1FWXA

Crystal structure of nitrous oxide reductase from p. denitrificans
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
591
structure length
591
Chain Sequence
ADGSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESVRIHERTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMKCDAILEIPNAKGIHGLRPQKWPRSNYVFCNGEDETPLVNDGTNMEDVANYVNVFTAVDADKWEVAWQVLVSGNLDNCDADYEGKWAFSTSYNSEKGMTLPEMTAAEMDHIVVFNIAEIEKAIAAGDYQELNGVKVVDGRKEASSLFTRYIPIANNPHGCNMAPDKKHLCVAGKLSPTVTVLDVTRFDAVFYENADPRSAVVAEPELGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIEDAIRAYAGEKVDPIKDKLDVHYQPGHLKTVMGETLDATNDWLVCLSKFSKDRFLNVGPLKPENDQLIDISGDKMVLVHDGPTFAEPHDAIAVHPSILSDIKSVWDRNDPMWAETRAQAEADGVDIDNWTEEVIRDGNKVRVYMSSVAPSFSIESFTVKEGDEVTVIVTNLDEIDDLTHGFTMGNYGVAMEIGPQMTSSVTFVAANPGVYWYYCQWFCHALHMEMRGRMLVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROUS OXIDE REDUCTASE
publication title Revisiting the Catalytic CuZ Cluster of Nitrous Oxide (N2O) Reductase. Evidence of a Bridging Inorganic Sulfur
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 185
structure length 591
sequence length 591
chains with identical sequence B, C, D
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2000-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13473 Cupredoxin_1 Cupredoxin-like domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1fwxA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1fwxA01
1PZCA 3MBWB 3PLYA 2PM9B 2IDQA 3CVDA 3NP4A 2IUQA 4A2MA 4FA4D 3FSAA 1FWXA 1MG3C 2VSMB 2H5UA 3UAAA 1AR1B 5CXBB 3L4OD 5SXMA 2HRHA 2H9MA 3FYEB 3RLMD 1PCSA 4R7AB 2IDTA 3F3PA 4E9WA 4PNKB 3FQYA 3DSMA 3ERXA 3FU7A 2HX7A 4UAHA 3EH5B 3AG1B 3NSCA 4AI7A 2P9KC 2DYSB 3WNJA 3T9WA 1OMWB 3DWLC 1BQ5A 4GZ8A 2QPEB 4OWRA 1B3IA 5LDUA 5B1KA 1NPNA 5I6OA 1JZFA 2YNOA 3FSZA 3FYIB 9PCYA 2PPDA 2I0RA 3T6VA 3AH8B 5FC9A 4FWWA 1GSKA 2UXTA 2WO3B 2H68A 4N14A 1N6FA 3W15A 1NWPA 2XYIA 3H4HA 4AKQA 3X1EA 2UZYB 3VGZA 3ASNB 4CI2A 4NERA 2JXMA 2P9NC 3T6XA 3EU7A 3GXUB 1AZUA 2UX6A 1GY1A 3CZUB 1SDDA 3GDCA 3ABKB 4G7RB 4GXFA 4KO7A 5PAZA 2BP8B 1KDIA 2HX8A 3IJ1A 2VM4A 4L1QD 2VW6A 5GXIA 4U1EI 1MG2C 2WSDA 4K9JA 1CYXA 1ET8A 2AGLA 2IURA 2P9PC 3UVKA 4X63B 5A2Qg 5K19A 3NJGA 1PAZA 3NJLA 5IGOA 3J80g 1ASOA 1BXAA 5TEEA 1AZCA 3X1GA 1B9XA 3DIVA 4K3JB 4A11A 3EI3A 1GXRA 3IIYA 4DPAX 4YSRA 1AQ8A 4YSOA 1PZAA 3IJ0A 4ERZA 3SWSD 3SVWD 4A2EA 1E67A 1YLBB 3PAVA 4AX3A 2HKRA 3L4MD 4ERYA 4E54B 5IY5B 4O45A 1TEGA 2MTAH 5C9ZB 5EHFA 4F2EA 5I28A 1E5ZA 5HE2B 2BW4A 2PPAA 2CALA 4L9OA 2TSAA 2I85A 3SXTD 1A0RB 4BWTA 2HXAA 3L45A 3JZNA 4G56B 3ULEC 2AGZA 3V5WB 1L9TA 5A7EA 4ENZA 2GC7A 1AS6A 4PBZA 4KO6A 2O9KA 2P80A 2R7EA 2CE8A 5JWZA 1DZ0A 3JT2A 4YSAA 4U7AA 1IKOP 3ASOB 4ES0A 5CYKA 3QJRB 1JERA 3TBBA 3E0CA 5EAPA 1GP2B 3S3DB 2J57G 2QXVA 3NVNA 4W9ZA 3OTTA 3IEAA 4G70B 3SN6B 4XYIA 4BWWA 2PLTA 2HXCA 3S8GB 1XMEB 2FJSA 4DP4X 2YBAA 2Z2NA 2AVFA 3PCYA 2NRDA 2Q9OA 5FKSA 3JAMg 4A2FA 3NJKA 3QJSB 5F7AA 4A68A 3N55A 4ZK8A 5D4IA 1PEVA 5B1BB 4PC0A 1P22A 2HLEB 4L3GD 4ZOVA 1SHXA 1OCCB 1SFDA 1NINA 5CXCB 1K32A 4BWUA 7PCYA 2XU7A 2VM3A 4E5ZB 2OCCB 4YSEA 3JZHA 4CY1A 2H9PA 4EWRA 2XWZA 5FQDA 2AGYA 4J8GA 1SF3A 4DP0X 4QL1A 1GYCA 5H17A 3ORVD 1J9RA 1NDTA 1X9RA 4L0PB 1TKWA 4X61B 2AH0A 1N70A 4CY2A 2OVRB 2B5MA 2FTAA 1W8EA 1M57B 2UX7A 3FU8A 2AH1A 4GYBA 1XB3A 5B1JA 3UGEA 4Z8LA 3EH3B 4GP8B 2VSKB 3V9CA 4E9TA 1TBGA 2B5LA 1NZRA 2CE9A 2XX1A 3FS9A 4BDVA 4QLWA 1TYQC 5EMKB 5TEFA 1KCWA 2YXWA 2CBPA 2CCWA 4FB1D 2OVPB 3DXMC 1E5YA 2BP0B 3GYRA 4BXVA 2AZAA 3MX0B 1ZDSA 3U25A 1B9YA 1JMZB 3CVCA 5IJ7E 3FU9A 3AG4B 1MDAH 3OL2B 1SNRA 2IWKA 3RN1D 3PXTD 2YAOA 4N8UA 2P9SC 2GI0A 5AKRA 4J78A 3RRMC 4Y7RA 3GFCA 2OJ1A 1RKRA 1BYPA 4GGAA 2XL3A 5EM2B 4HDJA 3NJFA 5FLXg 2DWSA 2H6KA 2Y1AA 5GXHA 3FSVA 3OQRA 1AOZA 3MKQA 4TZ4A 4GQ2P 4MFHA 2B08A 5H1MA 3EI1A 2MRYA 2XL2A 4J81A 5FKRA 1JZHA 1JOIA 4YVDA 3MMYA 1GS7A 4G7SB 4DP6X 4QT8A 4NAJA 3NSYA 1HAWA 1I53A 3ZDWA 4A0AA 4I79A 4IA9A 4NB7A 3OMAB 2FQEA 4DP2X 2UZXB 6PAZA 5HYNB 2XV2A 4UI9R 4AZUA 4A2HA 5B4WA 5C2WB 3BQVA 3ODTA 3SCYA 3S3CB 2YAMA 3VH0A 5I6KA 2XXFA 1PLAA 4DP5X 3QQXA 1PNDA 4HHGA 2CN3A 5ANHA 2UXVA 2GC4A 1GW0A 1XB6A 1AZNA 3JROA 4JXMA 3UVNA 4BL0A 3UVLA 2IUPA 4GP5B 3AY2A 1W6LA 2H14A 1IUZA 4FAVD 3V9EA 2CUAA 1KCBA 4JHUA 4CSZA 4JHVA 4MK0B 5IT9g 4X60B 2BW5A 4HAKA 3X1NA 3WKQA 2CO0C 1JZEA 3WI9A 3JB9L 3CDZB 1WA0X 2PBIB 4A09B 1OF0A 3TU6A 2IUVA 3G5WA 5AZUA 2H3XA 4A0BA 3DM0A 3QJVB 4YSCA 3I7HA 3TBCA 3OKYB 2YXVA 2DY2A 3EI2A 1NTDA 3QJQB 2XYBA 4AKOA 2PM9A 4J77A 5B7EA 4BH6A 1AAJA 3S3BB 2J56H 5CXBA 2PCFA 3NYKA 1A65A 1WS8A 3KW7A 3JRPA 1L9PA 3IE9A 3EI3B 5HE3B 1IBYA 3QPKA 4DPBX 3VA6A 2YQBA 1ILSA 1MG3A 4GGCA 1W6WA 4YSPA 2B4EA 2P9LC 5TDHB 2I3SA 4ZOYA 2HJ4A 3AFCA 5I6PA 4A66A 1UATA 3OKTA 4KO9A 1NIAA 2E86A 3C9CA 4O1QD 2BZCA 2EBSA 1NIDA 3F3FA 5C2VB 4KNUA 4LG9A 1NWOA 1ASPA 4CSPA 1PBYB 1XIPA 1L9OA 3EWEA 5B7FA 4G7QB 3PXWD 3IN2A 1ZIBA 4HCFA 3HEIB 1URIA 3IIWA 4DP9X 2Q7QA 4ZN4A 2OK6A 2P80D 1HFUA 5EALA 3ZWLB 4E5ZA 3CVBA 2A3TA 1BYOA 3HFQA 2BP8A 4YL4A 1GS8A 3IJCA 3UVOA 5E9NA 1PLBA 1NEXB 1QNIA 4D0KA 2W18A 3I8EA 4A08B 3CG8A 3PAUA 2Q5BA 2PPCA 3WG7B 2X88A 2XUWA 3V7DB 4CZYA 4X4KA 1JXDA 1VLXA 3UAEA 1AANA 1XKSA 3C75H 1MG2A 2MTAA 3UKUC 2IAAC 2FT6A 3EF4A 1AS8A 4YVNA 3BG0A 5AMSA 3FQ1A 3T71A 1ZV2A 4E9SA 2HESX 1JVOA 4M4RB 4E9YA 4E54A 5FKTA 1L9RA 2CJ3A 2H47C 4PCYA 2HJBA 2OIZA 5EMMB 4E9RA 1JMXB 5FA5B 1OE2A 3BVDB 1N6EA 2EINB 1E65A 3WIAA 1T5KA 4AOWA 1BQRA 3NSDA 4HCIA 1AS7A 3NP3A 3N0EA 3S8FB 4YVUA 2FT8A 3NVXA 5FKQA 2Y69B 4CC9A 2GBAA 1GS6X 3EI4B 5HQGA 2B3IA 4FA9D 4K3ID 3H56A 4H5IA 3C75A 3UABA 3U4YA 1WS7A 2G99A 5AFAA 2QT6A 3K27A 3RSEC 2FWLB 3FPXA 3KRWB 1GOTB 1ZPUA 3FM0A 2XV0A 1E30A 1QHQA 2X87A 1JXFA 4HHWA 4FA7B 4GM8A 4CZXA 3JZGA 3NJNA 1R5MA 2OJYA 4JSPC 3EH4B 2XV3A 3T6ZA 3RFHA 2HX9A 1DYZA 5TK4A 3I7PA 1SJMA 3WKPA 1OCOB 3AL8B 2I7OA 2YAEA 2VW4A 5I6LA 1V10A 1ZIAA 3K26A 5IJ8E 2XXGA 5CXCA 1IBZA 1PZBA 1N6DA 3IBOA 4PAZA 1Q47A 1YFQA 1ZDQA 4HCGA 1J9SA 2GHZA 2ZWNA 3X2QB 4FA5D 2AGXA 2HYEA 3ABGA 1OCRB 3UKRC 1SF5A 2OV0A 3AG2B 4KO5A 4AKPA 4GQBB 3RFGA 2XU9A 2CNXA 3CFSB 2CN2A 5B7MA 4YSQA 3UADA 3DTUB 4A2DA 2J57A 3P4FA 3BWSA 3SFZA 1TU2A 3A0FA 2HRGA 4J79A 4O3TB 3MXXA 3FU7B 3WNIA 4J87A 5TF2A 4DPCX 1MDAA 4KNTA 3V9FA 2W88A 2BWIA 4O9DA 3EHBB 1AG6A 5I5MA 3T6WA 3OL2A 4CI1A 3FGBA 2GB2A 1OE1A 1CURA 3JPXA 4FHLA 1PF3A 3DKHA 2GNQA 1PMYA 2I7SA 2QDVA 1WAEA 1L9QA 1NIEA 2EILB 3OMNB 2BZ7A 3QJUB 4WTQA 4LGNA 3RMZD 5AFU3 3OMIB 8PAZA 4W1TA 4GP4B 1ID2A 4J0WA 2XX0A 4YSUA 3J81g 3KW8A 2EIKB 1OE3A 2YMUA 1SDDB 2YNNA 2HKMA 4YSSA 5EMLB 4FAND 5KDOB 1NIBA 4ZOXA 5I6MA 2BBKH 5D4HA 1J5DA 5PCYA 1JJUB 4JD2C 2PPFA 3CFVA 1RCYA 3ZX1A 2AANA 5D4JA 1U4CA 1ASQA 3GREA 5AJAA 2QPDB 2H9NA 1AIZA 1JOFA 1MZZA 4A11B 4AEZA 3ZIYA 4G72B 2EIJB 3SLED 2OK4A 4BK5C 1VYHC 1OV8A 2YAPA 5K1CC 5IC7A 2Z2OA 5THAA 3FRXA 1CC3A 2YB8B 4J8BA 2XLLA 4E9VA 3C99A 2GC7C 1MZYA 2BCJB 3BG1A 4JT6C 4JSVC 2H9LA 1SQ9A 4FA1D 1R1CA 3HB3B 3PAZA 2P9IC 1F56A 5EARA 4DP7X 1BAWA 3NVQA 4PXWA 3CIKB 3RN0D 2AGWA 1BEXA 3AL9A 2PCYA 4A7JA 1BXVA 3CDZA 1TEFA 1KYAA 1PI6A 1AZBA 1FA4A 2R7EB 3MZKA 3UVMA 4A09A 4HZ1A 2QDWA 5GSAA 2J56A 4CI3A 1A8ZA 2N0MA 1GG2B 3OKYA 5CYKB 3NT0A 1OLZA 3FSWA 5HE1B 1XHMA 2CO0A 1A3ZA 4KOCA 1ILUA 2GIMA 4J84A 3FT0A 4HALA 4UF7C 4KFMB 1L9SA 4KNSA 3EMHA 3I7KA 1JVLA 3JTBA 2FT7A 1KV7A 2IDUA 4JKNA 4KOBA 4P5SA 4GQ1A 2CAKA 1U2VC 1HAUA 2PPEA 4A67A 4PBYA 3NJMA 1RZQA 2IDSA 1NR0A 2I3TA 1AACA 4J82A 4DP1X 1RZPA 2DYRB 2GSMB 4E9QA 2OVQB 5HE0B 2AQ5A 4BUJC 3ABMB 1SFHA 4CY3A 4CZVA 1X9UA 3PXLA 3MKSB 1KDJA 4J86A 3AG3B 4IMMA 4LG8A 2AFNA 4L3HD 1PGUA 5GMKn 1AZRA 4GY4A 5I26A 4WKXA 2BWDA 3X1FA 1SQJA 1QLEB 4ERQA 1SHWA 5B1JC 4H5JA 1A4AA 2IWEA 2YNPA 3KRXB 4YSDA 4CI8A 3FPYA 1JZJA 2UXFA 2B5NA 1PNCA 1WA1X 2FQGA 3SQRA 1PY0A 3X1BA 4ESGA 1BXUA 1GR7A 1K8KC 3I8CA 2IWFA 3PE7A 1ETJA 4GMBA 2PP9A 4Q8BA 4J73A 4J0XA 4BDVB 2XVBA 4P5RA 1RI6A 3EI2B 2LLNA 3AW5A 4NSXA 3SJLD 1V54B 2FQDA 1AG0A 1JZGA 1ERJA 4A08A 2IH9A 2J5WA 3OD3A 2Z2PA 3IKOA 2H6NA 3PSLA 3SBPA 2J55H 3SMRA 3SHFA 3F3GA 5IGQA 5H14A 3ABLB 1OCZB 4YSTA 3TA4D 3OM3B 5B3SB 2H13A 3C5MA 3N0DA 3NJHA 2YAHA 5B1AB 2YARA 1JXGA 4E9XA 3NSFA 3I7NA 4GGDA 4JSNC 2VN3A 4A2GA 4JT5C 1N68A 1CUOA 1ET5A 2H6QA 2YAQA 3DXKC 5TK2A 2PP8A 1BQKA 1ET7A 1NICA 2IAAA 4XYHA 1KBVA 4QKTA 2IDFA 2I0TA 3H4FA 4ZOZA 2P9UC 3EI1B 3I89A 2RACA 4Q89A 3UACA 4RH4A 6PCYA 2PM7B 3EG6A 4OZUA 3PVUB 1CYWA 4A2LA 4N4YB 1M9WA 2ZONA 2H47A 2BO0A 4G71B 2UXGA 2TSBA 5I6NA 4QQEA 1KBWA 5FXYA 2J55A 4CY5A 4A0AB 3EI4A 3PPSA 2PM6B 4F2FA 1WA2X 1FFTB 2JKWA 2FNWA 1L0QA 4Y5RD 2GC4C 1KGYE 3UR4A 1NIFA 2JFCA 1OOWA 3AZUA 1JZIA 7PAZA 4TXVB 2G9AA 3I7OA 5F7BA 3PXSD 1A4BA 2ZOOA 2VMJA 4D6VA 3FQ2A 3N2JA 3I2NA 5I5JA 2EIMB 4FAAB 3IN0A 2FQFA 1J9TA 4BXSV 1S4UX 2DV6A 3D12B 4HIPA 3TASA 2BHFA 2I0SA 3MZLA 3OKWA 3PSCB 4PSXB 2BP0A 1NPJA 2IH8A 1SHYB 2H3XC 2ZXWB 1A4CA 2VW7A 3ZBMA 3I7LA 5EM2A 1IC0A 4DP8X 3AL8A 3QJTB 2WO2B 3RYMA 3SBRA 1EHKB 2DWTA 4XEIC 3NJJA 4F7KA 4GM9A 5EAMA 3B7FA 1J9QA 1GY2A 5EMJB 3NJIA 2YAFA 4M3HA 1PLCA 2HZHA 4QRJA 3SBQA 2AZUA 1ADWA 1EZLA 4GM3A 1M56B 1J5CA 1XB8A 2TRCB 2W8CA 3OW8A 3PVWB 4O3UB 4A0BB 4EF3A 4JSXC 5I5IA 4PSWB 4UANA 4X3EA 2PP7A 1V55B 2QC5A
chains in the Genus database with same CATH superfamily
1QFHA 1LJMA 2HJKB 1EFXD 1MY7A 3MBWB 3ZKQD 4ZS6C 2HT2C 4XTRC 4HUXA 2H5UA 2FH8A 2PCFB 2QV2A 3QUXC 3QJXA 4MA1C 4AUJA 1EA9C 4E9WA 3L54A 4FFWC 4YL9A 1JHLL 2WKOA 3VXRE 4FKEA 4Z7NF 3VCLA 4PJCE 2D0GA 3S2CA 1PYWA 3T3PA 1KENL 3DA0A 4X0KB 2DYPA 4JPIA 2A83B 4U1NB 2ED7A 5KW9H 1IX2A 1D6VH 1T7ZA 2XPGA 3NA9H 4U0RC 4Z7OA 4XTRD 4HISA 5FECA 2ICWA 1BLIA 1D5ZA 2WNWA 3HS8A 5EA0L 1UA6H 2DD8L 3ZDZA 3QCUL 3EH2A 5I6XC 4KI5F 4YEFA 2LFGA 4KITB 1X5LA 5D96B 1FE8L 3ASNB 4GEIA 4XRCA 2XY1A 5LBSL 1IBBA 3I85A 3LH2L 3MOQA 5IEHB 4A7SA 1X4XA 3TV3H 1MFAL 1QNZH 2PO6C 3ABKB 3BYTA 5C0CE 2CJUH 3A4FA 3V6FB 2DJUA 3GBLA 5K19A 3QUMB 1E4XH 3I6KA 1UZGA 5GRWA 2GJRA 1B9XA 2WWNA 5BUPA 1G9ML 3TPUA 4UQAA 2PO6D 3BAJA 1OIOA 5FM5M 3P3UA 2EDFA 2FJHB 5E8OA 4XMXA 3BRGC 2ZUTA 2V37A 1AGFB 1FFRA 1SMDA 4P57A 4UQ3A 1YEWA 3BRFA 4L8SB 1UOKA 1P1ZB 3W5NA 1YDPA 1DZ0A 2LW3A 5C0BE 1ES0A 2XIBA 1K8DA 4YLQT 1HDMB 4H1LB 3GFUA 4IBWA 3S3DB 4HFWA 2QXVA 3V0VA 4Q0XH 4EUPB 1E6OL 4YDNA 4BBWA 4CU8A 1KF9B 4JVUA 1G0XA 3GSUA 3KPNB 4ONGL 3QUKA 4QXVA 3TWCH 1RK7A 3JSSA 4R90H 3SGJC 3VFGH 2KDGA 4UTBL 4D9QD 4ZK8A 4PC0A 3FQWA 4HXAH 3C09C 3EG9B 4GPVA 1OCCB 4NSKB 3O8XD 1K32A 3HZ3A 4NNXA 2BP3A 4DKFH 1D5RA 3JZHA 4CY1A 5D7IE 2XWZA 4LB8A 3U4AA 5I2IA 1ZS2A 3KYOB 4RAUA 3KXFB 3BJLA 5GS3A 3EJTA 4K3JL 4Y9BA 1ORQA 3VRLE 2ESVB 3B3IB 2LU4A 2JH2A 3G5YB 5HJ3B 5TDNB 2BCKA 1XGTA 4FQQB 3OLGA 2EYSB 4RRPM 1VADA 3SY6A 2OM5A 2ARJB 3FS9A 2ISDA 4BDVA 4AC4A 1NAMA 5DO2D 2VUOA 1KENH 4WIQA 3SD2A 1CD1B 1QRNB 5ALCL 2BP0B 3QZWG 2B5IB 1IE5A 2EIZB 4Y5VB 3ESNA 1I1YA 4LLMA 3SPCA 1TQWA 5HTSA 1RZFL 1KG0B 2DD8H 2KLTA 3ES6B 3QCUH 4PJAF 4BINA 4F7PA 4QRAA 3BIKB 3D2UA 1GZQB 4LP4A 5HYQB 4Y7RA 4AMYA 1OTUD 1UXSA 3W9DB 4U05A 4ESKA 4LSUL 4PHXA 5LBSH 2VISB 3LH2H 5B38B 3I6LE 1DFBL 4YGVB 4R2GB 1MFAH 3AQXA 1CLYL 4KBPA 1SXSA 5EZOL 5L4FA 5ACMA 4YBLB 1JZHA 1ZSDB 3APDA 3FBKA 3US9A 3BESR 1S7RA 1CE6B 2JI3A 2Z91B 1UYWL 1IL1A 1JD9A 2WQUA 4AENB 4XWOC 1U8JA 3EJPA 4XPHL 1G9MH 5CD3B 4DEPC 5A7BA 3SGDI 1BZEA 4B95C 3QDGA 2VDKL 3ZQWA 1KNOB 1AIFB 1MCOL 1KBBA 1XF5B 2WP3T 3GEWB 3WGUB 2IUPA 3KM1A 4N2AA 1WIOA 2EDNA 4XWOD 2EH8L 5D7LA 3QUZA 1G7JB 3BH9A 3OF7A 1S9VB 2B14A 2HVBA 3I7HA 3OKYB 3JWNE 5ISZB 2WWOA 2FWOA 3N6YA 3QEUB 1CYGA 4MNGA 5D1XB 1E6OH 2GJPA 5DQJB 1MVUB 1P7HL 1DBKL 2J3SA 4ONGH 5E94B 3LEXB 2V7HB 1R19A 1WYJA 2WTRA 4KJWD 4HSQA 5E8EA 1JE6A 5C08A 1VKXA 1BA9A 1UGKA 2VXQA 1FYTD 2IAMA 5HYEA 5HE3B 4UTBH 4IJ3C 1EXUB 3FFCD 4K3EL 3MV7D 1ILSA 3ZKMD 1W2KT 2UY6A 1NMCB 2YUXA 4QMEA 1QI5A 2R9HC 1BMWA 3F6LA 3VXNB 4FD0A 4K3JH 2DI7A 4Q56A 3QJFA 1XIPA 3B2MA 3ARSA 43C9A 2R8SL 4UUJA 3TV8A 4H26B 2P44B 3QORA 2YQ2A 5EB9A 1SYVB 4ANXA 4GOSA 1C7TA 4RNRB 2WLLA 2NR6A 4TQEL 1VFMA 1MCCA 1OZUA 5ALCH 4ELKB 3I8EA 3EFFB 3TEYA 1XZ0B 2J8UA 1IKFH 2R4SL 1Y18B 4A7GA 2DQEL 1IAKA 3GZPA 3QI9D 4HDIB 2NQDA 3VXSD 2YA0A 1L5GB 3QIWB 4PP2A 1BVZA 4LSUH 4UOZA 5B4MC 1YHPA 4XCYA 4O51B 1MFEL 1DFBH 1OSZB 4ODXA 5AKVA 4UT6L 1IFHL 1ZVYA 4HWBL 2XCMC 1MFCL 2VUKA 5EZOH 1RZKL 3DROA 4KH2A 4L9DA 2X4UB 1KN4L 5ADOL 4PJ8D 3MV8A 4AIEA 5C6PB 3KL5A 1KXQA 3OZKA 2BIIA 4M8QB 1UYWH 3VXUD 4CC9A 4NHCL 1FUNA 4UWQB 2COQA 3EI4B 3LKSB 4WGVB 1S5IL 2Z0BA 4XPHH 3WU1A 5SWSA 2EDRA 4JJ5A 1E2VA 3U0TA 4LNRA 4TL5A 1PFCA 4PRAA 1WIPA 2VDKH 2EE3A 3NH7L 4L3CB 1MCOH 3APMA 2NZ1A 4ZUSB 2PR4L 3LZPA 1IGYB 4F20A 3AWGA 3THMH 1DYZA 4HIIA 3FRPB 1SJMA 2EH8H 5DRNA 5E5RB 1YMMD 1ZIAA 3VG9B 1TZHA 4PJFB 1GJIA 1PDKA 2M8XA 3CDGB 3MBEB 4WQOA 5DVLA 5DSCB 1RXLA 3H7BA 4B6ZA 4XZUB 5HGGS 3TNNA 1EAJA 2V9TA 4KO5A 5LLIC 1P4LA 2BLFA 2MTPA 2XU9A 1DBKH 2X1PA 5LAXB 1XF4B 5FO7B 4N25A 3IGAA 3DX3A 1IC4H 4PJHE 5TJWK 1EGJL 4K3EH 5I71B 4XN1A 5GRYA 5FK9B 3KPSE 3OKKA 3OC5A 2HJLA 3STLA 1GZPA 4HHAB 4E9LA 3CTTA 1QFWI 1JMZA 1AG6A 3GM0A 3C5ZB 4PSPA 5LHDA 1VSCA 3DX2A 4KH9A 3F7KA 1RQ5A 4Y7MA 5DRZB 5GRUH 3ZMRA 5D71L 2DYPD 5C0FA 3US1A 2OPCA 3P0YL 3OMNB 2R8SH 2MJWA 3QISA 4J3OC 3VSUA 4WJ5B 3NUKA 3L4CA 5KVFL 3FT3A 4OD3H 3TA3D 5AW1B 3I50L 4PY7B 4UM9B 3B2DC 3HE7D 4PVMA 2NQ3A 5BRZE 4NRZB 4TQEH 3IMVA 4O2EA 2R83A 2R4SH 4Y4KD 7FABL 1A1NB 4W6WB 3QCTL 4XCEA 1CS6A 2P5WB 3I84A 5IW3A 2DIJA 4J3OD 1R5VB 3ETBF 3FJTA 1RPQA 3QZWA 5C07A 4BFEA 2IPTL 2O6PA 4NZFA 4UT6H 2D7NA 1IFHH 5T3XD 5D1ZB 4HWBH 5DD6B 1MFCH 1ZTXE 1RZKH 4N1CA 4RMRA 5ADOH 1KN4H 3PAZA 1EAPA 4WGWB 4X7TB 4XXWA 4JRYA 3FO2B 1LD9B 3AL9A 3ML9A 1LK3L 4NHCH 4MQ7A 4A09A 1M7UA 3PDGA 2NX5B 3L7FB 3SQOL 5CYKB 3OXSB 2VLRB 2BFGA 3D8MA 1I85A 1RIHL 2A6DA 2OULB 4OQTL 3HMXA 3FT0A 4POZC 4KFMB 4KNSA 3L2NA 4GKLA 2NY4C 4IBQA 1MRDL 2FIKB 5SWQB 2XKNB 5D5MF 4P04A 3Q8FA 1CZ8H 3V4UL 5I0VA 5KYWA 2PR4H 1FV1B 4L8BB 2YN3A 1EWHA 4N87A 2F7OA 2IJ0C 4PJBF 2QADD 5HE0B 3QEQB 2JNZA 1QD0A 1WZKA 3F5WA 3JXAA 4AXWA 2W81C 3MLTB 4NYLB 2XDWA 2VR8A 3ELQA 3MRQA 5ITFB 1QLEB 4XXCC 1SHWA 2E59A 1KLUA 5E6IA 3ROOA 4RZCA 1FCCA 1FIEA 1WBYB 5IVOA 1FAKT 1F11B 2LHAA 4MCZB 1X9LA 2V3DA 2EO7A 3HE6B 2DQDL 1I8KA 3BO8B 2X41A 3B6SA 5F7UA 3BSGA 4HMDA 3MRBA 4QRPA 4RE6A 3IKOA 3ZHKA 2Z2PA 1U2YA 32C2B 5C7ZA 9CGTA 1WFTA 3VMOA 3HW7A 1Y0LB 2E6QA 4L1LA 5D71H 5FYJL 3EDFA 1XEDA 3GPSA 3IFPA 2R29A 4ZTPL 3BWAB 4G2AA 1N68A 4FADA 5KVFH 4ZUTA 1X5HA 1R5IA 4FI7A 4K9EC 3I50H 4HLJA 4BCCA 3D2UD 1XR9B 3FFOA 4ANUA 4JDTL 4MCYA 3UTSA 4O02A 2OR8A 4JFXA 4PG2A 1UM4L 3KPOA 1TU2B 1SOSA 4JLRA 7FABH 4ES0A 2H47A 4Z7UE 4IMLA 4IKIA 1DL7L 3T3ME 3TCLA 3HA0A 3U4KA 2B7DT 2IPTH 3ME0A 4F2MB 4N86A 4HW6A 1QBAA 3PUUA 2NNFA 4HJ1A 4M7KH 3TVMD 5AAMA 5CCGE 1UXLA 3PWPB 1UD4A 4K94C 4YHYB 4HF5L 4IDLA 5EU5B 3ZIMA 3BHBB 4KROC 2PWEA 1DZBA 3QDGD 4PS7A 4XEIC 5FDYA 1LK3H 5SWZE 1IM3D 2LAAA 5IGXL 4BV1A 3CN0A 3OAUL 5EV7A 4FL4B 3SQOH 1HWGB 1ADWA 1I8LA 2NXYC 3D9AL 5EM2A 4PJIF 1RIHH 4OQTH 3U1SL 4JNXA 4YXHL 3J7HA 3E7JA 3QO1A 5DC2A 5D7LD 3QUZD 2A0LC 2PM9B 3TBVA 1MRDH 5DJCB 4LRNH 3U1PA 3V4UH 5CXBB 3L4OD 2X4OA 4K3DL 2IXQB 4GRWB 5CEXB 3FTWA 3VFOA 5B3JE 5J11B 1T1YB 4U1IA 1UXMA 2MNUA 5JDSA 3ESMA 3IVKA 1R33A 3EKCA 1OMWB 1S7QB 3AQDA 5C08D 1UD5A 5LDUA 2IAMD 4I2XE 1TQVA 5EZPA 2GSGA 2GT9B 2CKNA 2WAHA 3T6VA 2X70B 1ZKAA 4LOFA 1YEIL 3QORC 2BVPA 1NWPA 4FGMA 3DX0A 3NIGB 1XGUB 4TNWF 3HC4L 4MB4A 5JDJA 3SGKC 2DQDH 1CFSA 2NR6C 4NERA 1UZ8B 3BUTA 4P4KA 4ATWA 2P9NC 1K4CA 1F6AA 2UX6A 4KO7A 5EPMA 1S78C 3DTXA 3EZ8A 5EU3A 2P42B 3HOGA 3OX8A 4LHUG 4EDWL 4AYEC 3TTYA 5IIEA 4KK9D 3JV5A 2FGWL 3BQUB 3BZ4B 3VX0A 5J13B 3AU0A 3Q7JA 2XHNA 5FYJH 4W81A 3WHE0 5TEEA 5F1IB 5JHMA 1X9QA 2NR6D 3X1GA 4K3JB 4ZTPH 2Y1VA 3P9WB 2FX7L 4PD4J 4YSRA 1AQ8A 3V5DB 3HR5A 4N1HB 2A74B 3MA7B 5TD4A 1R3JA 1ZTXL 3FFCE 4HX1B 3MV7E 3SDXB 4O45A 2FO4B 1SOKA 4JDTH 2QZPA 2PPAA 1LILA 2A9MH 4G7VL 1A0RB 1UM4H 2OMZB 3NPSB 2FLMA 2NY6C 3L45A 3QJHB 4M93C 4MD0B 2H3NA 3RY6C 4B9KC 4NP4L 3MV9B 4LVNB 2GC7A 1AS6A 3HZYA 3ORJA 2EE0A 4I85A 4KO6A 5DQ9B 1G7QA 1DL7H 1TMQA 2WY3B 5GGSY 2H1PL 2WLMA 1NGZB 5FO8A 2H32B 2APXA 3H9YA 3ZTJH 1JERA 4KXAA 3TBBA 1QBMH 1YJDC 1OY3B 2N59A 3BFOA 4RGNC 1CGSH 1S7XA 3OTTA 2PYEB 3EGDB 3IEAA 4HV8B 2Q76A 1NPUA 4X6CA 3T0EB 4NXSA 5SWSD 1LP9F 4HF5H 5MEQB 2YBAA 3F7YB 1VPOL 4Y4FB 3CUPA 1Q9WA 4A68A 1VAHA 3E2HC 4GAYB 4ZTEA 5B21A 5IGXH 1SN2A 2IADB 3LSOB 3OAUH 5E2WL 2WLHA 1QO3A 4RGND 2PUQT 3D9AH 4HIQA 4P46B 2AI0L 1HCZA 3VXQA 1F3JB 1THAA 3U1SH 4U2ZA 4YXHH 2PKDA 4RMBA 1DJHA 4WO4C 3E38A 4LO9A 5GRZA 3NBNA 4UILL 3QO0B 1G7LA 3B2UC 4CY2A 3CVHL 4E5XB 2YC1A 4HK0A 4K3DH 4KKZA 2YRLA 2WXKA 3VXMB 2DEYX 5G4MA 5MHSE 4JHPC 4W9FC 2R2EA 3LKOA 1IAOB 4PB0L 1OP3K 3SPVB 3BX7C 5C09B 3VXUE 3W39B 1GKOA 1QFSA 3GXFA 5CIPB 1ACXA 3B37A 4K7FB 2WBJD 1MCEA 3U25A 3FQRA 1GYUA 2BVUA 3HFML 2YO3A 1E0OB 2NXZC 1YEIH 4G6FD 4GW1B 4AGPA 1SOXA 2K4WA 3VG0L 4G5AA 1P53A 2OXGB 4S1DD 1SVBA 3NFPA 5I1CL 1ZOXA 2ZXQA 1HI6A 3DOSB 5DJZA 1BP3B 5FLXg 4NBXB 3VXRB 3U9WA 2IBZX 4PJCB 4GKSA 4R5TA 3MUJA 4MFHA 1OAYH 5CEZE 2ZPKH 1LO0L 4Q6YA 4YVDA 3KWWB 5MI0B 2AJZB 2PXYA 4EDWH 3RPBA 1KXTA 5BUAA 1I53A 2ADFL 2FGWH 5IHZB 5DUML 1N8ZA 1QX1A 4NB7A 2VC2B 3IU3B 4NUPA 4YC2B 4MHHI 4ADIA 2FX7H 4A2HA 2AK1L 4P06A 4W4OA 2WUCL 1J86A 4HZAA 5FUZL 3SCYA 3DIFA 3WJLC 3GBML 1ZTXH 2JWYA 4NN7B 4PLOB 1QFOA 3X14B 1XF3A 4HIEA 3C2AL 3P3RA 3NIDF 5C07D 1A4JB 2YGVA 2R1XA 3O6KL 3PL6A 3EBIA 1W6LA 2N3JA 4JZJC 3WHXA 4NP4H 3WN5B 3FQNB 5I15L 1KTRL 4GQQA 4HOXA 1I85C 4V1DD 5J7CC 4MJ5B 3S35L 2PBIB 2H1PH 4RSVA 4GKZA 3G5WA 1M2VB 3TEZA 3T3PE 2DAVA 3TIEB 2AMGA 4KDTC 2TRYA 4PRBB 4JRYD 2CNYA 3GXTA 4Z7OE 3CWGA 1MCWM 4L1SA 1FZJB 1ZE3H 4WHYH 2WB7A 3RWEB 3A6OA 3IDJB 1MQKH 3O45B 1LYQA 3K6IA 3ZDZE 3FT2B 1U8CA 1VPOH 4AE1A 2F1AA 3EI3B 1G6RL 5J56B 4DPBX 3VA6A 3PY9A 3Q2VA 4LVOB 4OI9A 1KCSL 1KFAH 4WLCA 4LCCA 5E2WH 4OKVB 1CF8H 1NJ9A 3L9RB 5E6IC 5C0BB 5IMMA 5C0AA 1FC1A 1YRKA 3Q43A 3HHSB 5C0JA 1NANH 5E00B 2LU3A 4GQ9H 4WI2A 2BZCA 3SDDA 4UILH 5CCHE 4Y9FA 4G6AC 1LE9B 1NWOA 4MYWB 4LG9A 3CVHH 3EJQA 4QHLA 1UD3A 4B9CA 2XPYA 2OJEA 4ZW8A 1E4KA 3S5LB 3VJ6A 3BXNA 4PBWD 1B6UA 2RQEA 4PB0H 1JV2B 3E1F1 4XGZA 4CMMA 5BQ7B 2GAZA 2HH0L 2EEDA 1GCFA 5CR1A 2W0PA 3HZMB 5D7IB 2WJ5A 3DPBB 4FFYL 5I76A 4AVIA 1P7KB 2PPCA 5F9WB 1YY8B 3MFFA 1UTDA 1P6FA 5AOJA 3VG0H 2F53D 4AUYA 3PV7A 5FB8A 5AG8A 5I1CH 5AMSA 4L1MA 1I8IB 1JVOA 3ROLA 1N0LA 3GO1H 1KEMH 2H47C 2OQJA 4Z3HA 5C92A 4WEBL 1OE2A 4EI5A 1YY9C 4UOJA 3IDNB 1TETL 1CDCA 2ZNXA 3G9AB 3K6NA 4PLKC 3NP3A 2ADFH 3FH7A 5DUMH 5K9QG 3T4YB 1UURA 3UTSD 1SMOA 3H56A 2WTPA 5AAMC 3VUAA 2AK1H 5IM7A 2WUCH 4LEOB 5FUZH 4HG4K 4XC3L 4M3JA 5L88L 3GBMH 2FWLB 1UH2A 2I60L 3FPXA 5HHVL 3FM0A 2XV0A 1HL4A 2QPUA 3C2AH 2V9QA 3ISYA 3RIKA 4ZX3A 3O6KH 4PLKD 4FA7B 5IEKB 4JSPC 1NC2A 3L7EB 5J1AA 5H94B 5I15H 5DQDL 3HBZA 3WFDH 5L4JA 2OCFD 5EIIB 3VX1A 2CDGA 1CLCA 4WUUA 4MMZB 3FUFA 1JPSL 3SYCA 1MLCA 3CFJA 2AGXA 4X98B 4GW4A 4AKPA 5G2NA 1UZ6F 4D0DB 5I9QB 2FH6A 2CN2A 3B7TA 2WVVB 4YHNB 1YEHL 1HZLA 2P48B 4FTVD 1P7BA 1UKQA 5K9QI 1WCQA 2DQFA 4L4VA 2AMUA 4XVOA 1KCSH 1S3KL 1N4XL 4X6BA 4I48A 5TF2A 2GTZA 5EO1A 4EDXA 4PGJA 3AREB 5KSBB 2FLRT 3REWA 3VU2A 3OZLA 1V27A 1W15A 5E56A 2W0FB 1BQUA 4U3SA 5C0RL 1TFHA 4K8RC 3I9PA 1SYSB 3LZQA 3PP3H 4G6ML 4P4KC 5E4EC 5I17B 2GNQA 1I1RA 2X10A 2HJFB 3D34A 3SDYH 2ZE0A 1SOQA 3T8XB 4BFJA 4ODSL 3RI5K 2XX0A 4K5OA 3QDGE 4YDIL 3M1CA 4KKLD 1EIBA 1E9PA 3MRJA 1A6UH 5AWNL 1CJYA 5KAQF 1RZGA 1F4AA 1HH9B 1W0YT 1XSOA 2XOTA 4K8RD 4NOFA 1KIUB 1CFBA 4P4KD 2BHYA 5I16A 3MXWL 1O5PA 2JB6A 4QXTB 3ZKSD 1JL8A 5D7LE 5AJAA 3ILPB 4AH2B 5DVKA 4Y9GA 1N26A 5HBBA 3SYOA 4MNGE 2WAQA 3HB3C 3LVTA 1OV8A 5DHVH 5F6IB 1F0LA 3DMMC 5DJAB 3OKNA 2GC7C 3M6DA 2P9IC 5C08E 1TETH 5MEOA 1BAWA 3QAZB 2H7WA 3WMSA 4A7JA 3CDZA 1OAKH 1FNLA 5INCA 3AS0A 3RIFK 5HVHB 4DT2A 4ZX6A 4CI3A 4WK4A 1OLZA 4ZMQA 4XC3H 5L88H 2DB8A 3AGVA 5HHVH 4R4BA 3WNKA 2FBRA 3JTBA 3HVNA 1KV7A 4EVNB 5JLZA 4C57C 3ZWLB 4MD5B 4UT7L 2B1OA 5DZAA 5HHNB 4Y1SA 5DMYA 5DQDH 1XXDC 3EGSB 1EEYB 3OJDA 1JTPA 2C9PA 2DRUA 5D72H 2DYRB 3PJSB 2NY3B 5BZDA 2CGRL 5DGRA 4J86A 5IQOA 1H0DB 1DJWA 1UHVA 1NOLA 1BF2A 4M6NH 2QLYA 4NQEA 4ONFL 2J8UE 5T3XL 1QZNA 3PHAA 2VE6A 1XX9C 1YEHH 2ZUSA 1JNHA 4LVHC 4U1LB 5IHUL 4OIBA 5FCSH 1GXEA 3SZ6A 1S3KH 2BNUA 4W9HC 4GMBA 3K1DA 2XWJB 3KCPA 2GY7B 1YN6B 4Z7QA 1X5IA 2AEWA 3MROB 3MV8E 5F1SA 3ARDA 5C0RH 5KJRL 4G6MH 1GW6A 4H2AA 3T1WA 3TP4A 5DK2A 5DRXA 3MRMB 4KTGA 5SWSE 4PJHB 2F1BA 4K5PA 3N42B 4ODSH 4Q6IA 2XVGA 2QLVB 1MHEA 4YDIH 2PXYC 4UMGA 2YA2A 1KJ2H 2PP8A 2ZTBA 3TBYB 3BAIA 3KPSB 5AWNH 2OAAA 4HSCX 4RGNE 5BMFH 2O6DA 3K4AA 3QH3B 4AW4A 3WUZA 3MXWH 4W4OC 4F5CA 2BO0A 4ZSOB 5FA3A 3VXTA 5FXYA 3V4PB 1AD9A 1HXMA 2VERA 1L0QA 5EC2A 5CM1A 5I0DA 1TPXB 1RZIA 2L04A 2WP3O 4PGDB 1DR9A 2XVLA 1WGVA 3A22A 3TL5A 3PL6C 3VM7A 3GT6A 5IB5A 4M7LT 3FQ2A 4E0RA 2FBJL 2J88L 4U1MA 2OSXA 3GUTB 1BQHB 1RFDL 3WAJA 4ZFFA 1S4UX 1VACA 2HFGH 3RB5A 5F1NA 2AJVL 2IH8A 3JRPA 3ZBMA 1CFTA 1YEGL 3W9EA 4NOBA 3VWJB 4HPOL 1A1OB 1J9QA 1XH3A 3NJIA 5E8PA 1EFXB 2XIIA 1PZ3A 5LGYA 4RLDA 5I24A 1MEXL 5HPMB 5E51A 4JKMA 5JOFA 1EBAA 3MLSL 3L3GA 5CLYA 4LLVA 5ETUB 4X3EA 1A7QL 2QKIB 3ETTA 3PLYA 3NESA 3KM2A 3FSAA 4UT7H 3AROA 2CO6B 4LCCC 1BZDA 2QQKL 1YYLL 5EUOF 3AVEA 2ICEA 1T6VN 2WXLA 4N20A 2VCOA 4PJAA 2CGRH 3K91A 3GTVA 3OKOA 3N44B 1RPKA 3DX9B 2E3VA 4AQEA 4LCUB 4MAYA 5K9KA 1DTUA 1FIGL 3FSZA 4ONFH 3T1FA 3U0WL 4TNVK 3IFOB 4KKAC 1E4KC 5T3XH 3EGXB 5C0AD 3FN3A 2XZGA 4JHNA 2SODB 5DJ0A 1UT9A 5IHUH 4U0RB 2CIKB 3O6FA 2P5EA 3KWTA 3SDDD 4DEWA 3SHSA 4K7PX 4OLEA 5BOPA 1TQTA 3ZYIA 5I6XB 4GXFA 2VH5L 2YPKB 3LQZB 1U8HB 2VM4A 4L1QD 5FV1L 2RD0A 5AQ0A 4JRYE 3EZJB 2PO6B 5KJRH 5IGOA 4A7TA 4N0UA 2FJGB 3HFFA 1FNFA 4YH6A 1VGKB 4N28A 4A11A 3B9EA 3CVHB 1Q9OA 1SGKA 1GXRA 3SVWD 3CHSA 4EI5C 4OZFH 3IJ0A 1P2CA 2EO1A 1SLUA 3NIFF 5FR3A 1UUSA 1I7UA 4JS7A 4JZNA 2OI9C 2MTAH 2X0UA 4F2EA 2IFGA 2K3TA 4BK5A 1I8MA 2VXQL 1TYRA 3WUWG 4PTTA 3CZLA 4JL1A 3WO4C 2BVQB 2CLZB 4H8UA 2VDQL 4IU3A 4Z6AT 4EI5D 1BPVA 2HG5B 1JZDC 5LGJB 2HPTA 3AS2A 2E6JA 3GS7A 3OKDB 1I9EA 3ZUNC 2X4PA 2FBJH 2J88H 3KYAA 1RFDH 4BWWA 1OT2A 4DP4X 4UINL 2AJVH 3CSFA 1H19A 3DUHA 3O8XB 3P30L 1YEGH 2F18A 4CNIA 1XR8B 3II3A 4HPOH 3U6XS 1UWFA 2HLEB 4Z7UB 4HU8A 4XOCA 4ALAC 2R0WL 1MEXH 3T3MB 3MLSH 4IRSA 4QRPE 4J8RA 1BECA 5I19L 1A7QH 5DF0A 4YEEA 2A9NL 4WUUD 1JZ7A 1R24A 1NDTA 1ADQL 4QAWA 2YR3A 1ZLVK 2QQKH 1A6WL 3IF1B 4U0QB 3QB7C 5C70A 3UJTL 5MERA 1OM3L 3L3KA 4MA7L 3GMLB 4AZ8A 4UOW1 1DUZB 3UTSE 1K5NB 2CO1A 1FIGH 4P05A 2EDMA 5E1GA 3U0WH 5T3ZH 1PKQA 1K2DB 3OF6D 4J6IA 2EDYA 2X2YA 4G8IA 1B4RA 4GGAA 1FVDB 2YD0A 4G80B 3CCHA 3PP4L 1G6RB 3L4UA 3SKOB 3MNZA 4GUCA 3MKQA 4LKCB 3F04A 4X5RA 3ETBJ 3U4EA 3W0WA 4Z3TA 3JTSA 4S0TD 1MCLA 4I2XB 3S36X 2QPSA 1OKEA 2X9ZA 3MRFB 4IIQB 4PWHA 3RUGF 2X6MA 6TAAA 1QUNA 2HT3C 2J4WL 4QJ5B 4ICWA 3OSKA 1PX8A 4W9LC 3ZYJA 2D9QB 2FX8L 1KCRL 2BIHA 2XV2A 2DEXX 2MMXA 2VN4A 2X4NA 1UVQA 4HIJA 3QWQB 3UVNA 4JXMA 2KLSA 2ZSWB 2XN2A 1T1WA 3RNKA 4DEPB 4NC4A 2IOOA 4PGCB 5IT9g 4QAMB 4N2DA 3IK2A 2VDQH 3STZB 1BQLL 2X1WL 4RGMB 1AQDA 1V8HA 2NLJA 2Y5TB 4XHJD 1Q9KB 1J0HA 2HPOA 3O2DA 2I9TB 1FYTB 4JFVA 4M3KB 5I1AA 3FFCB 5DHVB 3MV7B 1QBLL 2JI2A 4UINH 3VYPA 4PV1C 3TFKC 1DQQB 2MOQA 3KW7A 5HJDA 3F01A 5IQ9B 4MA8L 3K71A 1AGEA 2YD9A 1HOCB 3QNXA 2VDLL 3KHQA 4NZJA 2A6JB 4OW6A 2R0WH 5E6UB 4AQ1C 5I6PA 4DVRL 2F8XC 5JPNC 3KE0A 4IJ3B 4FQ1L 3KPMB 2AKRB 3P77B 5I19H 3GHEH 3KVQA 3BISA 3LRSB 1B2YA 2A9NH 1NIDA 1XGQB 4PJEF 4XBGB 5HXMA 5C2VB 4EZLA 1ADQH 2P26A 1DBMH 3IFNL 1DUYA 1A6WH 1L9OA 2LTQB 4NQED 2XWTA 1WBZA 3SDCA 3UJTH 5I1EL 3IIWA 2D7MA 1OM3H 2EKJA 4U3HA 3ARDC 4MA7H 2EXYD 3ZE2F 1HKLL 1C8PA 2Q7NA 3VTMA 1NEUA 1JXKA 1VZ2A 1GS8A 4CJ0A 3QI9B 1W0WB 1BLNA 2AGJH 2YQGA 2LVCA 3C12A 3SOTA 3CG8A 1HHHA 3D0VB 3MJ9L 2AXFB 4Q6IC 3O0RL 1C12B 5B39G 3IDGB 2JV6A 3ARDD 4YVNA 2LQRA 2ADYA 2Z8VC 3FQ1A 3HMXL 3PP4H 3PU7A 4PJ8B 1U3HD 3WJMA 4QXGL 1GC1C 4M6ML 4L8CA 4JG9A 5HD8C 3VXUB 4X6CE 3UTZB 2CO7B 1RUQH 4R96A 1RVFL 3DVNA 3E6FA 4ZO8A 4CVZB 4MCNA 3IETA 4DN3L 4HCIA 4R97C 1VENA 2J4WH 1F4WL 5FGBA 1HQRB 2EVJA 4N2FA 4WWPA 2FX8H 5D5MA 4ZOCA 1IMHC 1TYEA 5KYXA 2J73A 4LPTA 1T0NA 2BSED 3HAEG 2Y23A 1E4JA 4LGPB 1X5FA 4PJBA 4PJ5A 5HD8D 2G99A 2M2DA 1GOTB 1QSFE 2ZNWA 4GFTB 1PVHA 1YMMB 1W16A 3K7UA 3NJNA 2OJYA 3EH4B 2HX9A 5IW6A 3BD3A 1M1XB 1BQLH 1KJVA 3H3BC 1DLHA 3PFUA 2P7TB 3FOMA 1J0YA 4LVEA 4X7EC 4JM2D 4I3GA 3WUWA 4RBPH 5CFAA 4ISVA 1ODUA 2ROXA 3Q13A 1J05B 3DBXA 4OBRA 5H4ZA 2CHWA 3BAKA 3UG4A 5LNDA 4IBLT 2G4GA 1QBLH 1ICTA 3WTYA 5EEWA 5EU6D 1AGDA 3IJ9A 2QKSA 4QLRA 1JZ3A 2YKKA 1E42A 4MA8H 3LV3B 4OY9A 5HHOA 3B9KD 3WEBA 2VDLH 1MDAA 4KNTA 1CBJA 3MRKA 4M6AA 1MREL 3T3PB 2W88A 5A16A 1U58A 2DYPB 4FQ1H 4JPIB 4MXQC 4LSSL 4ZXBC 4Z7OB 1YEJH 4H0GA 2X2HA 2X4QA 4AT6A 2ICWB 4GAFB 1D5ZB 3O6FC 1DHKA 1BDYA 1H3WM 3UOAB 5FECB 1CURA 1OEZW 3IFNH 3QA3A 1MFDL 3ZDZB 2VDOA 4MAYD 3HE7B 3QGVA 5J9PA 4XRCB 5I1EH 1UJTA 4X9HA 3RURA 2VDPA 4A6YA 3CFTA 4PJ7A 2GTQA 2K3HA 5CLZA 3J81g 1HKLH 2Y4SA 2EIKB 3GJFH 4TRPL 4URTB 2HKMA 4WEUD 1FVCA 1XWVA 3PF2A 4DESA 1NIBA 2ZCZA 2P5ED 1ZRUA 5SX4I 3C9NA 3VI3A 5I6MA 3V79C 3BUPA 1E5CA 2A99A 3MJ9H 2AANA 3I6KB 3O0RH 2A73B 2MKLC 1NH6A 4X5LA 1I1FA 5JIMA 2ADGB 3TPUB 2WNXA 3KPPA 4PV8A 4W70A 5CN1A 4BK5C 4QXGH 4CMHC 4M6MH 5IB3A 1LEKA 2ZYRA 1WIUA 3KDPB 3L3IA 4OLYL 4B3VA 3TS8A 2YB8B 2XLLA 4JT6C 4JSVC 5E8OB 1VZGA 1RVFH 3U7YL 4UNUA 1CGYA 4F7CA 4WY7L 3TIDA 2JI1A 3NVQA 2EDTA 3MTXA 4GRLD 3VB8A 1BEXA 2V5SA 4LCIL 4UQ3B 25C8H 5M5UA 1YDPB 5GS1A 4WV1C 1ES0B 5C0AE 1K8DB 2X53A 5EOCJ 3IMUA 2LFEA 4HSAC 2W60A 3V0VB 3ATBA 3CMGA 2Z34A 5D6CA 2IDUA 4OZ4A 3CSTA 3GMQA 1GOFA 3QUKB 1NCBL 1ONQA 5CP7A 4IRSC 2OSYA 2NY4B 1WGOA 2F54A 3FQWB 5T1DL 2AEOA 2WQRA 3B3BA 4GBXA 1KDJA 3FHAA 2ALWA 3ARWA 4NNXB 3IKKA 3RKDC 3HZVA 4AITA 4WKXA 1XGPA 2XFXA 5DC9B 4WU5A 3X3GL 4RAUB 3V10A 4KXZH 1PBYA 3GHBL 1PNCA 1ORQB 1WA1X 2ITDB 1W9XA 4IRSD 2BSSA 1BXUA 1GR7A 2BCKB 1FL3A 1GGTA 1NUDA 3GNML 3MRHA 3Q3GA 4HETA 4PRHD 1VADB 1ETJA 3CFBB 1DN0B 3RKDD 5IESH 4BDVB 3RGVA 1NAMB 4P5RA 1RI6A 4NO0D 4TLTA 5E8NA 1FFQA 2XKSA 4LSSH 2EVHA 1ERJA 4N0YH 1S3RA 3K1KC 4LLMB 5KBMA 4N0RA 3PHQA 2AAAA 4PS8A 1BBJA 1WAAF 2EYRA 1MFDH 1N0XH 1OCZB 2BY2A 2H26A 2VZTA 4P2CG 4F7PB 5B3SB 3U6RA 4M5SA 3D2UB 1UXSB 1UOQA 2FNBA 2YAQA 1MCHA 4TRPH 4BFNA 1MFVA 4F33A 3CU7A 2CMRL 3C08L 3BPOC 2VRKA 1JP5A 3DJZA 3PGDA 2FZ3A 1QLFA 5CU5A 3PVUB 1V3LA 2GSIA 1IL1B 4I3RH 4WUUE 3ECWA 2JKWA 4N5UA 1U8JB 1LE5A 4IOFD 1NUNB 2JFCA 2G9AA 1OAQH 2YUZA 2ZWKA 5M5RA 2ZUQC 2VMJA 5B39A 1DVZA 4OLYH 5IHBA 3QDGB 4DSYA 2NTSP 5LJYH 2EVFA 4Z3GA 1JNJA 3U7YH 2C9VA 3B8YA 3LOWA 1MCRA 4WY7H 3HJEA 3R0NA 1A4CA 5AL8A 1D9KA 1ODAA 1Y07A 2EZ0D 4L4VE 4ACTA 4LCIH 3ZT7A 3TBSA 5D7LB 2V2WA 3QUZB 5ELIA 3BH9B 1LEIA 5JA9A 1BJ1H 1HE7A 3K46A 5KAQG 1JVKA 3Q5OA 2FWOB 4MNGB 1T7YA 1N5AA 4PBXA 1GAFL 2IPUG 2VO5A 3JVGA 1A6TB 5JHLH 4L1HA 3UYPA 2IUQA 1NCAL 2NXYB 5ABZA 2OR9L 2DMBA 3HAEA 1NCHA 1NCBH 2IGTA 2WTRB 4FQCL 1GSMA 3IRPX 5C08B 1VKXB 4R84A 1KUMA 2IAMB 1ITCA 2NQCA 3FQYA 4UAHA 4X8JA 3EH5B 3NSCA 5T1DH 2P9KC 4WI4A 5TQ2L 1A6AA 2NY5L 2UY6B 3CFDA 1JPFA 5JQ6L 3QR2A 3X3GH 4YHOL 2WVUA 1B4JL 1E3FA 2ZD0A 5GGQH 4MZRA 4FWWA 4YS4A 3BMVA 3SDCC 3LQAC 1T2JA 5FOBA 3DI2B 2XYIA 1VDGA 3ZGIA 1CT8A 43C9B 5DZLA 4UUJB 2C3HA 2F58L 2EIEA 4H5SA 4NENB 5F7LB 3QZMA 4BUQA 4ZO9A 1GY1A 4QI3A 4Z95H 4PCSA 4FERA 5LXVA 1D2PA 2WLLB 3MREA 5LN4A 3SDCD 4TMPA 2P9PC 2J8UB 2M26A 2ATPA 3RBGA 4EBQH 5T1JA 1IAKB 3NIDA 3QVAA 3RPKA 5EEVA 1BFTA 1EO5A 4PP2B 4YSOA 1N5YL 3E0GA 4ZYKA 4ODXB 1X7SA 3GUFA 5IFJB 3CVIL 2BMKA 4RMSA 3DROB 3LXCA 2CMRH 3C08H 3MV8B 1E5TA 4PPTA 3FB8A 4JPWL 1CU4L 1NBYA 1L9TA 4ZG1A 3VH0A 5L6YL 4B0MB 4NKIL 2CHNA 1THCA 2ICES 2IOMA 1WPCA 2NY6B 3DTDA 2X9XA 1UM6L 3G04A 4M93B 4ZOAA 3Q5TA 5SWSB 2QQNL 5EOTB 4JJ5B 4YXKL 4NQEE 1OSPL 2VMCA 4PRAB 1QSZA 2PLTA 3U30C 2Q10A 1XMEB 4IEFA 2JMRA 4WFFD 5F7NC 2E9GA 3UAJC 1ZHBA 4RGNB 5D6DA 4PJ5D 5I1IL 3JAMg 2GBVA 5F7AA 4RMQA 5DRNB 4HIIB 3WXWL 5B1BB 4ZOVA 1TZHB 2BOBA 2XRAH 1PDKB 3PP3K 3RTQA 1F13A 4Z7QE 3H7BB 2HTKC 1A8JH 4X42A 3TNNB 1T6WA 4ANWA 5BZXA 1JPEA 5HHMD 4BK8A 1P4LB 1WWBX 2CA4A 2F5BL 2WBKA 1NCAH 2JLLA 2ZAGA 1I3UA 4FQCH 4M8VA 1TTFA 3IGAB 4GYBA 2WBJB 1TBGA 2APWA 3BIAX 5TQ2H 2Z7UA 2NY5H 5AOLA 4G6FB 2GHWB 1NDGA 5JQ6H 5K9JH 3OKKB 3HHRB 1BIIA 3STLB 2ZG3A 4HK3N 1GZPB 2CCWA 5L4IA 4BXVA 1B4JH 2BVTA 1T7WA 1JMZB 4HFUL 5IJ7E 4F5CE 2B59A 4WFHE 2OMYA 5I18L 3D1MC 2JELL 3PXTD 3ATAA 4F15C 4GAJL 3EJCA 4DFIA 2GKIA 3R19A 5C0FB 2V7NA 1JFHA 1ZHLA 4URKA 4WI8A 1T22A 2F58H 3T77A 1NDMA 2NXZB 2VOTA 3FC8A 3PWLB 1Q72L 4FCHA 5K59F 1U3NA 3FT3B 4TULH 1R9FA 1AOZA 5EC1A 5GXHA 3F84A 4N8CL 3V4VL 4IS6A 5AZ2L 1MVYA 3MZTA 3CAFA 4Z7VB 4QHKI 1F42A 5M61A 3D39D 3LD8B 2GITA 2Y22A 1E5AA 4NAJA 4O2EB 5L8JB 4XCEB 2FQEA 3IXTA 4FG6C 1VEMA 5F7HA 3EOAA 4J1UA 5K5YA 5IMLA 3QZWB 3L13A 5C07B 5MEPA 4ZFOA 1N10A 5AB9A 5T33L 5EMYA 2UYLA 5HYJD 3CVIH 4V1DB 2OMWA 3ULSA 2K6ZA 3GJFB 3EHBD 1EAPB 2FRGP 4O58L 5GS1C 4C56A 4JPWH 1W8OA 4JRYB 5L6YH 1F5WA 4PJAE 4NKIH 4MQ7B 2V33A 4CN6A 3JV6A 5AW6B 4A09B 1UM6H 2NNXA 3QJVB 1WZ1L 2QQNH 4LHJB 4YXKH 5BW7C 2DIAA 3FTSA 1OSPH 2A6DB 2XYBA 5JHAA 4HIXL 4MJHA 3BIBX 1A65A 1VZHA 2WM0A 2GCYA 4GBXC 3IE9A 3O4OC 5KYWB 5I1IH 1FP5A 2P5EE 2H0JA 2UY7A 1T80A 5GJTL 4GGCA 1UM5L 1ACZA 1M6OB 3JT0A 1HZHH 5IHHA 5J57B 2N0KA 2W1NA 2N4IA 3DETC 3F5WB 3IDMB 4AXWB 5EULV 5A1AA 3LN4A 3ZPDA 4QGTA 3MRQB 2F54D 4JFUA 5E6IB 4U7KA 5AVQB 2F5BH 5HYFA 4RZCB 3F3FA 4YBQC 4FXGA 4N0UE 1D3CA 5H8DA 1GTNA 3RGVC 2F68X 2QMJA 4NKQB 2LE9A 3FCSB 3S37L 4ABWA 2BHUA 2D31B 4I7ZC 3HRPA 2BP8A 3CD4A 1I1AD 4YL4A 3B6SB 4GAGL 3RILA 5E9NA 4XXDA 3AABA 2BINA 3HS0A 3MRBB 5KS9F 4MA3A 4HFUH 1XCTA 3DX1A 5I18H 3S3JA 2Y6TE 1OAJA 4GAJH 1JXDA 3WEXA 4AYSA 2AQ2A 1BJ1J 4MRBA 3IFPB 1AS8A 2B15A 4QHKJ 3VI4F 2ZIDA 3T71A 1Q72H 4E9SA 3FMGL 1F8TL 4FQ2L 5DK0A 1R5IB 4N8CH 2CJ3A 2VZSA 5AZ2H 3V4VH 1N7ML 4QR7A 5KOMC 3WNOA 1FLRL 1UD8A 3N43B 3EUDA 4TVPD 5JIHA 3ZL1A 4MCYB 1CXHA 4PRNA 2Y24A 3U2JA 3UTSB 2QEJA 4JFXB 1R5WA 1D7BA 3KPOB 5HY9A 4JLRB 2D7TL 4MXWL 1G0YR 4HUNB 1G9NL 4IMLB 1T0PB 4NDMB 1S5HA 2VDMA 4UT9L 3TCLB 4X6FA 1JK8A 3ME0B 3QFGA 3RVWC 5T33H 1KZQA 4LLQB 4JMNA 5FYLD 4ERSL 3QC6X 2APBA 2EQDA 4E2OA 4JY5H 3FB5A 2D0FA 1F1GA 3KWXA 4MJ6A 3BPLB 5I66A 4O58H 5EDSA 1SJVA 3GSWA 2OW6A 3P73A 5EZIH 4R4NC 2XZZA 4JVPA 2IBBA 2XN9D 3UO1H 4KRPC 3JVGC 1N6DA 4PAZA 3N0AA 1WZ1H 2XNAA 5CGYC 2HYEA 3L5WA 1D9KD 1GH7A 2P8PA 2CWRA 5HVGB 4DKEL 3J8F7 4PIBA 4HIXH 4MMXC 3QO1B 3CC5A 4XAWH 3TBVB 1M7XA 2KYIA 3FAWA 2EYTB 2X4OB 3DSNA 3ISRA 3RWHA 3VFOB 4KRPD 2Y1YA 4J3UA 4M03A 4U1IB 4LCYA 5GJTH 4N1EA 5JDSB 1QTYT 1UM5H 2OSWA 4X5PA 3N3EA 5SX5H 3IVKB 3TBTA 1WZLA 3W0WE 4NZRL 4TUJA 2D2CC 4O9DA 1ZLWH 3MX0A 1F97A 4NQTA 3T6WA 1HOEA 1O6SA 4AWJC 4CGUB 4FHLA 1VFUA 2BVPB 3G9VA 3QXWA 4X7DC 5FM4A 2VLKA 1OP5H 2WSKA 3EOYG 2NY1C 5LBVA 1MXDA 1Z3GL 3NCMA 3TJEL 1CFSB 5M94B 4IU2A 4P4KB 4U3CA 5FFLA 1K4CB 1U2HA 1F6AB 3HG5A 3S37H 5L8LB 5EPMB 4JFEA 3DTXB 4GAGH 4HEPA 4NM8L 1MFBL 5EU3B 5SV3A 2Z3FA 3NRQA 1SN5A 2HRPL 3SY0A 3MLZH 1RCYA 5IIEB 5KTEL 4ZMOA 5EF0A 2NY1D 3ZK0A 3LN9A 3KLQA 5SV4A 3D08A 5KYYA 4P4RB 1JPGA 3UMNA 1SRDA 1TTGA 4LCWA 3FMGH 3S4SG 1F8TH 1FSKC 3HR5B 4FQ2H 4JRWA 3SGEH 5I1DB 4H13C 3SPGA 4L3EA 1N7MH 4F9PA 2EDBA 3GC3A 1FLRH 4ZW5A 3BPNC 4MD4A 3FUMA 3HB3B 2KKQA 3U48A 5JXEA 2D7TH 2H3NB 4MXWH 2AGWA 4F37K 4N9GA 5D7HA 1G9NH 3ALWA 2XIDA 1RK0A 3HZYB 3UP6A 4AC2A 2EO9A 4BEIA 2RFXA 5ABDE 1G7QB 4MAUL 4UT9H 1YNTF 4IOIB 3UTTA 1Z9LA 3VB9A 3K2MC 4KQ4L 5D6DC 4ERSH 2E6PA 1S7XB 3X3FH 1OARL 2Q76B 4HU2A 5G5DA 3ZE0F 4KV5E 1CD0A 2CAKA 1DN2A 4X6CB 5TDOB 1JZ2A 1QWUA 3RTQC 4I77H 3RL2A 2F7QA 2WZ0A 1Q9WB 5DEJA 3UGXA 1E7VA 5E1QA 1PD1A 2K8QA 4CY3A 3C8KA 3ML8A 3ABMB 2D3JA 3NRFA 4WI5A 1WWCA 4AMWA 1SEBA 1QO3B 5FGSA 3A6BL 4CC4A 1G5GA 1T1XA 2C9XA 4F3FA 1PGUA 4DNLA 1SXNA 1A4AA 3RTQD 4C54A 4NRYA 3CZEA 3E3QC 1G7LB 1OVZA 5GHWL 2YC1B 4HK0B 3X1BA 2ZQKA 3P4OA 3EQ9A 3VXOA 3RHWK 3Q6GL 1DE4A 1AXTL 1UWGL 2HFTA 3FUNA 3I3BA 3LKOB 4QXUL 5KYNA 4NZRH 3P4LA 5DWPA 5JHDD 4ZAKA 3UBXG 1A4KA 1CGWA 2YLHA 3C6LA 2GIXA 3LH8A 1M4KA 4GSRA 3HN8A 4FMKA 5D5ME 3NRPA 5B1AB 4WFFE 4DQAA 3I7NA 1YYML 1Z3GH 3NFPB 4A2GA 4PJBE 3TJEH 4PJ5E 1CUOA 1HI6B 5DJZB 3BE1L 1DBBL 4AL8C 2F9BT 1IC1A 2FHFA 4JFHD 5JIPA 4FABL 2C9RA 4NM8H 5DZOA 2BY3A 1MFBH 2WKLA 3JQOB 3MGAA 3DC0A 2ED8A 3MNMA 4XNYL 1KXTB 2Z7ZA 4WRLA 5F7FA 5KTEH 2Y25A 1N8ZB 5HHME 1ZWIB 4FG2A 2CO4A 1CFNA 4TTDD 3FB6A 1XHHA 1X44A 4XH2A 3S8WA 4NBYB 4ONHA 3ZTDC 4K2UL 1GYAA 2PTTA 3CQQA 2J6WA 3CFCL 3NZSA 3MA9H 3I2NA 3UBXI 1PD0A 1XF3B 3BUQA 2I0SA 2BHFA 3MNVA 4N0FA 1AO7A 3PL6B 4UI2A 3MLUL 3ZQXA 5F7MC 1CLVA 3WHXB 4LESA 3AL8A 4GRMA 5HHOE 3DXAA 1NOAA 2EKSB 4ZS7L 4FHJA 1S9WA 3IMRA 2AXGA 1TVBA 4A7UA 4MAUH 4PB9L 3TJHC 2WLIA 4GKZB 3JYCA 4N2MA 4C56D 3GSNL 1CE1L 3H42L 2V5YA 2PP7A 1II4E 4KQ4H 2GJJA 4JJOA 3TZVA 1SBSL 2APSA 1OARH 4DWHA 4PVBA 2GQHA 3V0EA 4C4KT 5FO2A 3S48A 4J3WA 1KIQA 1U8CB 4X80L 5SXMA 5IMOA 4PJGF 5J06A 4JREB 5E4IA 1QRKA 2YWZA 4NO5A 2DYSB 2VJXA 4PJ7E 5DWUL 1SJXA 3T9WA 1BQ5A 1NJ9B 3A6BH 5I1HL 1UB6A 3PWJA 5KJ4A 5C0AB 4WW2F 4FXGC 5I6OA 5C0JB 1VCBC 3VI3E 5A3IC 4B7IA 2D8KA 4JHWL 3SDDB 3L95A 1Z66A 3L4TA 1YAIA 3L5IA 5GHWH 5J0BA 4G1MA 4QHLB 4DPRA 2GEQA 3L2MA 2FJUB 8CGTA 3HS0C 3VJ6B 3Q6GH 1NEZG 1AXTH 4QXUH 1GMIA 3BXNB 4YO0A 2H6PA 3QQDA 3GDCA 2EC9U 4XGZB 3PGCA 3SPJA 4CMMB 2GAZB 5JPMA 1KDIA 4NN5C 3INOA 3MJ6A 5DA4A 1OANA 1J8HA 1B2WL 2IURA 4AQOA 5I76B 4X63B 1RHHA 2BRRH 4LRIA 3RNQB 1O7DC 3S3PA 3MFFB 3GZOA 3W57A 1YYCA 3VSVA 5H35A 3DIVA 3ULUD 2FAUA 1YYMH 5BVJA 5GRVL 5FB8B 1ZJBA 4KZEL 5BZZA 3BE1H 3L4MD 3ROLB 4FABH 1N0LB 5IY5B 2OQJB 4EI5B 4RBPK 2G2RA 3WKNA 3EDJA 3JWOC 3D30A 1IGFL 3V5WB 2OI9B 5I5RA 2F54E 1VJSA 2YJQA 2EVGA 1E2WA 3T0WA 1BVLA 3WO4B 5IM7B 4K2UH 4X9IA 4QO1B 1X4YA 1JYXA 3CFCH 3KL3A 1M6UA 2WINB 2BX5A 2CUMA 1CBVL 3V4VB 4D0BA 4DAGH 1WLHA 4B97A 3MLUH 5AW4B 3CK0H 4TPRL 2VDNA 4XHQA 2JJTC 4OVUA 2X6BA 3N55A 1A3LH 4ZS7H 3UZQB 1RULL 2EEFA 4OLXL 1SHXA 4PB9H 4BSWA 4WUUB 2X4SA 5FIEA 1S7VA 3GSNH 1MLCB 2WVTA 5C6WH 2CLVA 1CE1H 3H42H 3X13A 4GW4B 3T65A 4AM0Q 2A4ZA 1KCLA 1SBSH 2VWEE 5F3HA 1OXYA 2VR3A 1JGDA 1HXYB 1JPST 2A38A 5IROD 4QNPF 1R0AH 1A14H 3GJFK 1HJCA 2B5MA 2ENYA 4Y19A 1M57B 3AFLA 4TVPE 4XO8A 4KX7A 4Z78A 2UUDK 1NKOA 1ROCA 1XSIA 2DQFB 3VAEA 4L4VB 3RZWA 5DWUH 4X6BB 4MWFB 4QLWA 1O9ZA 1SJEA 2GTZB 3H1ZA 4OAWA 3VFMA 5F70A 4EDXB 5EMKB 5I1HH 3GK8H 1UASA 2YEQA 5TF1L 1MI5D 4NLHA 4JHWH 4U3SB 4J78A 2P9SC 3V6ZA 4DGWC 5T5FL 5IVXA 1J0JA 1JGIA 4LAJH 4OZGA 1WV7T 4XCNA 5ABAA 3X11A 4UOQA 3OHXB 3MRJB 2VLKD 1UWXK 5IK3A 2JCCB 4J81A 4APQD 2FB4L 1RZGB 3H0TA 3EXLA 3MMYA 1B2WH 4G42B 1HAWA 5I16B 4A0AA 4ZD3L 3CSYA 4P2YA 1BM3L 4B41A 1SM3L 1EHLL 4F9PC 3VFUA 1T1ZA 4Q74A 4PWFA 1IKNA 4KZEH 3EQ7A 3QZPA 5JXEC 4XNDA 2QTEA 5K1VA 1P84K 3OKNB 4QCIB 4WTZG 5DS1A 3S34H 3TH3T 3C6SA 3KBPA 4FFZL 4PREA 3T04D 4LCWD 3V9EA 4BA8A 2A2QT 5MEOB 2JKIS 2EDLA 3S0PA 5C6TL 3RAJL 1IGFH 2RJMA 3FQTA 4L3ED 4DK3A 3CDZB 2P24A 5INCB 5I0YA 1T03L 5HYIA 4G5ZL 4PJDA 5LNGA 4WK4B 2GJ6A 5FCUL 1MCBA 4NN6C 3CU1A 4AQAB 1CTOA 1SY6A 5EN2A 4R4BB 1AAJA 3S3BB 2VDOL 5JLZB 1CBVH 3G6JF 5E6RB 1Z1WA 3CZFA 3DOIA 1XXFC 4N2LA 4TPRH 2QFRA 3ZT6A 2O5NA 3OJDB 4KGJA 1RULH 2B4EA 3DJTA 5BZDB 4IHOA 4G43A 3T5WA 3QXVA 3CDYA 1L0YA 3SO5A 4NQEB 1EVTC 3NIDE 5DS2A 3BGMA 3QJZA 4NIYE 4BSJA 1JNHB 3QWRA 5C0DB 4HAGA 4NGHL 1EAOA 1E7UA 3H3PL 1DQLL 3C6LC 1EO7A 2BNUB 3BVTA 3O3AA 4ODBD 5IQ7L 1MKFA 4QYAA 3KCPB 3EJZC 4Z7QB 3JWDL 1EX0A 2FX9L 5TF1H 1NEXB 1VESA 1FN4B 1EHNA 3ARDB 3MLWL 4PH8A 4NQXB 3U2SA 5T5FH 4ZAKD 3SCMA 1QZ1A 3C6LD 5DK2B 3F7VA 5DRXB 3C5JA 4M43L 2HESX 1MHCA 1UACL 1ZV2A 2OMXA 3D51A 3KPRD 4E9YA 4Q6IB 5FKTA 1MHEB 4R5XA 3G6AA 4PCYA 5KYUB 1J5IA 2FB4H 1NEZA 2O30A 4KI1A 4Z23A 5DVPA 1AI1L 1AS7A 4H4NA 4ZD3H 3VXTB 5FA3B 1BM3H 1ULVA 1TFPA 1SM3H 1SLWA 5HQGA 1HXMB 1FNGA 3UABA 2YSSA 3OHMB 1RZIB 4R97B 2YGNA 3O2VL 4NO3A 3ILEA 2DQGL 5IB5B 2WO4A 5IJCC 2EIDA 1IO4C 4WDIA 4M7JL 3P3YA 4U1MB 4FQXD 4ZFFB 3D4ZA 1QABA 1VACB 3GTNA 4CZXA 2X44D 4FFZH 1A6VL 4KMTL 4JM2B 5F1NB 5HYSG 3T6ZA 2XV3A 1A25A 3GMOA 5C6TH 3RAJH 3GZQA 1CFTB 3W9EB 3E3QE 3TZVC 1GJUA 3P2TA 1XH3B 1PZBA 2EEBA 2W94A 3WGVB 4AIZA 1J9SA 3B1TA 1Z5HA 3F8UB 5FCUH 1H3TA 1NUGA 3HNTL 1KTLA 5JOFB 3L3GB 3BKMH 4LLVB 1DQTA 1I8AA 3KWUA 2OMBA 2CNXA 3AS3A 4G8GA 3B9KB 3S97C 5B7MA 2FBOJ 4A2DA 4UIKL 3P4FA 4E41A 3CX5K 2ICEB 4J79A 2A6IA 3HPJB 4J87A 4I0PA 1WAAA 1I7ZA 3V9FA 4RMTA 2VR7A 3OKOB 2EXSA 1Z9OA 2QBWA 3D7PA 4ZUUA 4AQEB 3QP3A 4MAYB 5K9KB 4FRWA 2DBLL 2DLHA 1HILA 4J6RH 4P3CL 4AK2A 1CIDA 3T1FB 2JKTM 5FYLL 3QHYB 4N26A 3RDTA 3HG4A 1PMYA 3MRRA 4FLSA 3SJVA 4A1RA 4WGKA 1U36A 4NGHH 2KI6A 3H3PH 3O11B 1DQLH 3QJUB 3UC0L 4HZLA 4JMXA 1XAKA 4HKZA 3O6FB 2P5EB 1ID2A 3O2WL 2WWKO 5IQ7H 5JZ7D 1OE3A 3BEVA 2MCPL 2YMUA 4GO9A 1OAUH 3JWDH 2FX9H 5IB2A 1B4TA 5A40E 4P2OC 2CUHA 4IOSD 4C56E 3MLWH 3CFIC 5I0XA 3CFVA 4YHZL 2O5XL 3TO2B 1SVCP 1ASQA 1AHWA 4N0UB 3S5YA 1J8HD 4A11B 2EIJB 4M43H 3U0PA 1UACH 2WXIA 4K5MA 4YDLB 1P2CB 5C3IA 2VR9A 4GSDL 4KXBA 4OLWL 1I7UB 3TT3L 4WZ9A 3MPCA 1L9MA 1JF1A 1SQ9A 3K6OA 2WIIB 5EARA 3DK2A 1I8MB 4CMHB 4PTTB 1AI1H 5DCCA 5EIVA 3H2WA 2PCYA 1N18A 3T0XA 3UG3A 1TEFA 4IU3B 5CLWA 3UVMA 1KY7A 2J8HA 1NBQA 3BH4A 2QDWA 3P9LA 3N41F 1BBDL 3O2VH 2DQGH 2EDWA 4C47A 4PI2A 1ILUA 2XN1A 5F7KC 5CNHA 4HALA 2X4PB 4M7JH 1H6EA 3DDGA 2FT7A 3L1EA 1WAPA 5HGDA 1T6BX 2G5RA 4OGAC 2EIBA 4ZUVA 1G9HA 3P9MA 5JW3H 1A6VH 4KMTH 1U2CA 3ZSSA 2XA3A 4LIQE 2I3TA 2IGLA 5DZPA 1AACA 1A64A 1SXAA 1TNMA 4OR1A 4XNQA 3WJJA 4CNIB 3SYPA 2V17L 4BA0A 1FRGL 3HNTH 3BAXA 4IRSB 4HUKB 4AVJA 4HKBA 4KTDH 2YFNA 1IGJA 5J6GA 5LCVH 2OZ4H 1WC7B 3I9GL 3IWUA 4PRHB 3GS0A 1R24B 5IT2H 2UXFA 3Q48A 3LCYA 2WXOA 4S1SL 1FL6A 4GJTB 4HGWA 4DNUA 4YDVA 4F7MA 3PYCA 1BEYL 4LCVA 2Y9RT 2NY0C 4CN4A 2XWBA 3L3KB 5FUOL 3D4CA 4Y89A 4DUVA 1TQSA 2LGNA 3AW5A 4AZ8B 1T04A 2G0LA 1PG7W 4V2CB 4Y2NA 2MCG1 2DBLH 4P3CH 2P52A 4XBEL 5C9KA 5FYLH 1UCTA 4JJHA 1HHKA 1PKQB 3QK0A 3OM3B 5B3NA 1DVXA 3LRMA 2FD6L 4UB0L 4G8IB 2NY0D 4ZMVA 4N8PA 5DMJB 1RP9A 3UC0H 3SPIA 1QBBA 4OB5L 3CCHB 2R0LL 3O2WH 4XBPA 2ZCKL 5JUEL 1UENA 3MNZB 4W9IC 2B39A 4U6VL 2MCPH 2Z8RA 1AC6A 3U4EB 5HVFB 3JTSB 1X5MA 1A7NL 4Q89A 4RH4A 5CP3A 3EYUH 3FTGA 3EYQD 1KCUL 1IKNC 1QUNB 2WC7A 4FNTA 3D05A 5DRWA 2Y72A 4ODWA 5I6NA 1M2OA 2R2BA 1MJUL 2RH0A 2PM6B 2FNWA 4Y5RD 4H8PA 4TXVB 2P28B 5F8QC 5EU4B 3GSQA 3RG1C 2Q7YA 2X4NB 4GSDH 4OLWH 3TT3H 5A2JH 1MW0A 4HIJB 3KPQB 5A2BA 2PWGA 3MRLA 4KUCD 3NK4A 1T1WB 4I3SL 4QHNA 2ZUQB 1K8IB 3RNKB 3FH8A 4F7KA 2HKAA 4OZIA 2QSCL 3A0OA 3TO4C 1AQDB 1CL7L 2NLJB 1BBDH 1M56B 4ZMNA 2AJSL 5HVWA 3NEEA 1FYHB 4YHLL 2PCPA 4KRMB 5GGTA 3UIZA 4L9OA 2ZWLT 3IBEA 4JHZA 3RJQB 4JQIL 4XP9L 5I1AB 3HBGA 4FA4D 1KGCE 1MAJA 4MJIA 1IAIM 2GJ6D 5GS2D 2D3VA 2VLKE 1PCSA 2AQTA 2UZPA 2B4CC 3EO0A 4HBQA 1IM9A 1ETA1 2VLMD 3EIFA 3FU7A 2HX7A 3GXNA 4HC1L 3UL4A 3RFZA 1HK6A 1AGEB 2V17H 1V7NL 3FONA 1PSKL 3QNXB 2MFNA 1FRGH 4WHTA 5HYSA 4JFEE 1QASA 2DLFL 3PUCA 3S5ZA 4NT6A 3TEUA 2AS5M 1FBIL 3TT1L 3BN9C 1N6QL 1IEAA 3I9GH 3WFBL 5IP4A 4N14A 2YQ3A 4GEJA 4JFSA 4S1SH 1XTMA 4ZFOL 5AD0A 4BRVA 1BEYH 3F6JA 4J12A 4LCWE 1AOHA 2XWTB 1WBZB 3ISWA 1TG8A 3JV4A 5T1MA 4OJAA 3SDCB 4CL7A 4GINA 1LL1A 3K27A 4L3EE 3QWRD 4ILDA 4MRCA 4LDLB 2K6WA 4GI8A 3BN9D 5ISZD 1BLNB 3DBSA 3ZO0A 5I23A 1R75A 5DJ6A 1U33A 4XBEH 3SCMC 1UUNA 3D3VA 2VAJA 3ZTNL 3TYGL 3WLBA 2XZCL 4ADJA 2GPZA 4PRPA 2FD6H 2A9BA 1KB9K 1QYGL 4UB0H 4X8GA 2XJKA 3UTTE 3VVVA 1ETZA 5IJVA 3N50A 4JK0D 4OB5H 2R0LH 4QJ4B 2ZCKH 4L8CB 3L3JA 1U8LA 2EC8A 3QS3A 4U6VH 5DJDA 4ENED 4XT1C 4OTXH 2YPVL 5CSGA 1QP1A 5HE2B 1H3UA 1X5AA 4OJYA 3RZCA 3DVNB 3E6FB 1A7NH 5DU7A 4XE0A 1HSAA 1ZGLM 3JZNA 3IETB 1WHPA 1KCUH 2N56A 2AGZA 3CFKA 3FCGA 3KYKL 1MJUH 5DVOA 2R7EA 1G7IA 4LFHD 3GI8L 3JT2A 1TYEB 2O1AA 3IUMA 4NUQA 2ICCA 4XB7A 5KYXB 4NBMA 1T0NB 4PTUA 3OXRA 1OGAA 4OCWH 1NM9A 4PJ5B 1ZCRA 4XPBH 4GUQA 2YBGA 2QR5A 1AHKA 4RWHA 5SX5K 4YDJA 1JTDB 1TNNA 1OTTC 1RZJL 2AXHA 4OD2B 1YUKB 4I3SH 1WISA 4LIQL 1KGWA 1L9NA 4KTEL 1ZLWK 1WUZA 4FQLL 2KH2B 5IW6B 1B90A 4Z7WB 3U30B 1C9SA 1KJVB 5HHMB 2QSCH 3RWDA 2X09A 3FOMB 3G5XA 1CL7H 4BWUA 3WUWB 2AJSH 2Y7NA 7TAAA 3ULUL 4YSEA 5JW4N 4YHLH 4ISVB 1Z7JA 5ECJE 1OTTD 1QFPA 1RJLA 3DBXB 1FO0A 1B0IA 1OPGH 3GLDA 1EUUA 3NIFE 4JQIH 4XP9H 5AEAA 4U1GC 1W8NA 3ATDA 4I0PC 1IAMA 2AH0A 3UAFA 1IRAY 1AGDB 2Y2WA 5KG9B 1VE6A 4UTAL 3EFOB 4HC1H 5DUPL 5HHOB 3N85L 1V7NH 1PSKH 1ZGLA 3BAEL 3MRKB 2Y5EA 3WTSA 4U4IA 3RDTC 4N0CC 2XICA 4O2FA 4P59L 1U58B 2AITA 1QW8A 2DLFH 4P23A 3VI4A 4C55A 3US0A 4ONOA 1FBIH 3DLQR 3TT1H 1N6QH 2DQ6A 1S9YA 3AG4B 3WFBH 2X4QB 4AT6B 3EXJA 1QSED 1J87A 3WIHA 2VMDA 2VDML 3QA3B 4DKTA 2HAZA 2VDOB 1RURL 3JWOL 3C60D 4ODUA 5F71A 3IU4L 2FSDA 3AACA 4FMFA 5C3LD 4MDJA 3MI6A 4OM1H 4NAQA 2DWSA 2VDPB 3D39B 4A6YB 3NQKA 4N0CD 2BERA 1NGWA 4PJ7B 4F15B 5C7XL 3SJVD 1BV8A 3FF8A 4HP5A 4JRXD 3CHOA 1AHWC 1TDQA 1JOIA 1AO7E 3VI3B 3C9NB 3ZN6A 1BXXA 4HT1L 1QQDA 3DXAE 3ZTNH 4LL4A 1PIFA 3TYGH 3O6LH 2A1WL 2XZCH 1CO1A 1QYGH 5HYJB 1A21A 2VKXA 3ZKXC 3N04A 3KR3L 1JNLL 2DQUH 4QPEA 2KERA 3S3CB 4LL1A 3KPPB 1CCZA 2R2CA 1J1OL 4PV8B 3CDFA 5IB3B 3VQLA 2HMIC 1LEKB 5E2JA 2W9DL 3L3IB 2YPVH 4JFQB 3I9IA 4KTYA 4GP5B 5DS8A 1TTAA 1OL0A 3Q2LA 3TIDB 2NNAA 5K9OA 3KYKH 2X0VA 3GI8H 2AV1A 4LPXA 4NS0A 5TE7L 1PFOA 2V3EA 5GS1B 2DH2A 4GIAA 1XH1A 5DK3A 1FORL 2W60B 2IOIA 1SUHA 3WJJC 5GGRA 1E8ZA 5K39A 1RZJH 3WE1A 5KOVC 3GMQB 4J3BA 3QG7L 3K4DA 4LIQH 1T21A 2G9HA 3PIQA 1NGQH 1WWWX 5GSVA 4KTEH 2C1OA 3E8VA 4FQLH 5IVZA 1OTSC 1ONQB 2ZUUA 5CP7B 2L7EA 4WF7A 4FG0A 2F54B 5B8CC 4GBXB 5DMGC 1KY6A 3O4OB 2R1YA 4KKBC 3ULUH 5C0CA 2HJ4A 2FDBP 1RUKL 2XC8A 4JQXA 4AV4A 5BV7L 3HZVB 5I0ZA 1J8HE 1SQ2N 4KO9A 3FHEA 4WU5B 4NPKA 2O72A 4CSPA 4FLOA 1OTSD 1PBYB 3KJ6L 2UZYA 3IT8D 4UTAH 2BSSB 2DPKA 1Q94A 3FAXA 5DUPH 1FL3B 2FATL 2OTWA 3MRHB 3N85H 1DCEA 3Q3GB 1INDL 5DMGD 2GY5A 3BAEH 5EZJA 2OW7A 3RGVB 3D48R 4KK6C 4X4YA 2ADJA 1O7SA 3PDOA 4TS6A 5E8NB 4P5KA 3E80A 1QNIA 1U3JA 3CFNA 4YNYB 2YRBA 3ARUA 4BKLA 3P0VL 1KXHA 5J6HA 3PHQB 1RUML 2XUWA 8FABA 1BBJB 2EYRB 3IE4A 1K5WA 5H4YA 1RURH 2D03L 2H26B 4PJ9A 3S6CA 3QRLA 3U6RB 2NNCA 3CSBA 1JSYA 4KK6D 3QEQD 5C7XH