1FWXA

Crystal structure of nitrous oxide reductase from p. denitrificans
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
591
structure length
591
Chain Sequence
ADGSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESVRIHERTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMKCDAILEIPNAKGIHGLRPQKWPRSNYVFCNGEDETPLVNDGTNMEDVANYVNVFTAVDADKWEVAWQVLVSGNLDNCDADYEGKWAFSTSYNSEKGMTLPEMTAAEMDHIVVFNIAEIEKAIAAGDYQELNGVKVVDGRKEASSLFTRYIPIANNPHGCNMAPDKKHLCVAGKLSPTVTVLDVTRFDAVFYENADPRSAVVAEPELGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIEDAIRAYAGEKVDPIKDKLDVHYQPGHLKTVMGETLDATNDWLVCLSKFSKDRFLNVGPLKPENDQLIDISGDKMVLVHDGPTFAEPHDAIAVHPSILSDIKSVWDRNDPMWAETRAQAEADGVDIDNWTEEVIRDGNKVRVYMSSVAPSFSIESFTVKEGDEVTVIVTNLDEIDDLTHGFTMGNYGVAMEIGPQMTSSVTFVAANPGVYWYYCQWFCHALHMEMRGRMLVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Revisiting the Catalytic CuZ Cluster of Nitrous Oxide (N2O) Reductase. Evidence of a Bridging Inorganic Sulfur
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NITROUS OXIDE REDUCTASE
total genus 185
structure length 591
sequence length 591
chains with identical sequence B, C, D
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2000-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13473 Cupredoxin_1 Cupredoxin-like domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1fwxA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1fwxA01
5EM2A 2CBPA 2IWKA 1KYAA 4IA9A 4J87A 5HE2B 3RFGA 1OOWA 2XV0A 3DTUB 3TA4D 5GXIA 2HZHA 2AVFA 1PBYB 1OE3A 2FJSA 2PLTA 3JROA 1J5CA 4LGNA 4ZN4A 5I5IA 2HRHA 3MX0B 1B9YA 2IUVA 3PE7A 1XB8A 4Z8LA 4FA4D 4U7AA 3EG6A 2HJBA 3AZUA 1ZPUA 4E9WA 3UVLA 5THAA 1IC0A 3QJSB 1BYOA 4PSWB 4A7JA 1X9UA 4ENZA 2PCFA 2CO0A 2UXTA 1GS6X 1KDJA 3WKPA 4FA7B 5AKRA 4J79A 4YSQA 4OZUA 4DP1X 1PLAA 4FAAB 4A2LA 5AZUA 3PVWB 4ERQA 4F7KA 3ZX1A 4E9VA 1SQJA 4GZ8A 2AFNA 3I8CA 3L4OD 4PNKB 5I5MA 1L9RA 2DV6A 2FT7A 2HX7A 3V7DB 5TEFA 4PSXB 5PAZA 3N55A 1WS7A 4BDVA 3EWEA 3TBCA 2CN2A 3NVQA 3X1EA 2OK6A 3NP3A 4QT8A 4G56B 1AZRA 3NJFA 4KNTA 4CZYA 1TKWA 5C2WB 4HIPA 3NSFA 9PCYA 2RACA 2YQBA 3DSMA 2XX1A 3T71A 4FHLA 3BQVA 3CDZA 3DKHA 2GC7C 2CNXA 3EI4A 5IGQA 2YNNA 1MG3C 4JKNA 3V9EA 4CZXA 1PLBA 3AL9A 3NJMA 3CVBA 2YXVA 1U2VC 1PCSA 2GIMA 3OMNB 4YSRA 1PAZA 1SHWA 1TEFA 2PPAA 4BWTA 4QLWA 2AGWA 4GM8A 3NP4A 1T5KA 1RI6A 1JZFA 3FGBA 4A09B 4A0BA 1YLBB 3MKSB 2ZOOA 4QKTA 3P4FA 2WO2B 3DM0A 1PLCA 5CYKA 1OCRB 3V5WB 4YSSA 2OVPB 4FAVD 3J81g 2FQDA 4AOWA 4E9TA 3TASA 1J9SA 4I79A 3X1NA 4LG9A 4TXVB 3SMRA 2EIKB 3SWSD 1AS7A 1AZCA 4N4YB 5HE3B 3PXTD 4NB7A 1BQKA 1BQ5A 3CG8A 4DP4X 1ASQA 1JXDA 1V10A 2Q9OA 3WG7B 1AAJA 1XMEB 4ZOXA 3JB9L 4YSPA 2FTAA 4FAND 3RFHA 1MZZA 3HFQA 3OD3A 3FSVA 1F56A 1ETJA 2H47A 2I3SA 4BUJC 4G72B 5CXBA 1AS6A 5AJAA 4ERYA 4X63B 2I3TA 2HX8A 1SFDA 2YAPA 3ASOB 3L45A 1WA0X 3OM3B 4H5IA 4BK5C 2YAMA 2UXGA 4AZUA 4J8BA 1RZPA 3SVWD 3G5WA 4J78A 2PP7A 1JOIA 1R1CA 1GOTB 1ZIBA 4IMMA 5EALA 3IJ0A 3C5MA 3NJIA 4M3HA 3ZWLB 5GXHA 1OLZA 4HCIA 2HKRA 5FQDA 3OKYA 4NSXA 1XB6A 4AX3A 1NWPA 5H17A 3J80g 2DY2A 3RMZD 2WSDA 1JMZB 3FSZA 2XVBA 3AG2B 1JXGA 4BXSV 4X61B 2HXCA 3DXKC 1W8EA 2PCYA 3WIAA 1PNDA 2OJYA 5TDHB 3B7FA 2P9NC 4J86A 4A2GA 4CSZA 2PM7B 2IDTA 2W88A 3OL2A 3QJQB 4G7RB 4GP4B 5HQGA 2I85A 4HCFA 3T6WA 2UX6A 2B4EA 1W6LA 5EMKB 1ZDSA 3I7HA 3IE9A 2PPFA 2J56H 1SF5A 3SLED 1OF0A 1PGUA 3I8EA 3VGZA 4DP9X 5IC7A 4A2EA 2H3XC 2R7EB 4Q89A 3ORVD 3CFVA 4N14A 4KO5A 5FKSA 3CZUB 2G99A 1AZUA 1ASPA 2B3IA 3A0FA 1VYHC 1JZIA 2GHZA 1SF3A 1GY2A 4GGCA 4GXFA 1GY1A 3SN6B 1XHMA 4BDVB 3MZLA 1AQ8A 1N6FA 2PM9A 4MK0B 2DYRB 2X87A 3SBPA 1MG2A 4GM9A 1RKRA 2AGLA 1ILUA 3PLYA 4ERZA 1CC3A 5B1JA 3UAEA 2H47C 3ODTA 1A4CA 1JVOA 2QPEB 3OTTA 1JERA 1JZJA 2YB8B 3CFSB 3GREA 2PM9B 2TSBA 2VM4A 3CDZB 3EI4B 4HZ1A 4AKQA 1TYQC 3ZIYA 3FSWA 5A2Qg 4A11A 4HAKA 3AL8B 3KRWB 3NJNA 3BWSA 4E9XA 3I7KA 4YSUA 5I6KA 1NDTA 2YMUA 1WAEA 5D4JA 6PAZA 2LLNA 3RLMD 4NAJA 5B7EA 3JRPA 1M9WA 1S4UX 1DYZA 4O45A 2P9LC 4GY4A 1GXRA 3UGEA 3AL8A 3I7OA 4L3HD 5ANHA 3UR4A 5CYKB 2P9KC 1A65A 3F3PA 3CVCA 2FNWA 2H5UA 3AG4B 4N8UA 6PCYA 1SHYB 3JAMg 1CYXA 2ZXWB 4X3EA 4D6VA 2DWTA 2WO3B 3PXLA 3KRXB 5H14A 5IJ8E 5F7AA 1MZYA 2I0RA 1TU2A 4G7SB 3ZDWA 5FKTA 3RN1D 3SBQA 2I0TA 1ZIAA 3JT2A 1ET5A 1AANA 2GBAA 5I6NA 1J9RA 3UAAA 3NSYA 3S8GB 2HRGA 4XYIA 4Q8BA 1AIZA 1TBGA 5I6MA 1WS8A 4E54A 1BXVA 5B1KA 1AOZA 2CUAA 2FQEA 3FQ2A 2OVQB 2UX7A 3ABKB 3E0CA 3FRXA 4Y7RA 2XWZA 4YVNA 3S3DB 1NPJA 5CXBB 2HLEB 3X2QB 2X88A 4E54B 4W9ZA 2VN3A 4KNUA 2BP0A 1EHKB 2YAFA 1BAWA 3WI9A 2FQFA 5FLXg 2E86A 3WNIA 2B5LA 3UKUC 4JHUA 4A68A 2J56A 5FXYA 1B9XA 2GNQA 4YSEA 4AEZA 3KW7A 3BG1A 1KV7A 4CY1A 4PC0A 2BP0B 4O1QD 5EHFA 3NJLA 2YARA 3SJLD 4EWRA 4YSCA 1JZEA 4K3JB 3AFCA 2OCCB 3NJGA 3OKYB 1GW0A 2BW5A 2GSMB 4GP8B 2HX9A 3FPYA 3C99A 1NIDA 1L0QA 4GQ1A 1QLEB 4J82A 4R7AB 1ADWA 2N0MA 4DP5X 2CO0C 1JVLA 1NIBA 2Z2NA 4GQBB 4U1EI 1IBYA 2PPCA 1NICA 1KCWA 4E9YA 2YBAA 3H56A 2QC5A 1KBVA 1IKOP 3NSCA 3QPKA 7PAZA 2XV2A 2UZYB 3IJ1A 3PAUA 4BXVA 2J57G 4Y5RD 3GFCA 3ZBMA 3EF4A 3T6XA 2XV3A 3OL2B 2P9SC 1RZQA 3AY2A 2BCJB 1X9RA 3MMYA 2FWLB 3ULEC 3PSLA 3ABMB 2JKWA 1HFUA 1P22A 3IN0A 4KNSA 1HAUA 2W18A 3SHFA 3JPXA 2AZAA 2J55H 3PVUB 2R7EA 4DP8X 3FYIB 2XU9A 1NIAA 4UANA 2J57A 2AANA 4L1QD 1IBZA 1I53A 2PPDA 4BWUA 2XYIA 5HE0B 1XB3A 4A2DA 3UADA 4W1TA 4ZK8A 5B7MA 4ZOVA 1NPNA 1WA1X 1VLXA 1NR0A 2VSKB 1ILSA 1AZNA 1HAWA 2TSAA 3I2NA 4BH6A 2I7OA 4O3UB 1TEGA 4XYHA 2MTAH 4YVDA 5B7FA 4JT5C 3BG0A 4PAZA 2XL2A 3I7LA 3FU7B 1PZBA 1SDDA 1PY0A 3JZNA 3T6VA 1OV8A 5FKRA 1ASOA 1OE1A 2OIZA 5K1CC 3MZKA 3NJJA 1GS7A 5FA5B 2GI0A 3EH4B 3U4YA 2GC4A 1AACA 2YNPA 2H13A 2HXAA 3UVOA 4JXMA 4A11B 3FSAA 2QDWA 2XX0A 1E30A 3PAVA 3C75A 5B1BB 2G9AA 1URIA 1ID2A 4UI9R 5TK2A 2B5NA 2OJ1A 3FM0A 3C9CA 4LG8A 4YVUA 1GR7A 1NWOA 3FQ1A 3JZHA 1K8KC 4ZOZA 2H9NA 4ES0A 3VH0A 4JT6C 5I6OA 4CSPA 2VW7A 2Y1AA 3MKQA 1E5ZA 1V54B 3H4HA 1PZCA 2YXWA 2J5WA 2Y69B 1OE2A 1AG0A 4RH4A 3GYRA 5HE1B 4HHWA 1A3ZA 1ZV2A 2P9IC 3OMIB 3IIYA 5SXMA 1OCOB 1PF3A 8PAZA 2I7SA 5I6LA 1XKSA 1JXFA 2BZCA 4WTQA 4J77A 4E9SA 5TEEA 2P80A 4YL4A 1L9PA 2IAAC 3W15A 3FYEB 1OMWB 2H6NA 3VA6A 3UKRC 2CCWA 4L0PB 3F3GA 2CE8A 2EBSA 3I7PA 3K27A 1SQ9A 3ABGA 1CURA 4HDJA 2IDUA 4AI7A 4F2FA 5K19A 4P5RA 3TU6A 2AH0A 3ERXA 1MG2C 1MDAA 4G71B 2XU7A 4KFMB 5HYNB 2I0SA 2IH9A 1NZRA 2QT6A 1PEVA 2H9LA 4PBYA 4J0XA 2ZWNA 3KW8A 3MXXA 1GSKA 1L9QA 1AG6A 2BP8B 3GXUB 3MBWB 4KO7A 3IN2A 4X4KA 3T9WA 3U25A 3X1GA 1AS8A 2XYBA 5PCYA 2IUQA 5C9ZB 2H3XA 3PPSA 1ZDQA 5IJ7E 5LDUA 3V9CA 5EMMB 2CN3A 5CXCA 1JMXB 1BXAA 4JD2C 2FT8A 1JZGA 1E65A 1QHQA 2BP8A 3FQYA 2DYSB 3IEAA 4JSNC 1PI6A 5EAMA 2EILB 1FA4A 1MDAH 2HKMA 1OCCB 4ESGA 2Z2OA 1CYWA 4GGDA 4P5SA 1KGYE 3ABLB 4UF7C 3EHBB 5B1AB 2IDFA 5TK4A 3SQRA 1EZLA 4AKOA 4AKPA 2DWSA 1N6EA 2AGYA 1IUZA 2IWFA 4FA9D 4ZOYA 4CY2A 3C75H 1ET8A 2EIMB 3FT0A 4M4RB 2O9KA 4GMBA 2FT6A 4HALA 5KDOB 2GB2A 3AH8B 2A3TA 1V55B 2Q5BA 3UACA 1BEXA 2B08A 4J81A 1OCZB 4JHVA 3OW8A 1E67A 4BL0A 1PNCA 2MTAA 3RRMC 1YFQA 4CZVA 2CAKA 2IAAA 4GYBA 2PPEA 3PXWD 1N68A 2YAOA 2VSMB 1N6DA 2H6QA 3AW5A 3FU7A 1SDDB 1A8ZA 1Q47A 4KO6A 2H9PA 4L3GD 1RCYA 2XLLA 4FA5D 2CJ3A 4DPAX 1FWXA 2VMJA 2Z2PA 3RN0D 3SCYA 3EI2A 1BYPA 2HJ4A 5GMKn 5D4HA 4F2EA 5EMLB 1JJUB 3PSCB 2J55A 2MRYA 1SFHA 1QNIA 4KO9A 2JFCA 2Q7QA 4J73A 4K3ID 3EI2B 1DZ0A 1PZAA 3S3CB 4FB1D 1CUOA 3OMAB 5E9NA 5A7EA 4QRJA 1B3IA 3QQXA 5I28A 2AGZA 1A4BA 3PCYA 3FU8A 5H1MA 3NJKA 1SJMA 2IURA 3S3BB 4DPBX 4JSXC 2EINB 3RSEC 2IWEA 3UVKA 4BWWA 3DXMC 4KOBA 3V9FA 1W6WA 3ASNB 1ET7A 2QDVA 3I89A 3SFZA 1R5MA 2GC4C 3EH5B 5AMSA 5EMJB 1K32A 5D4IA 2OK4A 2IUPA 2PP9A 2FQGA 2P9PC 2QXVA 3EI3B 4PBZA 1BQRA 3DWLC 4E5ZA 2EIJB 3JTBA 3CVDA 2JXMA 1A0RB 2BBKH 4L9OA 1KCBA 3IKOA 5B3SB 2GC7A 3EMHA 4CC9A 1NIFA 2UXFA 1AR1B 5EM2B 3FU9A 5I6PA 2XXGA 1GP2B 1J9QA 4QL1A 4HCGA 2CE9A 4QQEA 4MFHA 1E5YA 2IDQA 4CI3A 4CY3A 2IDSA 2XUWA 3GDCA 3EU7A 3QJUB 4KOCA 1KBWA 3QJRB 2PBIB 2ZONA 1N70A 2XXFA 4XEIC 4EF3A 2PP8A 4GQ2P 4J84A 5IT9g 3L4MD 5IGOA 2BWIA 3PXSD 4DP7X 2HYEA 4A08B 5EARA 1NTDA 3PAZA 3H4FA 2YAHA 2YAEA 5AFAA 5CXCB 4J0WA 3QJVB 2H9MA 4K9JA 4TZ4A 2CALA 4DP2X 2AH1A 2H6KA 2P80D 3AG3B 4A66A 3IJCA 3I7NA 4A08A 3F3FA 1L9OA 1AZBA 5F7BA 3FPXA 4GP5B 4UAHA 4DPCX 3TBBA 2HESX 2PM6B 4O3TB 1XIPA 4GGAA 2BHFA 3RYMA 4A2MA 5B4WA 2IH8A 1BXUA 3T6ZA 1PMYA 2W8CA 1GYCA 4WKXA 4OWRA 4DP0X 4PXWA 3UVNA 2QPDB 3X1FA 5GSAA 2OV0A 3HB3B 5FKQA 2BW4A 3OQRA 3D12B 5C2VB 3HEIB 1NINA 3JZGA 2XL3A 5I26A 2AQ5A 4A2FA 3NT0A 2TRCB 3NYKA 2BO0A 3DIVA 5AFU3 4FA1D 3S8FB 4DP6X 3OKWA 5I5JA 1M56B 4O9DA 3SXTD 4A0BB 4A09A 5EAPA 4A67A 4A2HA 3QJTB 4CI1A 4YSAA 2VM3A 2VW6A 3K26A 4FWWA 7PCYA 5JWZA 4D0KA 2UXVA 4G70B 2P9UC 1WA2X 3FS9A 3NVXA 1SHXA 3IBOA 3WKQA 1GS8A 2YAQA 5FC9A 1L9SA 1J5DA 3NJHA 3UABA 3X1BA 1U4CA 1NIEA 2B5MA 4G7QB 2BWDA 4A0AB 4CI2A 3AG1B 2AZUA 5IY5B 2OVRB 3EI1B 1KDIA 4E9QA 4HHGA 3OKTA 5TF2A 1A4AA 3BVDB 1M57B 1JZHA 4CY5A 3NVNA 3CIKB 3NSDA 1GG2B 3IIWA 4A0AA 3N0EA 3N0DA 1J9TA 1ERJA 1L9TA 3EH3B 1JOFA 4H5JA 3EI1A 4YSTA 1FFTB 1SNRA 3N2JA 4PCYA 4YSOA 3SBRA 1MG3A 4CI8A 1UATA 4E5ZB 4YSDA 3EI3A 4GM3A 4JSVC 4JSPC 4E9RA 2BZ7A 5B1JC 4X60B 2NRDA 2H14A 2VW4A 4NERA 2AGXA 2UZXB 4J8GA 2YNOA 1NEXB 2H68A 3WNJA 3UVMA
chains in the Genus database with same CATH superfamily
3RWFA 2WTOA 2P8LA 4W4NA 4ATWA 1VZHA 2DDQH 3AUVA 1VZ2A 2ZKMX 1PVHA 4WV1B 3FFOA 1HHKB 5EUOE 5ERWA 1CFVL 1YRKA 1U8OA 1G7MA 2B2XL 1ZHLA 3B9AA 3EYUL 2G5UA 4GNKB 5C0JB 4OLVH 2OI9C 4JMXA 5DQ9B 1JPFB 3E8VA 1U21A 2ICWB 2ZYIA 4PBVC 1XGUA 1CDJA 2JKSA 3LQMA 4F7EB 1D9KC 2V2WB 1MLBA 2J1YA 1MCNA 2B3RA 3KYOA 3VD2A 1IGTB 3KPRD 5ISZD 3P9WB 3OX8A 2PO6C 3HHSA 2CJUH 3MLVL 4RX4D 2DV6A 3QNXB 1C12B 3P11H 4LPYA 3VGHA 4PG2C 3A23A 1ZS8A 1DBAL 4WW1A 2H1PL 3Q9PA 2JCCF 3ZT6A 4GW4B 3U0WL 4C4KT 2ODHA 2YRLA 1FVEA 2X9XA 4KNTA 5I0VA 3Q6FB 3TYFA 3G08A 4GSRA 4E41B 3T71A 3UZQB 3DSFH 1FJ1A 1MG3C 3PHSA 2Z65C 4PJIE 5IQ7H 2ILLA 2VZ1A 3F00A 3N40F 4QLWA 4BFBD 3LRSA 2VR4A 1KPVB 1OKEA 1ZVHA 2J6EA 2Z3FA 1ZJBA 3GK8L 2CHNA 4XMXA 4AV4A 3IDUA 4PTUA 2OVPB 3J81g 1RZJC 3PWNA 3LHPL 2GJRA 3PIQA 3JVGC 2R69L 3SMRA 5K59F 2GITB 2W81C 4Y9BA 2D03L 4KITB 3OV6A 1UM5L 1QTPA 1U0QA 4PJ9B 3VI3B 4N90D 4HC1A 4N0UE 1IO4C 4LPWA 3QUYC 5C07B 3ZO9A 5CD5D 2QHLA 3HFQA 2H47A 1R47A 2I3SA 4JFQA 4X8XA 5DS8A 5GGRB 3ISYA 2C9VA 3B2UD 5JYMA 1S2EA 5B8CC 3US1A 1KOAA 3QRLA 3FQXB 1AZVA 4ISVA 4XOEA 3P77A 1KZQA 1V8HA 2QKIC 2PP7A 5I75B 1E2VA 3GXTA 4O2EB 2XN9E 3F05A 3FQXA 2XZQH 3FRUA 3OKYA 4LSTH 5CBAB 5I8KH 1MPAL 3ULUC 2FO1A 5C0AE 1HCZA 2GTQA 3GB7B 5D2NE 4HYTB 4PLNC 4F2MB 5KG9B 4EXPX 2Z35A 3V4PH 3P30H 4MRCA 4WV1A 2NOYA 5F7UA 15C8H 2H8PB 2VWEE 5D8JL 2EVJA 1NGPL 3GSWA 4FNQA 5C0BD 1AZZC 2FEDC 1UJ3C 3BPOC 2JCCA 3MMEB 4OZHB 1NC4D 1U8JB 4OFYA 1MCKA 2J56H 1UZGA 1Y7VA 1G6RA 2WKOA 4KQ3L 5IC7A 5HPOA 4Q89A 4ZPTB 5DD5H 4PQXA 1N5YH 1WFUA 4H0IA 4Z7WB 3P11L 3I9AA 3K1DA 2DQFA 4JG0H 1Y07A 4JFHD 4HH8A 4NOFA 1LJMA 5DRWA 5L2KE 3PGFL 1AQ8A 1MG2A 3KCWA 2C7UB 4OCRH 2HTLC 5FHBL 1WFNA 1JHLH 2GTZA 3V0EA 1N18A 5IMOB 4YFEA 3OTTA 2EDTA 2YB8B 3FTVA 2N56A 1BQUA 2AJYL 1GCFA 2W0PA 4QOKD 3VDBA 5BZDB 1UZ8B 5IMOA 1MJ8L 5I6KA 5DC2A 3MV7A 5D4JA 2IFGA 3EO9H 3ZMEA 1PKQB 1TVDA 3GTTA 2MQ3A 2I9LA 3KM1A 1S4UX 3NCBB 4GY4A 4PW9A 2DQJH 1FGNH 4LP8A 2D4DA 4Z0BL 5CLWA 3K2MC 4PGEA 1EO8H 1P9MC 2DBLL 3KRXB 4D6VA 4LCIH 2E4TA 1MZYA 3V8CA 4PJ5D 4L29B 1Z7JA 4IJ3C 4YEFA 1WC7B 2E7LA 2E0PA 2CKBA 4N5ED 5ALCH 3ZTNH 3COOA 5ALBL 2FQEA 3BWZA 3N1FC 4FG0A 4Z7NA 2XTJB 4OLUH 1LILA 5JA8B 2OW6A 4JFQB 5GGTH 3ZKNC 2VN3A 2BP0A 2FQFA 5EF3A 4DEPC 2K4AA 4A68A 4QRPE 1G7HB 3VI3F 1DVFC 4F7CB 1BF8A 2VLJD 3QIUB 2D7TL 5E8EB 1GW0A 1MWAL 3DOIA 2PXYC 3VXPB 1PD6A 5HDBB 5IVXA 4APQD 1ND0A 3ROLA 2PPCA 4XRCA 1HH6A 4GAJH 3VFMB 1I8UA 2DEYX 2GAZB 3KPNB 3IJHB 1FSKB 1JMXA 5EU5B 1P5VA 1QACA 2UY6A 2ZCLH 3QDGE 4Y5RD 3DVGA 2N0KA 3QHTC 2ZWSA 2R4RH 4Z7AA 4M8RA 1AHKA 3O6FB 1OQXA 3NACH 3O4HA 2R51A 3IJHA 4KK9C 3PSLA 2I26N 1A6PA 1JD9A 3HA0A 4MDRA 4UNUA 4JRXD 4LCWA 4XNBA 1DFBH 4CN4A 1HYSD 3H6AA 2DKMA 3NQKA 3QDGD 4TQ8A 4PJXE 5E9DD 5FV1L 2AANA 5FM5O 5GGSA 1S9XB 1RU9H 2OX5A 3IMSA 4JGJA 4A2DA 3I85A 4Z78B 1IU1A 5KJRH 3OHXA 1DUYB 1MWAA 3Q8CA 1JL8A 4PJCE 2X4OA 2VLJE 2DLTA 1A4JB 3QDMB 2MTAH 2FK9A 1FFOA 2W38A 1TPXC 5M5RA 2Y7MA 3OLDA 3T4AB 1PY0A 3CLWA 1ES0A 4HFUL 4QYAA 4Z1PA 5F88A 5CXPA 2APTA 3DMMC 3JWNH 2EDHA 2W91A 4U1LB 4OLWH 3FQNA 5D72L 2DYPA 3G5ZA 3DV6A 5J5EA 5A3IC 1ID2A 2KZBA 2OJ1A 3FB6A 3O6ML 3QIBA 4UAOB 3ABZA 4JLRB 3KEHA 5E7FA 3LEYH 3CFDA 2FEEL 4ONGH 5I6OA 2V5SA 2VW7A 3BN9C 3TBSB 5EWIL 2ED8A 2WV3A 1P7QD 1M7DA 3DJRA 3LMJH 1DUZA 4MNHB 3MJ8B 1I8KB 2YPLB 3V55A 1IV8A 1MI5B 2P9IC 1I3UA 1PF3A 1MQKH 3EGDB 5KJ4A 2VDKL 1ZGLM 3CFEA 4UM9D 4CVWA 1YZZA 2HFFB 2WBKA 4L5FH 5KS9E 5HI5D 3OKDB 4OVUA 1TITA 4U1SA 5CCGE 4NRZA 3I6KA 3U1QA 4NLAA 4HISA 4YR6B 4F8NA 4ZI8A 4U6HA 5IQOA 4Y19D 4Z7UF 5IBUG 4XCEA 4ONOA 3FJTA 4P5RA 1S9VA 3HAEG 4IBLT 4L3EE 3NCWA 1MG2C 4N85A 3ZSSA 3CV5A 1BAFL 1LD9B 4OB5H 5GS1A 1C9SA 1PTZA 5AW4B 1EHLH 1TJGH 2B0SL 1AFVH 2ATKA 3GSUA 3WV0A 3HE6A 2NY2D 3IRZA 3MBWB 1TVBB 4JFHE 3X1GA 3F8UB 1V7ML 1AMXA 4EVNA 3Q06A 2ETWA 4D3CH 1IAOB 4N8CL 1U9KA 1YYMH 4JD2C 2OK0H 3IEAA 1MPAH 5DZOA 4FMFA 1PZ5A 3JTSA 4H25A 1MDAH 1KGJA 5EUKA 4JDEA 4FTVE 1CYWA 3VFPB 4LEBA 3EHBB 4YAQB 1OQOA 4KRNA 5C2BH 3QUYD 2OJEB 4S2SA 1ET8A 1EO7A 3FT0A 4HD5A 2XN9A 2O9KA 1BVNT 4HALA 2JJTC 5CBEB 5I2IB 3WTTA 1KTDB 4OLZH 2IXQB 1G7LA 1BEXA 4WWNA 1XF5B 3O3AA 4ZFQA 1NL0L 3QUGA 4QWWC 4XNYH 4PRDB 1XGPB 3DYOA 4JO2L 5CBEA 5I2IA 3BP4B 4GYBA 3PXWD 3OR7B 4XP6H 4M5TA 2RQ8A 2LU4A 4XHJD 4LAQH 4WI3A 4L3GD 3WJJC 3SCYA 3NA9H 3K2UL 3OXRB 4PRDA 2B4CC 2FX9L 3MQIA 2X9YA 5GMKn 4XX5A 3RL1B 3WFHB 3SDXE 2E74C 3LRKA 1IQDB 2VDPB 3U2IA 4QNPF 4NO3B 4FC3E 4Y5XC 2ZAGA 5E9DA 1X7SA 4XNDA 1T21A 4FQXC 2JIXB 4N90E 1T0OA 4NZ8A 4OZFA 1F4AA 2IGFH 3D9AL 3PDGA 3ARBC 3T4AC 3V9FA 5HHPA 1OTUC 2M83A 3EBAA 4J28A 2VDNA 2QTEA 3TO2A 1I9JL 1QRNB 5D4IA 3MKGA 2YBGA 5CKGA 4Y7OC 3AT0A 2CA4A 1G7IB 4JUSA 2FJGA 1SDAB 1KIUB 2QHRH 2RCSH 2X4NA 3V5DA 2UXFA 3GLDA 3FU9A 2ADFL 1SDYA 3LH9A 3O81A 4AC4A 3TFKC 4QL1A 2VYRE 2CNZA 4JFZH 4JB9L 4QNPE 4NT6B 4CY3A 1IARB 3KBEA 3GNML 4LL4A 4OM0L 1OANA 4E5XA 2OMYB 1LDPL 4ORGA 1TQBB 4PR5B 3PXSD 1I4FB 1TT6A 3D39E 3AAZB 4M6ML 3B37A 1TQTA 1D7DA 4U3HA 4DGUA 2PXYB 1T04A 1D9KA 5H2BA 5AFAA 4JJ5A 4QTFA 1Q38A 2W9LA 1DVFB 3DX8A 5I17A 3AAZA 1U93A 4G9DB 4Z7OE 2CBOA 1CK0H 1T04B 5EEVA 5H2BB 2KQNA 4KVCL 4LE8A 4O3TB 4NC1C 1W8NA 1HXMA 4NUQA 4RGMB 1DBML 4P2QD 3ZT5A 3GMNA 5D7IE 3TL5A 1YMMD 5I1KL 2VLRB 3ZR5A 4G8IA 1J8HD 3WNPA 3WNLA 4HQQH 3ML8A 1JF1A 1LEKA 3LZFL 4PJBE 1U8MB 1G1YA 1EGJH 1S46A 5J9PB 3BEWA 3I84A 5DYOB 4Z6AT 4L5FL 3T0BA 1AQKL 3WEBA 1AKPA 2RBLA 3NYKA 4ELMF 2HUEA 3IU4L 3KZ8A 3WN5A 4MSWA 4RBPH 5LN4A 4NAMA 4L9LC 2UXVA 1JXKA 4FTVA 4P3CL 1U8CA 2AXWA 4H8UA 4NNPL 3CX5K 5SX5H 4P9HH 3QZMA 4PCKA 5I15H 1W15A 4A0AB 3NABH 4ZUUB 1DO5A 4CGTA 3BVDB 1H8NA 5HYSA 2HFGH 4PJAB 3EFDL 4MWFB 3Q5YA 3TXAA 3US9A 4H5JA 4MA8H 2OW7A 1ML0A 3SYAA 2J2ZB 2X1QA 4JSVC 1PW3A 1VFBB 4WCYH 3M1BA 1BX2B 5B1JC 1MRDH 3LYRA 4LLQB 3B9KC 4OSUH 1ZPLA 5C8JA 5EBWA 2AGXA 5KJRL 2XKNB 1M4KA 2FHFA 3QO1A 4LSUH 5KVDE 1NEZG 5EF1A 1JGVL 1BEYH 4J87A 3BSGA 1FNEB 3AS3A 2EVHA 1S5HA 3L5XL 4G83A 4FRWA 4UT6H 3EDKA 3FO0H 1LDSA 3CU7A 2ZXGA 2R2HA 3O3BB 5FYJL 3U4KA 1FNEA 3DX9B 3MRRB 3U4BH 1X5KA 1A3RH 2PMZA 4F8OA 3EG6A 4AG4L 1NEUA 3P9LB 4KRMB 1T3FB 1GS6X 3L5JA 2FB4L 4ZUVA 3UP6A 1IEAB 2LR4A 1VIWA 5EU4B 3K74B 4Y1AA 2J1ZA 2EABA 1Y18A 3W0WB 4HS3A 5EOTB 1CBVL 1KJ2L 3LY6A 3MROA 4B9PA 4BDVA 3CX5J 5CIPH 2DLHA 2VUOA 2OK6A 3HIZA 5B8CB 4XN8A 1BQLH 3S5YA 1UACL 2HLAB 3M8OH 1HZLA 5C92A 4M1CC 4G6KH 5A2AA 3SE8H 4DW2L 2DMGA 2FWUA 5GGTL 5IW3A 3FTGB 4CADB 3NCYS 4YLBA 1DJZA 4NSKA 3CVBA 4OGAD 4J4PC 3WFEH 2BY2A 2WCPA 3S5LA 3EYQC 4WNQB 3LXUX 3B8YA 2NR6C 2HG5B 4BKLA 3MZTA 3GMLB 3QHFL 3TBTA 2F68X 4LLAA 4AXWA 2NY0D 3WIFA 4MBRA 1OAUL 5M5UA 5JR1H 2NY2C 4JRWA 2P5EA 2NW3B 4IGBB 3VMNA 4RX4A 1RJZB 3HMWL 5CJ8A 2ESVB 2EIKB 4JREB 3WIFB 3ZE2B 4J1UA 1CGSH 3PXTD 4WEMB 3KEDA 4NUPA 2F54A 1JXDA 2V0AA 4TUOA 4EQ3A 1D5BB 2AEPL 2CHXA 3TA3C 5IB4A 1MZZA 1SYVA 2J43A 2WYIA 4IRZA 5D7IA 4OLXH 4Z7NB 3L8QA 3DUUA 1I85A 4JO3H 1XZ0A 4TNFA 3TH3T 3KYAA 4JY5L 1CLYH 1BIIA 4FXGA 2HX8A 2YAPA 3OM3B 5E4AA 1ETB1 2QQLH 2R27A 5CBAA 4G8GE 4OCRL 5JW4M 2IH1A 1Z9MA 1G7HA 1AXTL 1THAA 4S0SD 1RXLA 1ZIBA 5HYJA 5FO9A 4O58H 5JO5B 4IHOA 5I1EH 2BY0A 4XVUD 1MXDA 4FKKA 1P6FA 3GSXA 1YNKH 1FAIL 5TQ0L 2DWDB 4WEEA 1P7QA 2H6UA 4JQIL 1T22A 1W8EA 3CC5B 2QQNH 4Q52A 4FQPA 3C09B 5A16A 2ZICA 4BFJA 4F58H 3FQTB 2P5PA 1Q9LB 4LSSL 1SRDA 5DJYA 2FZ3B 3MJWA 2D7OA 5JPMC 2LAAA 4TQPA 1U8NA 5EU6E 15C8L 5F7HA 3KJ6H 2VGLM 3VD5A 1S7RA 1WAAF 1UEYA 2XNAA 3IGLA 3U83A 4TRPL 1SBSH 2DZEA 1AZUA 1R4XA 4IK7A 4LRIC 4XTRC 5DVKA 5IHBA 3FQRB 1SF3A 2F0CA 3CK0H 2DQEH 2IH3A 3HCVA 4PGCB 1YEKL 1WISA 1U3HC 4C56B 2GUYA 4P2CG 2V7HB 3SBPA 3EYFA 5CD5C 8CGTA 1GJWA 3F7YA 5B1JA 1EDHA 3WFBL 2I07A 1JVOA 2MMXA 2HH0L 3AXIA 3MLRL 4F7TA 4OLXL 3GREA 3FO2B 3UZQA 2VM4A 3CDZB 4ZOEA 4IBWA 4ZXBA 1MFDH 3FSWA 3US0A 1C08A 4B5ZA 5GPRA 5FK9A 3X13B 4LEOB 4OF7A 4PGDB 3ZTJH 4K8RH 5D2NC 2XDHA 3S35X 3BMWA 4L29A 4AJVA 3NRQA 3FZUD 3VA2C 4GB9A 4KK6D 2DWTA 4CVZA 3VQLA 1I8KA 4NHCH 3RKPA 1G6RL 4ODTH 2MH4A 1RZGB 3EW3B 4PJFF 3WN5C 4JKLA 4CN6A 4MMXC 1IM9B 3WFEL 3PQYD 3FB5B 3FT4B 2DMHA 2HRGA 2B20A 5EEXA 1QBBA 1NCAH 2UX7A 3X3GH 5DWUH 4KV5F 1DO6A 3HUJE 4H0LC 5CXBB 1WC7A 4ZW8A 5IHZB 4W9ZA 4GW1A 3AABA 5ACZB 4ZYKA 3SJVD 3HPLA 2VDOB 4LDEB 4FTVD 2V7NB 4CY1A 4F8PA 4NQVA 5EHFA 2L3BA 1CICA 2F5BL 2ATKB 1IBHA 2J8OA 3L1OL 3QHZL 3SDDA 1RSFA 3TIDB 4DJMA 2K45A 3LN9A 1CE6B 4G6ML 1B6UA 4LFHD 5KEZA 4BK4A 4OCWH 2O5XL 3FQTA 3UFIA 3VFMA 3BQUA 3VQ1C 1HQ4B 4PJIA 5D71H 3ZL4H 4OZIE 3LPGA 3APNA 3QZNA 1B9KA 2UY6B 4UT6L 1GHFH 1U8JA 1QRND 2W18A 2JI1A 2FD6H 2ICEC 2RALA 2YUZA 3PVUB 3A6CL 1OM3H 2BSED 5C9JA 1AQHA 1DSYA 3V4LA 3HC0B 3IKKA 4BWUA 2XYIA 3O2VL 4HU2A 4ZFFA 4XC3L 1EJ8A 3EFFA 5DD1L 3I2NA 4O3UB 4GS7C 2WGNB 1KNOA 4BA0A 3BG0A 4G8EB 4PJ8A 2YPKB 3FU7B 4OI8A 4PS3A 1E50A 3M46A 3MNWB 4KVNL 2WVSA 2DQJL 1R0AL 1GS7A 4H8WC 4K23H 4QPEA 1M2VA 3U4YA 1AACA 3TZVA 4NAAA 3WMPA 4Y4FA 5JORB 3FSAA 4KDWA 4A37A 4M03A 1NCNA 2BSEA 2NT1A 3MN8A 4MKTA 2ZCHH 4YVUA 4PEEA 1XIWD 4D94A 3QCTL 3QK0A 1A9EB 1IX2A 3VW3L 3VXSA 4ES0A 1EANA 3UGXA 1JK8A 3BW9A 1V3LA 2J5WA 3OG6B 1UKSA 3DJSA 4X8CA 1RZGA 2A9NL 3E9UA 4QXWA 2Y07H 1CYGA 3EHBD 3W39B 4P23C 4DPRA 3GIZH 3BN3B 3LQAL 5FUCC 3L5WA 3H9SD 5IT2L 4L0PB 1XF1A 5DURD 3II2A 3VYOA 4CBPA 3HRZB 2YD1A 4L5FE 3QZPA 3KXFA 5BO0D 2IJ0C 4JQXA 5E4EC 5E8DH 3TWCL 4DUWA 1MW2A 4BGLA 2K1MA 4NO0D 2BNQA 1CT8B 5H35A 2H9LA 3U48A 4MKMA 4AMKL 1ZXQA 3PRZA 2ICEA 1R46A 3QUMB 3HTLX 4MJ4A 1H3TA 2H1XA 4LEXH 5HGGS 4F9PA 4MYPA 1GSKA 5JPMB 4Q14A 1MJJB 3KG5A 2HA1A 3G6DL 3UTQA 3ZQXA 4RE6A 3W2DH 3GEFA 2Z31B 1A7BA 2NPLX 2TRYA 4YHOL 5I19H 1BXAA 4OI9A 2NCMA 1FRGH 2P3YA 4TYUA 3BP5A 2DYSB 3MBWA 3QFJA 1KCLA 5EN2A 3KCPA 2R56L 3MVDK 4M93C 2HKMA 3L3IB 3MO1A 2AEQH 4I48A 2Z2OA 4XP1H 4FZ8H 5TK4A 3CH1A 3HBGA 5L2JB 3QQDB 1EAQA 2FD6L 1MI5D 2UUDH 3B3IA 2DAVA 4KAQH 3HI5H 4PWHA 2Z8WC 2HJLB 4M9OA 4L3AA 3ILQC 2PR9A 3IXAB 4RAUA 4JO4L 4AEIL 7TAAA 1VADB 2XBZA 2ZKWA 5LO7A 2ZG3A 4JHVA 1P2CA 2GJZB 3EJZD 3QEQA 3T3PE 3DECA 5KAQF 1N6DA 1JJUA 4E9LA 4LLMB 1B9ZA 2V17L 4KRPC 5BOZG 1IAKB 3EI2A 4U1MA 3MRBB 5ESAA 1FIEA 2J55A 4X99B 3AWFA 4ZQKB 1U8HA 2WINA 3LQZA 4OZIA 1A1OB 3OMAB 3DXAE 3QRBA 3L08A 1JPSH 3FU8A 2M2DA 2E7BA 4FI8A 4JSXC 3RFZA 1ZT4B 1QG3A 4C4BA 1JNLH 3MBXH 5HHVL 1W6WA 3DXMC 1UXWA 3B9DA 2R23A 3I89A 1NOAA 1EUTA 1G7IA 3W81A 2DQHL 1PL3A 5AZ2L 3OKLA 3TNNA 3AQZA 3EZJB 4WCYL 3EI3B 2H9GB 1JCKA 1JV5B 4J4PA 3TO2B 5MEQB 2W65A 4OY9A 4NZUL 4LKCA 1EAPA 5L6YH 1HHGA 1XXFC 1LWRA 1R24A 2YXMA 3STBA 3B1TA 3TN0D 4MJIA 4BP9A 3ETTA 4GRMB 2O6DA 4FQ1H 4AYBA 3QXDA 1JHKH 2XUWA 2VLJB 1NAMB 2BSCA 1C5DB 3QIUD 5AZEL 3EU7A 3KDPB 3Q0HA 3QJRB 3QUXA 4UQ2A 5A6MA 1NCJA 4UZGA 5A6LA 4H5SA 2NZIA 3BZ5A 4FQ1L 1B0WA 5GIRB 3TOPA 1ZGLP 2WLLA 5DQJB 1H9VA 3DX3A 5AW0B 1DJWA 1RZ7H 3MGTA 4OGXL 2YQ3A 1X6NA 4G6JH 4KVNH 3CFBB 4W9FC 1PYWA 1CXFA 4ZUVB 3FZUC 4ORGB 25C8L 1XAUA 4R83A 4XO9A 1BVLA 3OPZH 4JE4B 2NSQA 5CJOH 5DVPA 3RUGE 2WC7A 4P46B 3HS0A 4B97A 3AG3B 3IJCA 1D7CA 3GWJA 5GJTL 3FBKA 3NCJL 4JPSA 2G9KA 1R3IL 1QBLL 1KN4H 1QP1A 2P5WD 3UMTA 1BVLB 4I4WA 1T2XA 2A99A 4QJ3B 3RYMA 1BFOA 4BH7B 3CVHL 3U0TA 1GYCA 2Z7WA 4L9DA 3EQ8A 5MENB 2E75C 2KMWA 3WTWA 2FECI 4R7DB 4DK5A 2VQTA 4ZUSB 1R34A 2WVTA 3EYVA 4I3SH 5ETUB 5JHMA 3GDBA 1G9NC 3KPRA 5ISZA 3JZGA 4XPTL 4ABQA 1NC2D 1GGTA 2N1KA 3GBMH 2VKXA 4X5QA 5KSVB 4Z7IA 1D2PA 3L7FA 1O6GA 2A4ZA 3F7LA 5BJTA 5FEBA 3BZEB 3WKML 1TCRB 1SLUA 2IDCA 3C6LB 1XGRA 3HAEH 4TKWA 3V6BR 5T33L 3OKWA 3F84A 3ZDXA 1YY8A 2OYPA 3K26A 3UDWC 1JSYA 4F57H 3NVXA 4DGYH 1ETZB 1G7QA 1HESA 2ITDA 2EZ0C 5DHXB 2VR7A 4B9IA 2H0EA 5M94B 2Q76B 2BPBA 4MWFA 1ZT7B 4XBEH 2E9GA 2P44B 3ULUF 4X7TA 3I6LE 4PTTB 3SE3C 3SDYL 4LHUD 3FT3B 5G4NA 2Y7OA 1ACYH 2ZXAA 3W1ZA 3FF7A 5E00A 1FL3B 4PWJA 1J9TA 3GMQB 5DRZB 3FQWA 1A3LL 1FV1B 3WL9A 2VXUL 4YC2B 5GRWA 5IEHA 3FOLB 2BZ7A 2R56H 4HKZB 2JH2A 3OKOA 5C0BB 3UTTE 3CFJB 1OARH 1TZ8A 4TSAH 1EMTL 4HLJA 4LIQE 3OKOB 5C0BA 4LCIL 5ABAA 2EC9U 1CQKA 1QFUH 2HZHA 5EBWB 1C5BL 3CBKB 1NGZB 2DKUA 2EKJA 2E6PA 4W81A 5T3XE 1ZHKB 4JL2A 1KCSH 5BOJA 1MQ8A 2IMNA 5DQJA 4NNPH 3PP4H 1TQBC 4PBWD 5HYIA 1OSYA 4W9LC 2UXTA 4MBOA 4XNUL 5J6HB 5T33H 1YJDH 5F44A 3SGEH 3FU0A 4WUUE 3MA7B 4ERQA 4OCXL 4Z7VE 4E9VA 5I17B 5AUMB 4IEFB 2R2BA 2R1XA 4KKQA 1A02N 4B95C 4L8BB 1DQVA 5PAZA 4LPVA 4QOKB 3TBCA 3PGFH 1IL1A 4LP5A 3X1EA 3HUJB 4XB7A 5E6SB 1TKWA 5C2WB 5F1IB 1CJYA 3L1EA 1MFCL 5DT1H 2K4WA 1XCQB 1FFQA 5DMJB 1E4XH 3GUTB 4N0YL 1TMCB 1TZHB 4KI1A 4D9RE 1A1MA 4N22A 5KSAA 5DC0A 4N2IA 1WCQA 1GXEA 1NLBL 3P4OB 3G5VA 4FFYH 4W9HC 4QGTA 4R7VA 4RAVB 2WLKA 4M00A 1UENA 3L3OB 4LCCA 4Y5XB 4GRLD 4X8JA 3HS9A 1I1AA 2R83A 1J9SA 3C9NA 3KPMB 3TV3H 2YLKA 3NMEA 3EJTA 4FFVD 4FG6D 4GG8A 2YD3A 5AZEH 2V9UA 4NB7A 1E27A 2AQTA 4Y5YC 2J88L 3WFDH 1YPZF 3TP4A 3S9DB 3HMXL 5LNDA 3K6SA 3OD3A 1M1XB 3BFWA 1XEDA 5HGBA 4K5LA 1UC6A 3WJMB 2ZJSL 1SFDA 3FQWB 2YMTA 5IQMA 3DX2A 5IF0B 2QSCL 4BK5C 2UXGA 4ODVL 5IJDC 3O4LD 4HETA 1C8PA 2W1NA 1GOTB 3WJMA 1CGWA 1T22B 5HPMB 3GSVB 2WN3A 3FU6A 3J80g 1CU4H 2PO6A 3FSOA 2XVBA 4P2RE 1JNNL 4KWUA 5LHDA 1S5HB 2GSGA 2VR9A 5JO5A 2YC1B 1B3JA 5BUAA 4P2QA 2IGFL 3ARED 1KSRA 3C2AH 3E9TA 1IVLA 4N0RA 1DZBA 3GI9H 1A3QA 2NY0C 3N50A 2PPFA 4O4YL 3CN1A 1F2XK 1UTCA 4FTDA 3DX6B 1RZFL 3MUNA 2XZQL 1MCCA 2QVFB 4JDZB 4D2NA 1G9NL 1SVBA 3FT1A 2H1PH 2UYLA 2RMNA 1IIIA 2VIRB 5EPMB 3DK2A 1KCVH 3MLZL 2R1YB 2DL9A 5JTWA 4FLRA 4PRNB 3QB7C 2DH3A 5IQ9B 1BOYA 1UA6L 2EYTA 1GRWA 4ZSOE 1KB5A 2EDMA 1J88A 3A67L 3GSQA 5JORA 1E6JH 3W0WD 4WW2F 4QEGA 3EAKA 1Q0YL 3WTYA 3MFGB 1VERA 4G1EB 1UQSA 1ZMYA 4OLYH 2F7OA 2ICWJ 5B38B 1BW8A 3E80A 2R4SH 2YEQA 1L9MA 3OJDA 4O02B 5AENA 2CKBB 2WGXA 3RWHB 4G7SB 5DA4A 3LQAC 5ITBL 3CSPA 4WY7L 4XODA 2Z8SA 4GG8B 4G9FB 3WUWG 1A6AA 1JRHL 3RDTD 5MEPB 4Q8BA 2IG2L 3FHAA 3B2MA 2EUWA 4YL9A 4RBPK 4N0FA 5IB1A 4Y7RA 2KC0A 4EN3C 1NFKA 4CJ1A 4G5AA 2R29L 1DBBL 5H94B 3WI9A 5EIIA 1XL4A 4IIQB 4Z7OA 4PJXF 3WIIL 5IF0A 1DBAH 1K6QL 2WQXA 2YUVA 3PPEA 4G2AA 5H35B 3SYOA 4BZ1L 4FG2A 2EEBA 1UHVA 3QYCA 3IMRA 4UTAH 2OYLA 4JK0D 4JCWA 1UH4A 3HI1A 1TTUA 4AM0B 4NQVB 3AITA 3LOWA 3NEEA 4PJGB 1E8WA 2C8NA 3AS0A 5E8EA 4TL4A 2ZCHL 1FSKC 2J57G 3GRBA 1ND0B 5KZCD 2O30A 1HEHC 1X9RA 3SYCA 1JN6B 2DDQL 2JKWA 3VUAA 3VI3E 3DVGB 1MH5B 5D72H 5FGSA 2YBRB 2NSXA 3ZDXF 4EZJA 1N6UA 3Q2VA 1IC4L 1IBZA 4AOFA 3FT2B 3LIZL 5HE0B 2G4GA 1YY9C 1ZVSA 2ARJB 4CKVX 4D0DA 4HKXB 4LSPL 1NPNA 5LN8A 2IOOA 4AE0A 1YMHA 2J4WL 4PLKD 1XGPA 1TO5A 2XTJC 3QEQB 4IOSA 4AJWA 3ZZLA 3GBDA 1A3LH 3DV6B 3VO0A 5K1CC 1G9MC 1D7BA 3WTSA 3IRPX 2GC4A 3MRBA 5HHOD 1KJVA 4F58L 4G8EA 2ZX5A 3EBGA 1NSNH 2QDWA 4RMRA 4HU8A 4XNMB 5TDNB 5ICUA 5CP3A 5FK9B 4KZEH 4GQ9H 4G6MH 2GUOA 3ENEA 1K8KC 5B39G 2DYPB 3FULA 4OCYL 1RULH 4PW3A 1WUNT 5DGRA 3B7YA 1RH8A 1XR8A 2IAND 4TQHA 5FOJA 4RH4A 2ODIA 3EJRA 4GG6F 4MD5B 3EJUA 4UCFA 1B2WH 2F1EA 2XWTB 5HYJD 5EU6B 4CNIB 2VKWA 4OJFL 2R8SH 1A5FL 2EVGA 1EAPB 2AXFA 4LVOB 1S9WA 5EU6A 4CNIA 1A25A 3QUMA 2IDUA 5DUBB 3GJEB 3MV7D 3HE6B 1X7QA 3UG4A 4Z3HA 3EDFA 3DOHA 3OKKB 5DDHB 2I0SA 3CXDL 4ZFOB 4M6OH 2BVQA 1UD5A 2WIMA 5I1CL 2FJUB 3IPBA 4PJHB 5AVXB 4NKMB 3VH8A 1EO5A 5C9ZB 5DTFB 4L3CA 5T1KA 3V4UL 2OTUA 3REVB 5K9OA 3DHJA 5KVFH 1MUJA 1PX3A 1ZLDA 5EZPA 4F1ZA 4HF5H 5E6ID 2DM3A 1MCWW 3NZUA 4X4XB 1I82A 2VDNH 5FO2A 1N5AB 1V5JA 3ABLB 1FNLA 1XCWA 3EO9L 4MA3A 4PUBL 3NFSL 2EDLA 4GAYB 1PQZA 4ZOYA 1E4XI 2Z6FA 4YHNA 5EBMA 2VMFA 5ACMA 3WO3B 1ODUA 5IKCA 2FT6A 4M61A 4IDJH 1N5AA 1U4EA 2D3NA 5JIHA 5DHEA 5EBLA 1J0ZA 2GJZA 1AY1L 1FYHB 1S7QA 3CH1B 3ARDA 3V6OA 3WUZA 2D8KA 3MXVH 1QFWL 4J81A 4PM1A 2VDLB 4YFLF 4M61B 1SYSB 1E67A 5GQBA 3CAFA 4XP4H 5T3XH 1JK9A 2IAAA 3NOIA 1MCIA 2YAOA 3BH9A 4YH6A 3RL1A 1E8ZA 3V0FA 4Z7UE 1H5BC 1EEQA 4NENA 1VADA 5F7MC 4B3VA 3U46B 3X3FL 3RFZC 1YCSA 2OMNA 2AXGB 2VAAA 3IU4H 3QDGA 5IM7A 1AHMA 1V27A 3GRWL 5EMLB 2MRYA 2VABA 1KTLB 4KO9A 4U6VL 1NBCA 1BLNA 1DZ0A 3BDXA 3QH3A 5E9NA 4JN2A 3VDAA 5IESH 3K0YA 2MCAA 4EI5D 1E9PB 3ECUA 4JKKA 2Q87A 1SJMA 5KOMC 5HHNA 1QSVA 2FGWL 2N4IA 2C9RA 1AE6L 2QDVA 4NGHH 1S78C 3VTAA 4O2CB 4WGWB 2H26B 4KX7A 5B4MC 4WWKB 1DJXA 4NC2B 4O9HH 3BYYA 1DVYA 3BAJA 3W39A 2QXVA 3DWLC 1R24B 2DBLH 5DSCB 3L4CA 4WFFE 3O4GA 2O6CA 3O8XB 1M6OA 1F18A 2A6JB 5IJCC 4WFHE 3F58L 5EWIH 1AR1B 4M29A 2X0UA 5L0QB 3WBDA 4OBRA 2CU9A 1NJ9B 4FDWA 4WDIB 1GZQB 1LWHA 3B6SA 4HCGA 1ED3B 3EYOB 2MQGA 4JPWL 4UDTB 1PGRB 3MUHL 4B60A 3IBEA 3T2QA 3P9MB 4XO4A 4Y0GA 1KTRL 1IAIM 2AJYH 1SXNA 1ZLWH 1PZSA 4P5KB 5DK2A 2ALWA 1OGPA 4FN0A 1IIKA 1NTDA 3PAZA 4EIUA 1PPIA 1BD2A 1KJ3L 3QDJD 4WV1C 32C2A 1FE8H 2CALA 3VWJC 1T20A 1KC5H 5I1HL 1I1AD 2AH1A 2P80D 3WDHA 1W72B 1QFMA 1I9IL 4YDKH 1HZKA 1NEZB 3VFTB 1NMBH 1CICC 1P1ZB 4JQXC 1PQZB 5JPNC 4WAFA 1QFOA 3A24A 3N3EA 1RHHB 4ACTA 4PRPB 4A7TA 2D3JA 4OWRA 4PJFB 4WFHD 2BNUA 1CD9B 2YD2A 1TYEB 3OQRA 2ZUXA 4P23A 1NINA 3I9PA 4ZNEE 1P7KA 3U1SH 5JW3H 1AJ7H 2G3XA 1MCRA 4EBQL 5AFU3 3QUYA 2FB4H 1RZKH 1J8SA 2EIBA 2NY4C 4PTUB 1BOGA 4HMCA 4RFOH 4KKNA 5C3TA 4CMHB 4DN3H 2EYSA 5BMFL 4O5LH 4GKSB 5CILH 5FUZH 1NAMH 4G7QB 4MSWB 3WFDL 4NZRL 3ARUA 1UM4L 2YO3A 4DWHA 1PD1A 5FKAB 4QRTA 3OKTA 5GGUA 4WZ9A 5ACLA 1T7VA 5KSAC 5LGKA 5DZLA 4AGNA 1AD9B 3N0AA 3HC4H 5F70A 3BO8B 4OSUL 2R9HD 4IS6B 1H6UA 3T3MF 1QO3B 4H26A 2F61A 1OT2A 2HT3C 2RFXA 1F3RB 3RVTD 2X4UB 1NBQA 4JFTA 1EHAA 4W6XB 4JM2F 5EC2B 5BS0A 3SPGA 1PKQE 2NQCA 2XTJD 4R0LA 3C5ZB 5HHMB 3RFGA 4QHLB 1JUFB 2CMRH 3N04A 2AVFA 3QO1B 3AUWB 3JROA 4G80A 4YZWA 1F3JB 4ZFZB 4EN3D 4HWEH 1WAAA 5D2LE 5FYLE 2IBBA 2AJXL 1XB8A 1ZANL 3KPPA 3HS0C 1LLAA 3O3BA 2PCFA 3S34L 2BVOA 3X3FH 1I3RB 2C4XA 3D69A 1O6TA 4YSQA 1VPOH 3GBNL 4IOFD 2QVKA 3UBXA 4WJKA 3IJYB 1SQJA 4LOFA 2LU3A 1TKWB 3RB7A 3ATDA 4S1RH 3GHBL 5L0QC 2VRKA 2EC9T 3NVQA 1E0OB 4F24A 4I7ZC 4QRPB 2V7HA 4G56B 4JDTH 5EPMA 1W80A 5EO1B 2R2BB 2I07B 1KLUA 2PETA 4HK3J 4KHXH 5GGRY 4V2CB 4OT1H 3CDZA 1JFHA 2GC7C 2HG5A 2VZTA 2XQBL 4XAWL 3PGDA 4JZNA 4CZXA 1L0YA 2ZOLB 4HJ0C 4AXWB 4IU2A 4GQZA 3ETSA 4YSRA 1SHWA 5F8QC 4CILA 3PG2A 4JFFA 1CTNA 3R4RA 1I7UB 2OMVA 5I73B 3G6JA 5F97E 1PEWA 2B0SH 4M7KH 3RIFK 5LBSL 4OZ4B 3FB8A 1RJCA 2FQDA 3GF8A 3NN8A 4FMVA 4JM4H 3TVMB 3NIFB 2ERJC 5A7BA 1E9OB 5C09E 3QUZD 4N4YB 2PWHA 2WXIA 5DS2A 1CLOH 1ASQA 3HKZA 2P8PA 4YLQT 4I18A 5FECA 2A0LD 2FX8L 1F90L 3ZU8A 3NESA 4G7YL 5KVDH 5DLML 5EZJB 3PWUA 3U0PA 2SEBB 4BZ2H 4H5IA 3H3KA 2YPVH 3HPLB 3WL9B 3D34A 4Y16C 5ADOH 4XXDA 1GYAA 2XZAL 2AGJH 3CSFA 4P05A 1U92A 1Q0XH 4WU5A 2ALAA 1CFQA 4XPFH 2QSQA 3LNHA 2HKFH 1X9LA 1MVYA 1MJUH 2OTWA 2Y7SA 5IMMB 1GH7A 2XJLA 2WUBH 2VZOA 2EIZA 5MERA 2BVPB 4F27A 3B7FA 4A2GA 1I8MB 2CIKA 3OAYH 3DX6A 5INDB 1YC7A 4WTWA 4L2LA 4A39A 4EMZA 3FL7A 2NR6D 3OGCA 4UQEA 5CZVL 3QQ3B 4BSJA 2XA8L 4HPYL 4XCYB 4XPAH 5F7FA 2BVOB 1HL5A 1J8HA 2GIYA 2XN2A 3CFVA 4N14A 1OD7A 4AUUA 5D6DC 1P84K 4X83A 1JGEA 4TUKL 4YHKH 4FLSA 2CNYA 1A64A 1XHMA 1FORH 3LVEA 1I1RA 3D39B 1YMMA 4ERZA 1RKRA 2AGLA 2WLMA 4Z7VF 3OAZK 4BA8A 4R4BB 3RJDA 3FUIA 3RURA 1IFGA 2E3VA 5FUOL 3TO4A 5A2JH 2VXSH 1EZVX 3S48A 5CCJA 4JM0A 5KVFE 5ICYB 3AM8C 5SX4H 2FWOB 3LKNA 3PUCA 4A11A 4I2XB 3RNQA 5C7XL 6PAZA 3U6XA 1AHWB 1WSST 3KLKA 4ZW7A 2BM3A 4DT2A 5SV3A 3RWHA 4TUKH 5IBTH 5DD0H 3X12A 4CC4A 2W9DL 4HV8B 4LSQH 1CYXA 2EDOA 1NA8A 1XSJA 3PXLA 1XF4A 4FQ2L 3DJ9A 4X6DB 3V4UH 5KVFL 3DI2B 2I0RA 2EDQA 4FULA 3EBHA 3VRJB 3W3BA 4HJJH 4J1UB 4M7LL 5TE7H 1ET5A 4ZX3A 5LKNA 5CGBA 4WK2A 3OKEB 4MJ6A 2J12B 3S3DB 4FA6A 4AN0A 1WBYB 3DV4B 4J6RL 1AIFA 4P04A 3UJIL 1KEML 1A1NB 1TFPA 2ZKYA 3NIFF 4HUUA 4KVCH 4XMLL 1S9VB 3RY5A 1T1WB 4MD4A 4L8SB 4AIXA 3RZCC 5GS1B 2OZ4A 3BAKA 3HAEA 4GIAA 3E3QC 1FZMA 1WF5A 3P3YA 2HX9A 1EHNA 2EXTA 1NIDA 1T1WA 4MD4B 3QDME 1B90A 2H41A 4HUCA 4AYID 3TN0B 2Z2NA 4H1LA 1KCWA 4E9YA 2NT0A 2UZYB 3IJ1A 5D7LB 4KU1A 4ZS7L 1MH5A 3P4MA 1IKFH 1OGAB 2VISA 4NNYB 3GFCA 2XV3A 4K3GA 1A2YA 2EDEA 4FF9A 5E6YA 5BMFH 2BCJB 1UURA 2AEQL 1M6UA 5D1ZA 4JB9H 4FL4B 4JFZL 4L1TA 3EIFA 3HE7D 1YG9A 2IQ9H 4OGZA 4RFOL 3CN4A 1FFNB 4ZW3A 2BIQA 3ARDD 3RB5A 4YHYC 1JF6A 5C09B 1NAKH 3CMGA 1O7SA 1FHNA 3W9EB 2IXQA 1ZAGA 3N44B 2VJ8A 1NM4A 1EBAA 2V8LA 1ILSA 1BECA 2VDLA 3I9GH 3BH4A 1L7TH 1M2VB 4G8GB 3SDCB 1OSZA 4JT5C 2QLYA 2HT2C 1DQLL 4AENB 4N2NA 4DSYA 2WOBA 2F2HA 4QAWA 5CGMA 2AABL 5AYTA 2PTUA 1W16A 3P4LA 3IJSB 1UZ8A 2FEDD 4FYRA 1RSYA 3TBSA 3ME0B 3ALPA 4FQLL 4L3EB 4H8WH 1AHWA 1BZ7A 2X9ZA 3T77B 1NWOA 1WFOA 4YHIA 5DJDA 2HT4D 1OHZA 1TENA 3D18B 4Y1SA 3MKQA 2RGSA 3NA9L 1E7UA 3D2UB 2ENQA 3PWPE 3O9WC 1OE2A 3RAJH 3WHE0 4DKAA 2LT9A 3KD4A 5E2TH 5TGBA 1FLRL 2BZCA 4KY1H 4NDMA 2OL3H 3NSXA 3KXFB 5I8EB 4P8QA 3R8QA 4YL4A 2H6NA 3ZMRA 1OMWB 5T1DH 5E08L 5JIKA 4I79A 1ZE3H 3IMWA 1G9EA 2X4NB 3O9WD 1LD9A 2EBSA 2QADD 4LL1A 3D1MC 1ZLUH 2YIHA 3B56A 1DBMH 3MRNB 2BIPA 2NNCA 3Q3GA 3S36X 3MC0A 4X6CE 5AAMA 4WWKD 4G71B 4G1MA 3CUPB 4P5MA 5FM4A 1M71B 3LH2L 3MLYH 3L9YA 5DVNA 3PDOB 1YYML 3QIBD 4PRID 2QADC 3MXXA 3DX7B 2LFGA 4NPYA 3DUHA 3HN5A 2BOLA 3LXAA 4XPBH 4ZSOB 4MA1C 4EI5B 2ENYA 4PGJA 3BT2L 4LARL 3RUGF 2GSIB 3INUH 1E65A 4WWID 1T20B 3I74A 5AW1B 1PI6A 2EILB 3UJTH 1VRSA 2F15A 3CZGA 2XKUA 2Q7YB 3ZL4L 4GGDA 1NEZA 3VFTA 4MCNA 4TUJA 4AKOA 4FX5A 2BERA 1N6EA 3ZKND 1GC1L 5GJSH 2B39A 4B9KC 3N44F 1BJ1H 2CE6A 2VZSA 4WTXA 4JN1L 4BHUA 1A12A 1D6EA 2Q5BA 3HG1B 2OX5B 1V7NH 4YX2H 1ORSB 3MPCA 3UTTD 3D39D 3OHXB 5CINL 2R69A 3QR2A 1SQ2N 1E4WH 4APQC 1RURL 2BNQE 5T1MA 2JVUA 3GI8L 3DTXA 2AV7A 3P3SA 5AVTB 3EOTH 4GI6A 5FYLL 4JFSA 4KKLD 3RVXC 3N9GL 4AJ0A 3D85D 2B59B 1HTYA 3LEXA 2HWZL 3BYTA 5D4HA 4L1DA 4WU7A 2EYSB 5FDWA 3PV6B 1SOXA 4H8WL 1F11A 4NO5A 5KVEL 3RVXD 1A4BA 4ZO7A 3O6KH 1Q72L 2PYED 3T08A 4MS8D 3IDIA 3VXTB 1N9PA 3GS7A 4FERA 5DFTA 1QPPA 2APXA 2BOCA 1FL3A 1RPUA 5L7XL 4NYLB 2BXYA 4AW4A 4MQ7A 4XWGH 4E5ZA 2FQGA 3CFEB 3ULVH 4KTYA 4NRXA 3E1ZA 2O72A 3IKOA 1FGVL 4MAYD 5E99L 4OFDA 3FFDA 4CC9A 3C87A 2CRYA 2H6OA 2A6DB 3G9AB 1KGWA 4KAQL 4RFEB 5I6PA 2YK1H 1TF4A 2WBJB 3NEXA 1JUFA 1FGVH 5E99H 5A3ID 2HH0H 1IGYB 4KI5F 4WLCA 5GRXG 2V2XA 2XWDA 2P5WE 2IDSA 4HJ1A 5E2TL 4BE6A 1TEYA 4P5KA 2KKQA 4PGBA 1VZGA 2ZONA 1ZLVH 1JGUH 1CXEA 5FYKD 3VXSE 3FDWA 1GGCL 5IT9g 3LZRA 4WEUD 2ICWA 3BZDA 2HYEA 4DP7X 32C2B 3SJVB 3T1WA 2C9UA 3VWKC 5HYQB 4L3CB 4XO3A 5DK3A 4ZSOA 5T1LA 1F58L 2UUDK 2OP4L 4X7SH 4L1MA 4UILH 3FB7B 2WLLB 1N3NB 4LPCA 4P99A 1HXMB 1OW0A 3NFPA 3V2AR 5IEKB 5HYQA 1BFOB 4BQ6A 4A7GA 5IQ7L 3ARFD 4I48B 4IRZH 4XMTA 1F4WH 1NKGA 3QQDA 2BHFA 1WQVT 3PWPB 3V5KB 2DM4A 2W8CA 1KIPA 3UCQA 1TETH 5LVEA 2EYRB 4LK4A 4X6FB 1WBXA 1OT1A 4L0ZA 4DP0X 3QJFB 1MFCH 3BLKA 4N8VB 2DBJA 1K8DB 3G6AB 3GIZL 3PJSA 5E1HB 4DETA 1BFTA 5CINH 4DVRH 2XL3A 3BWAB 4QO1B 1A6VL 1OEZW 2C3VA 4XR8C 3IURA 1AYRA 3MRHA 3NT0A 1WHOA 1GAFH 2AV7B 1UOKA 3DSNA 3KR3H 4A0BB 5CEZE 3JV4A 2J21A 2JJWA 2ZX6A 3UPAA 1FL6B 1O75A 2BY3A 3CVHA 2AC0A 1A22B 1ZT7A 4D0KA 2WCSA 4Y19E 5FKAA 4X99A 2FH6A 5FO7A 5DHVH 1N8ZA 2RIKA 3QWQB 1DJYA 3E8UL 3DXAD 3MRCA 3GXDA 4QHKI 3C5SA 2KQMA 2BWDA 4ZX5A 1PKOA 2FLBT 5FFLA 2BSDA 3NTCH 3H0TB 4Z3IA 3RPIB 1JZHA 2NR6A 3NVNA 5EU3A 4MAUL 2WYZA 3H2PA 3OKMB 4WI5A 3RBSA 1KN2L 3V0HA 4HZLB 2PNDA 3VWJD 2Y7QA 1RUPH 2BSBA 3DJTA 1EMTH 2EVIA 4TRPH 3BGFC 4UBDD 1Q9KB 4LCYB 1CICD 2XBTA 1DQMH 4TLTA 3WXVL 4NERA 4X5RA 2YNOA 2VXUH 4NBZB 4BH8A 2IV8A 2QGDA 3LZOA 2A6DA 4RFEA 3S0PA 5LXVA 1EEUA 2ZT9C 1I31A 5C8JB 3TA4D 5FWQA 5DQ9A 4APXA 3RDTB 1BGXL 1OE3A 4KFZC 4Q58C 3R18A 5KUMA 1IB5A 4E5XG 5I5IA 1NGPH 1YN7A 3U7YH 2DI8A 3P3UA 2YHGA 4DN3L 1KFGA 1ADQA 2ZD0A 4X80H 3K46A 1PBYA 3THML 3VACA 5MP6L 2OFQA 5I74B 3G7TA 3K5RA 2JCWA 1I1FA 4KJQD 2LVCA 4UMGA 3WTVA 4Z7UA 1VA9A 2P42B 4TVPD 3C8KA 3PP4L 1YUHB 2F5BH 1T5WB 5FW7A 5E2UL 4IKJA 2A83B 3Q2NA 2F8OA 2DQFB 2VDQH 4JRXE 5IROD 3VAEA 3SDXA 1A7RH 2N7AA 2UVEA 3V0IA 4HDIA 1FJ1B 1JDCA 1AZRA 3K6FA 3NCFB 4YHZL 5C9KA 2WQAA 4ZMAT 4NC4A 1JAEA 2GTZB 4BKTC 2GJ6B 2VXTH 4YNYA 4P48A 1BEYL 1MELA 4ONHB 5DFAA 3VI4F 2PCPA 3CDGB 2G75B 1LEKB 4GG6E 4LDCA 3TYFB 3NJMA 4AEHH 4NCDA 1TZGH 3DARA 3IWVA 3V0VB 1T5KA 5HVHB 1AGEA 4G6AC 3WFCH 5CYKA 3FUJA 3QC5X 4QXTA 1AH1A 1IC4H 4QF1A 1CLZH 3ZE0F 1C5CH 2RB8A 2XXMB 1PIGA 3QT2A 1JPGB 5CMAB 4U3CA 5FYKH 3BVVA 4ZS7H 3CG8A 3MOAH 4LU5L 4N0FB 3OJVC 5DD6B 2W0KA 2VL4A 2XY2A 5T5FL 2P7TB 3HUJF 4IYKA 2MCPH 1Q0XL 3O0RH 4XPFL 2CDEA 5JW5B 4NKDB 2X4RA 3WGUB 1LMIA 4KGLA 4M3KB 3O8XD 4RMUA 3RPKA 2YAMA 5IEHB 4J8BA 2X4UA 1NBVL 3G5WA 1JOIA 2WXQA 4XZ4A 3ULVD 5DLMH 4XHJC 3NJIA 3QNFA 4M3HA 1MCWM 2XZCH 3QG6B 5F9DC 5GS0H 3VD1A 3ETBF 5CJQL 3IAQA 5E6RB 1R3HB 4MXQC 2AQ1A 3E6HA 3FSZA 4XCFL 1JMZB 5I71B 4HXAL 4K4KA 2IAMB 4RIRA 4TULH 1YNLH 1GGBH 4W9GC 3OLIA 5IG7A 4B5EA 1OGAA 1JPEA 4N28A 1RY7B 3II3A 4MD0B 4NUJB 5EDXA 1A6WL 1XZWA 1UT9A 4JQIH 4PV1C 4ONFL 1NCGA 1PAMA 3QI0A 4F3FB 5F9WC 1D5XB 1ORQB 5DO2D 2KI6A 3KGUA 4C57C 2F6AA 1YPZE 2B3IA 4QXVA 3FKUS 4X0KA 4OLYL 4QRFA 5TE6L 5DD1H 5FB8B 3RVUD 5KANI 1I8IA 1VFOA 3UMNA 1YNTA 1I3GL 2DLFL 2A4CA 3PLYA 5C0BE 2ZSVB 1KXQA 1EDQA 3QZWB 1DVTA 3A67H 3PREA 4Y16B 4Z0XA 5INCB 4BFEA 2AQRA 4HZ1A 1MCOL 1GIGL 4JRYD 3RVVC 4AKQA 1G43A 5EV7A 3KWWB 3WLBB 5D1XA 4A55A 4HA1A 1HOEA 5ECJE 4Y8AA 1Z9LA 3T3MB 4ZFGL 4CU6A 5DC4B 3R1GL 5C08A 4JANA 2WBJD 5BRZE 1SXAA 3H7BB 2EUZA 4ABVA 1PU0A 5MENE 4L3HD 1L6ZA 43CAB 3RVVD 1SBBA 3LHPH 4PJAF 5IJ8E 5GS2H 5DVOA 1F4XH 2EEXA 3Q05A 5F3HA 5SWQA 2P52A 3IKCB 4FQLH 3VFRB 5I6NA 4UU9A 3AXLA 1KYFA 2EDKA 1BJ1J 3B2VL 5IMLB 3C2AL 2VUKA 1VENA 3HE6D 5FGBC 3K6SB 5KYUB 2X4TB 1GYWA 4C47A 4WJ5A 4DW2H 3DUUB 2LTQB 4OM1L 4U0RC 3IGAB 3N6YA 4KNUA 4XN4A 2VSDA 2E86A 4D9LH 3UKUC 3D6GA 4P2AA 1L7TL 2GNQA 1CFTB 3UTZA 2XZAH 8FABB 2BSSA 2IBGA 5GRUH 2YARA 1M71A 2BOBA 1KJ3H 1NCTA 1A9BA 1O9WA 3DX7A 4R2GC 1E4KC 5MHSD 2IPUK 4OF6A 3QG7L 2GT9B 4H8VA 1QLRB 4Q9RH 4Q97A 1FBIL 1XH2A 3KPTA 5D96B 1QATA 4IBTA 1NAML 3CBRA 3KYMB 2DQMA 5CN3A 1MCFA 3DHMA 2CIKB 3FH7A 3LKQA 1JWSA 3HG1D 1WZAA 3QORD 4RFNB 3ZUNC 1LK3L 1MAMH 2FJHA 5HBBA 2F74A 4F57L 1MNNA 4L1BA 3FUFA 2DQ6A 4OU3A 2PTTB 4O2FB 2XU9A 1NIAA 4Z7NE 3DDUA 4L1QD 3R8BB 2VDML 2Q2EB 4PJDB 4S1DC 4XNZC 4HH9A 4YDMA 4TPRL 3GMMA 1XF5A 3O3AB 4LMQI 1JIBA 4RGOL 5C07E 3PGCB 4ZAKB 3QGVA 3JWOH 1HYRC 3RGBA 4UBDC 5C09A 5MEND 4P2RA 1TJMA 3GMMB 3HC3H 5A2CA 5CJ5A 2F54E 2D0HA 4S1DD 5EC1B 5TDNA 3G5YA 5DUJA 4J23A 4OIBA 2W59A 5CGYC 4P2RB 3V0GA 2H13A 1KC5L 5IJVA 1XSKA 3PAVA 4EZLA 4JRYE 1OP3K 5CFHA 1WFMA 2G9HB 2R15A 3UIYA 3LPFA 4OKVA 5TK2A 5BVPH 2Z1KA 1CL7L 4XH2A 3U1PA 1TQWA 3BUBA 5JIPA 4JRXA 4LCWD 4ZOZA 3BISA 4P9MH 4Y4HA 1VPOL 3LS4H 1Y1DA 4NO0A 1J1XH 1QKZL 5CEYA 3TH2T 5IHLB 1DEEA 2B14A 4CMHC 5DJCA 4DVBB 4OGXH 1K4CB 5F72S 4Z3EA 4O58L 1NL0H 3CIQA 1ZV2A 3B1UA 4LGSB 5BV7H 4NYLA 5F89A 1EGJL 3NZ8A 1JXFA 2ADGA 4E68A 1KTBA 4MAYA 4OZFH 5F1NA 4OCLC 2AMGA 2HJKB 5EU7E 4HOZA 2APWA 3UKRC 5KYUA 3SQOH 4MA7L 5F2FA 4GSDH 4NJAL 1IT9H 2H3KA 3VXMD 1OHQA 3S96A 1CURA 4F2FA 4ZUTB 2AEWA 2ZNXA 3UAJA 4ETYA 1OSPH 2XQ0A 4GRWB 3OAUH 2NTFB 3X14A 4F93B 1LK2A 3F3HA 4LHJB 1NZRA 4PBDA 4OV5A 4PBYA 4RGND 3I02A 4WSJA 3VXQA 4PJ7E 2RAMA 3AGVA 3VG0H 2J7LA 1C16B 1RMFH 4OD2A 3VGBA 2YEZB 4TOYL 4Y19B 1EHLL 1FO0A 1ZDQA 3PPSA 5IJ7E 2WXNA 5CXCA 3MRMA 3QI9C 3LB6C 5FKPA 4Y88A 3WS3A 4JSNC 2BP8A 3MREA 2B7DT 1FCGA 4P46A 5GGTA 2ENJA 3BVWA 3S8WA 1HEJC 2MKWA 5EAMA 1FO0B 1H3WM 3UTSD 4TULL 2AQNA 3RU8L 4R7AB 4FNUA 5GS2D 3P4NB 4Y4HD 1ORSA 3C75H 1RZJL 2YPLD 5AOIA 2I9TA 5J3HD 5KWYC 4O2FA 3JZYA 4QRRD 2GB2A 2O5NA 2W5PA 3D25A 4LVNC 5EUOA 5GGSB 4DN4H 4ZMWA 1BF2A 2E9JA 2NXYB 1F45A 4QMEA 3VFNA 4ERSH 3GHEH 5IB5A 2I9TB 3PGCA 4ZAKA 5JLZB 1SUHA 3FCTB 1D5MB 2AHIA 2MCPL 3SE9L 3F7KA 4WIQA 4BK5A 5J3HC 1MRFH 1QD0A 2HCZX 3TA3B 4BK8A 2Q7NA 3FN0L 5GSRB 1CR9L 1BBJA 4I0CC 5FWRA 1FWXA 1Q9OB 2EAEA 1QBMH 4WO4A 5DZAA 3RX5A 5CD3B 2HJ4A 3EO1B 3POHA 4WKZB 4KZEL 4IM8A 2ZF9A 2EVFA 3PNRB 3BUYB 2K6ZA 1UEMA 2R23B 4B7LA 4DZBB 1KTLA 4J2XA 4KKZA 3V95A 4DAGL 4DPBX 4LCCC 5E9DB 4UT9A 1KXQE 4HIHB 2FYYB 1R19A 1Q9WB 2FJGB 5KBMA 5CSZB 3NZ8B 5B3JF 1JTPA 1BZEA 5HHPB 1DDHB 5E6UA 2AJUH 2OMTB 1J8HE 3I6KB 2V5YA 2QPSA 5AOJA 3SDYH 3BZ4A 1NIFA 12E8H 3P1VA 3UYRH 1J9QA 3QBTB 2YJLA 2CE9A 1R3JB 4MHHG 3S3SA 3DO7B 3KPSB 3ZDZA 1EJ6A 5LXGH 3MGTB 3S6CA 3O2WL 5FYJU 4HOXA 5KBNC 1ZHKA 4PGZA 2OR8A 1VKXA 3MLXH 4IRJC 1KG0A 4IOIA 3P0GB 1UOOA 1NQBA 3DBXA 4U6YA 1NAMA 3CQQA 4A08B 4XOCA 4GUPB 1S6NA 5K9OB 4RQQA 4FQXD 5AALA 2QR0B 4PFEA 2F9BT 1AQKH 5EN2B 2DTMH 2IOIA 4A66A 5IHUL 4JDEB 4U6VH 1PYWB 3PF2A 2YEVB 1BFVL 5H4ZA 3FU3A 1V3KA 3MA9L 2OQJB 5I1KH 5J13B 1EFXD 5D8JH 3RG1C 2GY7B 4LQFL 1CGTA 1YNKL 3B9KB 4YE4L 3DGCR 2R0WL 5FW8A 3SDAB 3H85A 1XH0A 2IPTL 4HWZB 2BW4A 4WFFD 5TH2B 4GBXA 4PJ7A 3PWPA 1XGRB 1EVTC 1EXGA 5FHAL 5FF6A 5LAPA 1MKFA 3SCMD 3VGFA 3IJ9A 2VTFA 4A2FA 3CZSA 3IDJB 4WVRA 4YPGB 3W37A 3TJPA 4A09A 3DRTA 3S8FB 4GKSA 1M56B 2H7WA 3QIWA 1A6UL 3MRGA 4L23A 1W0VB 2Y36L 3NK4A 1VFUA 2D7PA 3X1BA 4NZTL 2CSPA 2C3GA 3RGHA 1QMUA 4HXBH 1LGVA 5C0CA 1CXHA 1GCYA 1CLOL 4NI6A 2WMPA 1D6VH 4GKNA 3B5GA 4U49A 1HOCA 5C0RL 4HK0B 1IQWL 1X5LA 3APCA 3RIAK 4RWYH 1YEDB 2E9IA 4EBQH 3JUYA 1IC5L 1E5TA 3EI1A 1TDQA 1S5IH 5LGJB 5AZ2H 5CN1A 4GO6B 3VG9C 2D2OA 4F8TA 3OKMA 5E94B 2Q20A 1T89C 4UUJA 2PKDA 1J5OH 1L7IH 3KWXA 4APXB 1NEXB 2H68A 5CZVH 1HHKA 2RFXB 2CBPA 2IWKA 4KROD 2AERT 2IG2H 1UVQB 2VH5L 1BDYA 1YEGL 1XCXA 3F2LA 3MLSH 4MJIB 4FS0A 5EORH 4K71B 1KBKA 2AEOA 5F71A 1E40A 4MA7H 3VRIA 2FRGP 3GM0A 5FGCB 4R4FL 1ONQB 2YKKA 3NFNB 3VSTA 3WGVB 3ZMNA 3W5NA 4J12A 3MLWH 4WI4A 3ZK0A 4ENZA 1JNNH 2VLKA 2XPZA 3BVXA 3I9IA 4MJJA 4QY8B 2C3WA 4JY6B 4PJGF 2HRPL 5AKRA 5TF1H 3SDXB 1PLAA 3U7WL 3TEWA 2ZP8A 2A4EA 4QRPA 4HJSA 3THMH 4JRLA 3S34H 1SM3H 1KLGA 1O5DT 1ZA3B 2JF1A 4P9ML 5EOCJ 1GGUA 1HNGA 1RUQH 3SCMB 3UBXB 3KBFA 3W82A 1KLGB 2JJSC 4JZNB 3NSFA 5DMGC 2YQBA 4PBXA 1CDUA 4EKXA 1WBXB 6TAAA 2EUXA 1YEIH 2Z93A 5FCSH 5E6SA 1DTUA 4CGUB 2XFGB 5EO1A 3D3VD 3VGAC 3NRFA 2YXVA 3VFSA 2H0JA 2XE4A 3BH8A 3T0ED 5DHVB 3VD3A 2Y2WA 4BELD 1KTKE 3ARBB 5DJXA 2C9QA 4G82A 3BJ91 2BVTA 3IGFA 5FX3A 1D2OA 3GPEA 4HWNA 5LAXA 4FQXB 1YY8B 4PV8B 4WTZG 5TE4L 1NEPA 1KY7A 3ARYA 2E7MA 3LRLA 4D7PA 4M5YH 1D5BA 2GK2A 4GFTB 4RRPA 4DQOH 1WIUA 4XVSH 3IVMA 3T0EC 1TTCA 1BSIA 3DA0A 1AS7A 5SWQB 4NKOB 1S9YB 5ID1B 4HULB 1HZHL 5LGYA 1B0IA 3WG7B 2HKHH 4AUYA 2J3SA 3ZHDA 4HMDA 4N2OA 3VX1A 5JUEH 4I5BB 5ID1A 1N8OE 5AJAA 2WLNA 3FONB 3L45A 3ZLQC 7FABL 5JHDE 4JO1H 4KTEH 3N43B 4HKZA 5DS8B 4J78A 1GC1C 4C58B 3MXVL 5TFSL 3B8SA 3C5MA 1HDMA 1TLKA 1IGCL 3LN5B 4LLVB 1AY1H 1E43A 2P49B 1XB6A 5E8NB 5GGVL 2HKRA 1B6DA 3QPQD 4KUZH 4KXCA 5JMOC 3QCTH 4XI5D 3AG2B 1UD6A 5IW6B 2Y4SA 4AEFA 3AGWA 2R2EB 3B9EA 4Y2DC 3WENA 1NCCL 1IGMH 2OSLA 3MRLA 1F4WL 4JHBA 3KLAB 1P5VB 5GRVL 4N9OB 3M1OA 2P9NC 3X17A 4Z7QB 3HHMA 4H1LG 3FCSA 2IDTA 4TSCL 3TV3L 1H6FA 2DIAA 4J3OC 1IBBA 4LPXA 3RY6A 2XNAB 3C6EA 3QWOA 4P9HC 1T83A 1CWVA 1ZXKA 5G4OA 4L8DB 2P46B 5JNYA 3F65A 5HHXH 3DLQR 4PI2A 2BLFA 4XCCL 2NDFA 2OXGA 2NY3D 5DJYB 4C8XA 3B3BA 4NQCD 4DNLA 3PU7A 4XBPB 3MMEA 4OZHA 3WO4C 3A0FA 3O2VH 2A83A 4I89A 1CO1A 4XB8A 3T65A 4Q56A 2GY5A 4HXBL 1F5WA 4GPVA 3JTTB 3N1PC 2YK1L 2IQAA 2NXYD 4G6KL 3SE8L 4PJHE 3QRGH 4XC1L 3OR6B 1E8NA 2PM9B 1FO0H 1QSEE 1IRAY 4JANB 1KJVB 3EGXB 3QULA 2Y3NA 1MY5A 3O0LA 2VWEC 2LVEA 3T0EA 4W4OC 1B0RB 3L48A 1TSRA 1H3UA 2RA1A 4H2AA 4XNUH 3TCXA 4RAVA 2DD8H 4KRLB 4UNIA 4PJFE 1MLCB 3HG2A 4BEIA 3UR4A 4R97B 3ZQWA 3RA7H 2Z31D 1G0XA 3KPQB 2V33A 4V2BA 3W57A 3S88H 4LEOA 2WO3B 1DUZB 5I8OL 4HCRH 4G1EA 2MNWA 3B34A 3PV7A 5CGTA 5HDWA 2E7CA 1ZT1B 4Y2LA 3CXFA 4HC1L 4TV3A 1FUNA 4QKXB 1YQ2A 3UPRB 1P6AB 2WUCH 3NZHH 3ZE0E 4FQCH 4BFGA 2OVQB 1SYVB 4NPJA 5D93B 4OZGA 4E42B 1NPJA 4ODUA 1CU4L 2HLEB 3LKRA 4E54B 4NQEA 3E3QE 4HIIB 4MNGA 1BAWA 1I9IH 2VDKB 3CD4A 4UINL 4YDKL 5HY9B 5FLXg 5HYSG 3ZTNL 3QYNA 3DROB 3CVIH 1OK8A 3CQFA 2WOYA 5EO9B 4WSGA 3JT0A 4O1QD 4HS8L 3SJLD 2CBTA 3SCMC 4AEEA 25C8H 5L4JA 2H32B 1ZHNB 2OTWB 1JPTH 1QLEB 4K7PX 1JMZA 1Q1JH 1IT9L 5CR1A 3AT8A 5HGDB 3DURA 3O6FC 1IBYA 1VEMA 2JKXA 4UT7H 4ODHL 5AKVA 3GO1H 5DUMH 3SDDB 4RLDA 3O3EB 2DQTL 2EIEA 4LCWB 2Y36H 3MOAL 2FBRA 1AQDA 3EYSL 5GS0C 2GAZA 3KPNA 4UQAA 3IS0X 4RZKA 2YGPA 3TPUA 1U8NB 3K81A 4L4VB 2DEWX 2XWRA 3L9EA 4LPUA 4P2RD 1DN0A 1YEHL 1BZOA 5F6HJ 2IALB 2XQYG 4FLHA 4YDJB 3EJCA 1S7SA 3D25B 5EUOB 3LCYA 4DGIH 4AQ8C 3KVDD 4FXKC 3JBG7 2HUHA 3UADA 4W1TA 4LZKA 1UWEH 3N5AA 3I75A 1O9VA 3O4LE 3IVKB 4YN3A 4E0RA 1YMMB 3REWA 3OF7A 2P24A 3QR0A 2L8AA 3I7LA 3T2PA 3V6FB 2YGNA 3VFVA 2CKBH 5BZWA 1ASOA 4PRNA 3QDJA 1MCEA 3EH4B 3D4GA 1MFEH 2EDWA 1GHFL 4IBYA 3VFWA 1UKTA 4AENA 4MB3A 3UVOA 3UTSA 1C08B 3M8OL 1E30A 2VDRL 3HPJB 2ITEA 4GSUA 3C75A 1QBAA 2CGRL 5C0GB 3STLB 1GZHC 1UUNA 5CO1A 4OCXH 3JZHA 4HWBL 3Q13A 4RMSA 1YJDL 5E70A 3BKMH 3VCLB 4A04A 4NDMB 2OULB 5F1NB 5C0DA 1FQ9C 5IREA 3VE0B 4Z77B 5SXMA 3GO1L 1JTTA 1E28A 5DUML 2Y7LA 3I2CH 3S7GA 1DBJH 2XYCA 4KK9D 1SEBB 4NQXA 1C5BH 1CZ8H 3MRNA 1P7BA 3T4YA 3BPNB 3RI5F 4Q6YA 4ADIA 1HYSC 3MBEC 1FL5A 3PWVB 5BZZA 3SPCA 4F92B 1ZKAA 4NRYB 4H13C 2XVGA 4EE2A 2XVLA 1YPZB 5DC9B 3TO4C 3KPOA 4U1SB 2E5EA 4MZRA 4HUUB 3S5ZA 5K19A 3TU6A 2WIIB 3ERXA 5HYNB 3AADB 4M1DL 4N0UB 2WNWA 1U3HA