQA 4ZJ9A 1WFUA 1J05A 15C8H 5FO7A 2W5PA 2IDFA 3KPNA 1MHPL 4J8RB 1FRGL 2NY5L 3MNZA 4ZMWA 5C07D 1CF8L 5EZIL 1GGTA 4LEOA 4LVOB 1HYRC 4ODUA 5C0AD 2F54E 3FCSB 1MCWW 1U0QA 2WKOF 5AOKA 1TJHH 1RU9H 1U3HD 1ZHLA 3V5DB 2F8IA 7PAZA 1E7UA 1NFDA 3ZE1E 2CJ3A 3FUKA 4HIHB 4MJ4A 1PG7X 3NCCB 4PGCA 2XG5A 3T0EC 1P5UB 5L88H 2VDOL 4NZRL 2WZPD 3N44F 1CFMA 1EQWA 3LD8C 5H4ZA 3I8EA 4W9CC 5C0AB 5GZOA 3VM5A 3A67H 4W9HC 4MXVF 4DEPB 1E28B 4M03A 5I0XA 5I23A 3GLAA 1U3HB 2DWSA 2X3CA 4X9YA 4YGAB 3N9GH 1BQHA 3FB6B 3L3KB 1DVYA 2DH2A 3WIHL 3ZHNA 4ZPVA 3DK2A 2NQDA 4FXGC 1J86A 2XRAH 1NANI 1F90H 2OP4H 2WXJA 1LDSA 1W72H 5BO1L 4F93B 4ANUA 2OK4A 3WBDA 1XEUA 3ERXA 3H3PH 3NZHL 1T89C 3EF4A 4ZOAA 4U1SB 1NEPA 4OVVA 1UVQA 4EZLA 1KV3A 5TDHB 1AANA 5TQ0L 2NXYB 3BYTA 1ZHNA 2QPDB 4YPJA 3GJEA 4LLMB 3T0EE 4IMKC 5LAPA 3G04B 4JX0A 1BF5A 3C60C 4XCFH 5E8DH 3BAXA 4DNVA 4L9LC 1T80A 5M5VA 1PFCA 4B7IA 1PYWA 1NBYB 2UVEA 3GS7A 3D0VB 4H2CA 4NO2A 5JMRA 2GBAA 3MLTA 4AQEB 5K1NA 1A47A 1G7PA 3GSXB 5C3IA 4G80A 4JN1L 3N41F 2CKBH 1BBDL 1L7TH 2N59A 4GG6E 2Y7MA 3N43F 2B1HL 3TS8A 1S7RB 2JFCA 2GCYB 3A6OA 1KWGA 2JB6A 1HXMA 5EM2B 1I1YA 4HS6B 2J44A 3VXSE 2WUCH 1OTSC 2GT9B 1TTBA 2JCCB 1IKOP 3PWLA 4K3DL 3TH3T 1OOWA 3L3IB 3WNNA 1A21A 3PXHA 2AJYH 5HGHA 5LUMA 3MV9D 4ZW5A 3HG1E 2HTLD 1HHJB 4TULL 5EMYA 3V95A 4EBQL 1S7TA 5B39B 1BGXL 5GS2D 3SPIA 5GS0C 3Q13A 4FEIA 4Z8FH 5KVFH 5EU6B 3IJHB 2ADGA 4I48A 2VDNL 1Q72L 2X4RA 4ZOEA 5E4IA 2EVHA 3IT8D 3UJJL 2CPUA 3UZEC 4EIUA 5I1JH 5JHLA 2LLGA 2ZAHA 3V10A 1BD2A 5IJDC 4GEJA 4HWBL 3A4AA 4JKNA 4CY2A 5M5UA 2AXGA 1SQ9A 1ZSHA 3DV4A 3BAIA 2ED9A 1M7UA 1UACL 2MKLC 1RULH 4GAJL 4NP4H 3TIEA 3IJ1A 1M2VB 2F1EA 2J1YA 1YZZA 4Q2ZB 4PJCE 3QPQD 2AF2A 1GGCH 4R84A 2MJWA 2XHNA 3JZGA 5DEFA 5KZCD 3SPGA 1FP5A 4YE4H 5DJ2B 3AB0C 4PEEA 4M1GH 2E3VA 3V4LA 2GJRA 2HX9A 2ZOKB 4A37A 5CLXA 4KVPA 4M4PA 3ZGIA 2CGRL 2V9RA 3QW9A 3QZPA 4R3SB 1VRSA 1YNTA 4AQ8C 1HHHB 5FLVA 4NNXA 1EJFA 3GBNH 3PP4L 3H1ZA 3TBWA 3FPXA 5DVMA 4KMQA 3QIWB 2X4NB 5AJAA 5TE6H 2BVYA 3BQUD 4P2RD 1TETH 2O30A 1NDMB 2CIKB 4I9XA 1NGQL 3B1UA 1UD4A 3IGKA 1JHKL 1KENH 3MOBH 2JSFA 3QG6A 4L8DA 1YMHB 1NCGA 1XGRA 2M83A 3HBPA 5DJ6A 1RD6A 2QT6A 2QVKA 3QA3B 1R24A 5T5NG 2IBZX 3BUDA 4OJYA 2BOCA 3BCFA 1PKQA 1TMCB 2VXQH 2YAFA 1U8IA 4F3FA 4AJVA 2IANE 1A1OB 5IVZA 1T4KA 3OSVA 4ELMA 4UIKL 1XBDA 3MI6A 1T6BX 3NZ8A 3O3DA 3DTUB 4FA6A 5DGQA 4N90E 4RGOH 5IFHH 3JPXA 1FO0H 1KXTB 3GUFA 2JI3A 3P69A 1FV1A 3EFFB 3BSZL 4KKLD 4NN7B 3TBBA 3HHRB 5EORH 5C70A 2ICEB 5FR3A 3C6LD 2AAVA 3F00A 3MV7A 1K2DB 1JP5A 4KX9A 2VXSL 1UZ8B 4QHLA 3D4GA 1JXDA 4D0CB 3OJDA 1MFBH 1JF5A 4EJ1C 4MXWL 3BD3A 1Z2KA 2ICES 3PWNB 2BIHA 4EZJA 4ONGL 3EI4B 3L7EB 2J25A 2DJSA 4D8PB 4IKLA 5TDOB 5DCCA 1CMOA 4NUJB 1KJ2L 5DF0A 4DP7X 5FECB 4CU8A 3ZKMD 1MXGA 1LTXA 3VXRA 1MCFA 1VE6A 4PGEB 2WMPA 3IGFA 4D9RD 2XBDA 3D48R 4U05A 5GHWL 2OJZH 5I5MA 1LWHA 4DJMA 1BQLL 4FLOA 3TPUA 3UTTD 1WT5A 2JB5H 2ROYA 1JG9A 4MX7A 4OGAC 3WNPA 3IVKB 2DQDL 1GHFL 6CGTA 2QVIA 3GHPA 4BRVA 2IH9A 3N0DA 1MAMH 2VSCA 3IFOA 1D5XB 5HYJE 1MJUH 2JJWA 1C5DB 2JQMA 2IV9A 3TP4A 2P48B 3EUDA 4LSUH 3RFRA 2O6CA 4UI2A 3ROOA 2HU7A 3E9TA 1DBAH 1HIML 1EEZA 1O9VA 2NY3D 1AJ7H 2WKOA 3GMQA 3UG4A 3E1F1 3UTTB 4XP4H 5HSFA 1JD7A 5BMFH 5M94B 2HRPH 1D9KC 1S7QA 1NCAL 5H14A 5B1JC 3ZMRA 2R2EA 1BOGA 2PPCA 2ZKHL 1PAMA 3SDXF 1RZ7H 3T77A 3LKRB 4AMKL 3QUZC 4YFDB 1N0XL 4WTZA 1CT8A 4YLCA 1BIIB 3QYMA 4MB3A 3AROA 4R90L 1PD1A 2X2UA 4OZ4B 3U6XA 2Y0SA 3ARGD 1Q9WB 2WQWA 1DVZA 2YEZB 4ZXBA 4NPYB 4YUEL 2I9TB 4X6DA 1YMMD 2X0UA 3NN8B 4LHUD 1JD9A 5H8DA 5E95B 4HGMA 2VDQA 5B38G 2NYKA 1EVTC 3AU1A 3MRQA 5CUSH 4LKCB 5CKGA 4KFMB 1IUZA 5FPIA 1G7LA 4GRWB 5EPMA 4LZKA 5D1XB 3VCLB 1AGCA 2PPDA 3ULUF 4G6AD 3NEOA 1XFPA 1L0YA 2UY6B 3QJSB 3FU9A 1IX2A 4MLSA 4LMQE 5CZXD 3VA6A 4AUYA 2YSSA 3VFOB 1YMMB 2Z92B 4KRMB 2L8AA 5IHLB 1MY5A 4EZMA 1JPEA 5J06A 1C5CL 1FFNA 1JPTL 2K4WA 4FCAA 4L3AA 3RVTD 3RE0A 4B5ZA 3ZE2F 5DZJA 3LKQB 1D5BB 3K8LA 4AQOA 4OI7A 2CXGA 4G72B 1WBXA 3QIUA 4KVCL 5HI4D 3TEYA 1HHGA 3LIZL 1RK1B 1A7PL 2R7EA 1E8YA 4ZQTA 2OSLB 4LSQL 2VIRB 3RWGA 1ZGLP 4HWZB 4H5JA 3BP4B 4P46D 4EN3A 1OWRM 4Z5RB 4ODVH 1R5IA 3CLFL 5D7SL 1MNUL 2NNAA 1MZZA 4MMZA 3SDCD 2FD6L 4LARL 2NDFA 4WTWA 5IROD 1B0GB 2HJLA 5HVFB 2XXGA 3D1MC 1Z5YD 2D31A 3BH9B 4PB0L 5DHVH 3C99A 4KH9A 1NCTA 4BINA 2F53D 4UINH 3QRLA 1QATA 5C0DA 5DXWA 3OKMA 2EVFA 1HN1A 1J5OL 1A6VL 3MKQA 4CI1A 3UZVA 1U91B 2W59A 2M8XA 2ORBH 2VAJA 4MZRA 2K7PA 4Y1SA 3BSGA 5F7AA 1XHMA 4N2CA 4MYWB 4KRPC 2F18A 3SBWA 4PB9L 1N5AB 4M7LH 1TTCA 5E99H 1HX0A 5GJSL 3B7SA 5GGTL 4Z7UA 3KRWB 3DGCR 5EC2A 5J56B 2F5AL 3GMPB 1CXIA 1GTFA 3A5VA 4C47A 5HJBA 2R2HB 4NM4L 4F24A 1KTLA 1A6WL 1NPNA 2IGFH 1ZHBB 1UD3A 3GNML 4FCHA 4NKMA 1WWBX 2Z35A 2C7UB 1ILUA 1Z32X 2BCMA 3B8SA 4OUUA 4TSAL 3X12B 1J5HA 5EUKA 4HBQA 4XNDA 1G6RB 1IEAB 1NL0H 5AENA 4WY7L 5IJCC 2CH8A 4UV7H 3RWJA 2XPGB 5AOLA 4C4UA 4E41B 1CI3M 1J0IA 2NY7H 3KH3A 4R9HA 1E5AA 3EHBD 5ESAA 1CD0A 5EAPA 1BF2A 2H1LM 4N5UA 3VD1A 2K6ZA 3CHSA 3GI8H 3HZVA 3BP7A 4PYGA 3IXAB 1LHZA 1F41A 1F02I 4I1NB 4XC1H 1QLFB 1YEKL 3QWOA 2NLJA 5LBVA 2ZYIA 4BKTC 1J9QA 2EIMB 4Y2NA 5LQBH 5KBPA 5FO8A 1PDKA 2IADA 3B6SB 4HFUH 2VR8A 4LASH 2Z0UA 4BQ6A 3EHBB 2ESVD 3MJ7A 2X6VA 5H37H 4OI9A 3EWEA 5LN4A 2D9CA 4A39A 2XG4B 3T8VA 1XF2B 1MH5A 5L8KB 2OW6A 1JZDC 1FPTL 5GIRB 4P5TA 4XPGH 4TMPA 4L4VB 2J71A 5AYUH 1HHKB 3UCRA 4WLCA 2UY7A 3AITA 5ID0A 1HKFA 5FYKE 2ESVB 4JQXA 3FHEA 3EDDA 4K8RC 1GMEA 2BC4A 4Z78B 1CCZA 2YXVA 1PBYA 4RDQF 4Z8LA 3P9LA 3K3QA 1KV7A 2HLAB 5EU6E 2VDOB 4V1DD 3RL1A 2ZKMX 3SPJA 1JV5B 2BSDA 2PR4L 3HZKA 4IRSD 1T5XA 2CHNA 3L9EA 1IL1A 4FN0A 2UZYA 3HZ3A 3L6FA 3NIGF 2MCPL 4EI6A 1TSRA 1BMGA 3CDGA 1DJGA 2OULB 1WFMA 3DHUA 4NPKA 4O2EA 5E2WH 3QI9D 4YQXL 3PG2A 3T0DA 2D7OA 1OE3A 3VI4B 1F45A 4R7NB 4DPCX 3H7BB 4NJ9H 5BXFB 5KJRL 4DNUA 2AABL 5E94B 4MMXC 4OIAA 1TTRA 5DD6A 1JCKA 3RI5K 4HHAA 4L3HD 2BW4A 4XVTL 2J1XA 2P5EE 3NESA 2ZF9A 1D6EB 1RZFL 2V2XB 4ZS7H 4XP6L 4D3CL 5IF0B 1NGZB 3DVGA 1ZXQA 5CCKH 4LU5H 2JKWA 5CJQL 2EZ0D 5F72S 4E5ZB 5KG9B 5AW7B 5EUOA 3D5OF 1WWAX 4ZTOL 5DRNB 1RZGA 5CBEB 4OM0L 2AW2A 3QDAA 3MBWA 1QUNA 2R69H 3P11H 4KOBA 1QHPA 3FB5A 4BZ1H 2VKWA 1CTNA 4H1LB 1UT1A 1KYOJ 3HMWH 2D7QA 2W92A 2Y06L 5EULV 3R19A 4F91B 1B88A 1ND0A 4P3DB 4R6UA 1FSKC 1TQTA 2AHIA 3V5KA 1O6SB 3NUKA 4FQJL 2V17H 4GKZB 3HHMA 4PWFA 3SGDI 3IUNA 1LWJA 5JQ6L 3T08A 2JWYA 4Y7OC 3HMXL 2XQBL 3G6AA 1EANA 1MUJB 1U8KB 3CZJA 3VDCA 4KNUA 2KHAA 5TF0A 3W39A 1HEZA 3PJLA 5K59F 2AQ5A 3ZRFC 1IAII 3V52L 5HHXL 3OKEA 3NH7H 1AGDB 1WP6A 1IO4C 1ZSDB 2VDNB 4MA8L 5DJDB 4AENA 4BEIA 5EB9A 3NJFA 4LAJH 4NCC2 8PAZA 1BJ8A 3JYBA 4O3TB 4QHNA 1RIHH 1KT2A 3B4NA 2W0LA 2Q10A 1L7IH 3ULSA 4UIMA 3CPUA 2V2WB 2MPAL 4KBPA 3JZ7A 4YNYB 2IPUG 3RJOA 3I9GH 3UABA 2HJFB 2DWXA 2E7LC 4N2KA 3P73B 4FFYA 3KYKH 4KK8C 4PJ8C 4I9WD 4NUQA 4UQCA 2MTAA 2E6QA 5FGBA 4BP8A 4Y9EA 3DX7B 4CSSA 3DXAE 3L3JA 4GRLA 1A9EA 5I1IH 3HE6C 4OGZA 5MHSE 1I8KA 5I1HH 2H0JA 1P5VB 3GJFA 4KHTL 4UAOB 4X63B 3CFJA 5C6TH 5IW3A 3SBQA 2PYFA 4XCCL 1IKFL 5IBLD 3BSHA 5CYKB 2RA1A 1DUZB 3AG4B 2PYED 3C5JB 3MXVL 5B4MD 4EI5B 3HJ0A 2VISB 5KAQF 1E5ZA 1K3IA 2JXMB 1JGVL 4AC2A 3UYPB 3FOMA 4PRDB 4I3RL 1CFTB 3RAJH 1MRFH 3ULVF 1JMXB 1S4UX 3Q06A 4I2XA 4RIRA 3FT9A 3HFMH 5DD5L 1EEUA 2WBXA 3B5TA 4WFEE 3ISWA 3VXTA 1H3XA 2WD0A 4HHGA 2ALAA 4S1SH 3F58L 3RFHA 4O4YH 4JG1L 1J5IA 2E86A 1IZKA 4PRAA 2F74A 1CDHA 3GKZA 3QJHA 3EJCA 2EDNA 4H8WH 3RN0D 3LB6C 5AW0B 5IOKA 3EG9A 4JT5C 3IMVA 1UKSA 4MSWB 1AXTL 1IC0A 4HIXL 3G5VA 3BLKA 3MLWH 1BZ7A 1OTTC 2H5UA 1N6VA 4KVNH 2VNCA 2ICWJ 3FFOA 4U1HB 4A0AA 4HF5H 1AC0A 4KKNA 3VGDA 3WFDL 4PJDB 2WSKA 3B2MA 3MJ9L 3J27A 3QUMA 4QLWA 5HHPA 5D55A 1OGAA 5D1XE 4DKEH 1KEGL 1OW0C 2HRHA 4N2LA 2QKIC 4YXLL 5HDQL 3WTTA 4P2QB 1OKEA 5AB1A 3ZQXA 3P3UA 1XL4A 1ONQB 1XSJA 1VGKB 3FOLB 4F7PB 3EH4B 3QEGL 5E6UA 2AJZB 5ECJE 2WC7A 2QR0A 2YN3A 1QSEA 4M8UA 3CVIH 1FNSL 4DNWA 5IQ7H 4J78A 5KUKA 5K9OA 1NEZB 3H85A 4M5ZH 2OR8A 1BVLB 4GKSB 2Y2WA 3LKPB 3VQ1C 4MCMA 2UWEF 4MZIA 3IDUA 4P06A 1KGCE 3W3BA 5K69A 3SDDC 4UOZA 1BP3B 3QORC 3WNKA 4TF4A 1WBYB 1IBZA 4DZBA 3PRZA 5L8JB 3PQYA 4ONOA 1CC3A 1I8IB 1UM6L 1EFXB 1CL7I 1C9LA 2QPEB 3CSBA 2ZYHA 1WEJL 2A7BA 2G4GA 3CHPA 5FK9A 4X7EC 4OQTA 3X14A 3VACA 5BO0D 4JRYA 4RAVB 3WTYA 3C2AH 2YAQA 5EU4A 4Y4HD 3WFHB 4PJ5A 4KITB 4AQ1C 5AW4B 3SOBH 5C9KA 5EMLB 3OHXC 4JG5A 1G6VK 1XH3A 4WWKD 3HR5A 3QHFH 5E9DA 3OL2B 1BMZA 3BH8A 3WKMH 3ZPDA 4A2MA 3CMOL 4HJ1A 4KY2A 1KPRA 2P9NC 1NEXB 1XGPB 3X3GH 5DK2A 2BNUA 4FMKA 5DUMH 2BRRL 2VLRD 4Y4HB 3GXDA 4G5ZL 4K5OA 4E41E 3S88H 5IGXL 2F8VA 2YMOA 1ERJA 4U1LB 1DVFD 4YDVB 5D1ZI 2G9AA 1UWYA 2VR9A 1GGIH 1SUHA 4Y5RD 2HRGA 3ARPA 4DP6X 3BGFC 2WOBA 3GBML 1NANH 3D9AL 4FFWD 1SHWA 1MFAH 2Z31A 3TN0B 3AZUA 4I0PD 1F4WL 4DN3H 4TVPE 5LGYA 4ADGA 4J3BA 3L4UA 1TZOA 5FUZL 3X13B 3ZLQC 5JHMA 3DSFL 2VLRB 1VPOL 1T21A 2JKLA 2EEDA 1P84K 1AIFA 4HJ0D 2V7NB 5MENB 4WTQA 1DVFB 5F1KC 3DO3A 3ARDA 3WO3B 4ANVA 5F7HA 2J4WH 3RRMC 5D4HA 3UGEA 5IMLA 4NYLB 2HRLA 5AFU3 1U8HA 1FFOB 1L5GA 3FBKA 1B2YA 4I0PB 2QHRL 3KDMB 3F3HA 5IQ9B 2ADYA 1HAUA 2VW6A 3UC0L 3SHSA 4L4VE 2IG2H 3BPLC 4IQHA 2QMJA 5DHXB 1A14H 3BHBB 4N8PA 4OD3L 1OEZW 2A1WH 2GJ6A 5C09B 4MXQC 3AJ7A 4PV9A 4WUUA 2VITB 1CYWA 3VGAC 1ZV2A 2ZWKA 4FZEH 4B9GA 4UQDA 4NIYE 4PP2B 3WGUB 5FLUA 4WKXA 2VLLA 1RK7A 1Z9NA 2OXGA 5DJ0B 3ZYIA 2IAAA 1AFVH 4PQXA 5DTFB 5B21A 3KVPA 3VGEA 1TNNA 4P3WA 1QBLL 5FYJL 2EYRA 3QISA 1GYAA 2JKNA 2LW3A 3B9KB 2VC2H 3CZNA 3E6FA 1OP3H 1MVUA 3R8QA 5L8LB 1JNJA 4KO5A 5EU3A 5GRWA 4X9FA 3IULA 3LRLA 3BRGC 2C4FT 4FG2A 5I5JA 3VI4E 5HGDA 2VE6B 4YSOA 4MKMA 1PLBA 3ARQA 1NSNL 2NUPA 3TBVB 3W0WA 1NICA 3NPSB 3LNGA 4DF9A 4XHJD 4JDTH 3PE7A 5F8QC 3BLBA 3MBEA 2IWGA 3DMMA 4F1ZA 2GPZA 3KPRA 4P5MA 1IE4A 3K4ZA 4K3GA 4X0KA 4WWPA 2JNZA 2XX0A 1PLGL 2W65B 3K0YA 1LILA 3DTDA 3ESUF 1HH6B 3FUHA 1DBBL 2X9WA 4WRLA 3D8MA 4TNVK 2FGWH 2DQTL 1CDBA 3KBFA 2RIKA 2IH3A 4J6IA 4P8QA 4AM0A 2JJSC 3QG7L 4F1SA 2AZAA 3QXDA 3ZVVA 4L4TA 2P8PB 2DLFH 1JHLH 4IEFA 2XYIA 4ZZFA 4Y1TA 1WAAA 3BKCL 3BT0A 5IJ8E 1BCIA 1XGUB 1X5FA 1XR9A 2R29H 2ZCKL 4OZGB 4R97B 5EOCL 4KQ0A 3Q5OA 4Z7VB 4HOZA 3FKUS 2FJUB 2QELA 1FAIL 2W1NA 5H4YA 4HETA 1XWVA 1QAWA 5FLXg 3NCJL 5MEPA 4XYIA 2NNCA 3HN5A 4Z7QA 4LAQL 4GSUA 2EEFA 3SE6A 1H3WM 4GSDL 4XP9L 3N1GC 1TQWA 3RVVC 3JVGC 3O6MH 5AKRA 2Z4QB 3MNZB 2YFOA 4UBDD 2FWLB 2RH0A 1BXAA 4WI8A 3VYNA 2BCJB 3PF2A 4ODUB 5GZOD 1SQMA 3QJRB 4ZSOA 1FE8L 3A6BH 3EJJX 1QKZH 4WK0B 2WO3B 4GFTB 2DQIL 4FQCH 5DDHA 2HYMA 1NR0A 1I9IL 5FUCC 2NY1C 1CE6A 3APMA 3O6FA 4PGCB 5AOZA 2XG5B 3H42H 1KCLA 1F8TH 3V6BR 5DEGB 5LJYH 4A66A 5BOZG 1NMAH 1MCDA 3B2XA 4DKFL 3WFCH 2J1WA 5GGSB 4DUVA 1HCYA 2D0HA 4EI0A 3BRDA 1HC1A 3DUUA 5EV7A 1BQHB 1UOPA 1DBKH 1G7HA 2AV7A 2XDWA 4ZPVB 3MUOA 1DQMH 5GISL 3CFEA 3E1ZA 2ZUVA 2XV2A 2F19H 4PJGB 3U82B 4JSXC 3FQNA 1DSFH 2OBGA 3RUGB 3CHXA 3OMAB 3DIDA 2YPLE 1I7ZA 2YQBA 3QCTL 4NSXA 1MVYA 5TE4L 3PXTD 1H3UA 4TNWK 5CCJA 3ZZ1A 1E4XI 5F96H 5FUCE 1AKPA 2DQGL 1RVFL 3MV8B 3S8GB 1OSPH 3GJEB 3OW8A 5F0LB 1U93A 3B7YA 4XPTH 2AMUA 2AEQL 4PWKA 4BD4A 4ZD3H 1INEL 1PYWB 3DECA 4I5BA 4A09B 4NO2B 3L4WA 3C5ZA 3MLTB 4HUMB 5KSVB 2OXHA 2FEDC 4LSRL 4LRNH 4GQBB 2ITDA 4G80B 3WOVA 1SXCA 3TNNA 4EKXA 3IDIA 2OR9H 3SBPA 2VT0A 1EGJL 4WO4A 3C08L 3IYLW 3T0XA 4FQ2L 2B1OA 4UDUB 5JTWA 1AZVA 4R83A 2JB6B 1HXMB 3PGFH 1GOFA 1RPKA 4LEXH 5FKSA 5JR1L 1Q1JL 2ZXGA 4Y16C 4X9HA 1WRFA 4NC2B 2ZCLH 5M95B 2R0WH 4K9EC 1Q47A 1F4XL 4PJDE 5HGHB 2X4PA 5CP3A 4KUZL 4RFNB 2J57A 1IFRA 4AOFA 2CK2A 4NQCA 1X6LA 4YXKL 4NZ8A 2VR5A 1RURH 1WD9A 4P2QE 4WI0A 5ALBH 2ADGB 3US9A 4DTGH 4JJ5A 1NCUA 5I15L 5IR1A 1QVOA 2OCCB 2HSIA 2YN5A 4DPBX 4Z7NF 3RIKA 3PABA 5B1BB 3BGAA 4X2UA 2P9KC 12E8H 1KIUA 3EQ8A 4FQLH 4J28A 1BD2B 4XWOD 4IGBA 1JDDA 1MZYA 5T1LA 2Z0BA 2AXGB 5A43C 4ZX4A 3DM0A 2OZ4L 3WFBH 1CK0L 4Y1AA 2LFGA 3TIEB 2TSAA 3FUNA 3QWRD 4FFYL 3VX0A 5EEWA 4HIQA 5DRWA