1FWXA

Crystal structure of nitrous oxide reductase from p. denitrificans
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
591
structure length
591
Chain Sequence
ADGSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESVRIHERTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMKCDAILEIPNAKGIHGLRPQKWPRSNYVFCNGEDETPLVNDGTNMEDVANYVNVFTAVDADKWEVAWQVLVSGNLDNCDADYEGKWAFSTSYNSEKGMTLPEMTAAEMDHIVVFNIAEIEKAIAAGDYQELNGVKVVDGRKEASSLFTRYIPIANNPHGCNMAPDKKHLCVAGKLSPTVTVLDVTRFDAVFYENADPRSAVVAEPELGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIEDAIRAYAGEKVDPIKDKLDVHYQPGHLKTVMGETLDATNDWLVCLSKFSKDRFLNVGPLKPENDQLIDISGDKMVLVHDGPTFAEPHDAIAVHPSILSDIKSVWDRNDPMWAETRAQAEADGVDIDNWTEEVIRDGNKVRVYMSSVAPSFSIESFTVKEGDEVTVIVTNLDEIDDLTHGFTMGNYGVAMEIGPQMTSSVTFVAANPGVYWYYCQWFCHALHMEMRGRMLVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROUS OXIDE REDUCTASE
publication title Revisiting the Catalytic CuZ Cluster of Nitrous Oxide (N2O) Reductase. Evidence of a Bridging Inorganic Sulfur
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 185
structure length 591
sequence length 591
chains with identical sequence B, C, D
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2000-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13473 Cupredoxin_1 Cupredoxin-like domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1fwxA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1fwxA01
3EI3A 1B9XA 1XB3A 3DTUB 4X61B 1L9OA 1WS8A 2AGLA 2HX9A 1ETJA 4HHWA 2UXVA 4DP4X 2BW4A 5A2Qg 2I3TA 4G56B 2VM3A 4M4RB 1ADWA 3OM3B 5B1BB 2J57G 1PZCA 4Q89A 5D4JA 3ULEC 2YNPA 1OCCB 3PXTD 4A2MA 4KNTA 4DP2X 2MRYA 1ZPUA 4W1TA 2UZXB 2HLEB 4GM8A 3UVOA 1MG2A 2B3IA 1QNIA 1TBGA 4J82A 1M9WA 1KV7A 1QLEB 3X1NA 3SBPA 4N14A 3IJCA 5CXBA 3UKUC 4DP7X 1OV8A 4DPCX 4R7AB 4XEIC 4Y5RD 1PZAA 2CN3A 2OVQB 3WIAA 2HRGA 1S4UX 3C5MA 2QDWA 5EAPA 4ZOYA 1IC0A 4H5IA 2Z2NA 3K27A 3JTBA 4ESGA 4KO6A 2AQ5A 1FFTB 3NSDA 1F56A 2ZXWB 2CCWA 1OMWB 3SHFA 5FC9A 4JKNA 3X1EA 2P9UC 3ZX1A 4DPAX 3C75A 3TA4D 3UGEA 4E9WA 2H14A 1BQKA 1SHWA 2G99A 3EI3B 3DXMC 4JSPC 4L3GD 5EMMB 1JXFA 3JRPA 4J0WA 4U7AA 4H5JA 4ERYA 3PVWB 1JZIA 1OE1A 3UAEA 3NYKA 2HZHA 2PLTA 1J9SA 2GHZA 3MBWB 1ZIAA 5PAZA 1JOFA 2B4EA 3PSLA 3PXWD 3SLED 2HESX 4EWRA 1UATA 2H47C 2HXAA 5TF2A 3ASNB 5HQGA 3DSMA 3U4YA 2PCFA 4GYBA 2YAHA 1AQ8A 2DV6A 1NEXB 1XIPA 4JT6C 2CUAA 4IMMA 3V9EA 3JZGA 1XKSA 3NT0A 4J8GA 4JXMA 5CXBB 2FQEA 4E9YA 3BG0A 1BEXA 1I53A 2AVFA 2W8CA 2WO3B 1WS7A 4J87A 3QJUB 3I8EA 5AJAA 4FB1D 1IUZA 5H14A 5EMLB 4JSXC 2UXGA 4FAAB 4J78A 4A0AA 4BDVA 2YB8B 1A0RB 2HX8A 2XUWA 4GM3A 5FKSA 1N68A 3PPSA 2P9KC 3RN1D 5CYKA 1ASOA 2QPDB 3FU8A 3NJFA 3IJ1A 3PSCB 4CY5A 1B3IA 3MZLA 3GDCA 4AKPA 4A2FA 1YFQA 2AANA 3QJVB 3X1GA 7PAZA 4L9OA 5GXHA 2EIJB 1KGYE 1V55B 4GZ8A 1NWPA 2Q7QA 1ILUA 3ORVD 2I7OA 3EG6A 1CYXA 3DM0A 4GQ2P 4BL0A 1JVOA 4F2FA 5FLXg 4AI7A 3FU9A 1ET5A 1NZRA 2FT6A 2RACA 2WO2B 2YAFA 3N55A 2O9KA 4FWWA 5THAA 5A7EA 2CO0A 3IEAA 1MG3C 3GREA 3IKOA 2B5MA 2PBIB 3NVNA 5IJ7E 1WA0X 3L45A 5I6PA 3SQRA 2YXWA 3SCYA 2GB2A 5I6NA 2YARA 5AFU3 1L9QA 1MZYA 3AG1B 4AKOA 5TEEA 4A67A 3JT2A 4QLWA 5I28A 2B5NA 3G5WA 3FT0A 1L9SA 3ABGA 3UADA 3OKWA 2QC5A 1E5ZA 1MZZA 3CVDA 3ODTA 1U2VC 1AZBA 3FQ2A 5I6LA 4K3JB 3HEIB 4E9RA 4A0AB 2H6QA 4BDVB 4G7SB 3T6XA 4D0KA 5CXCB 3VH0A 2PM9A 1E5YA 1EZLA 2BO0A 2YAPA 1PNCA 4GXFA 2IWEA 5CYKB 4CZYA 3TBCA 4CI1A 4U1EI 1SHXA 1TKWA 2BZCA 1KBWA 3KW7A 4PBYA 1A3ZA 1NIAA 1M56B 5B1AB 5FQDA 2GC4A 2B5LA 2ZWNA 4ENZA 5TK4A 1W6WA 3FGBA 3ZWLB 4DPBX 1NWOA 2VSMB 1A4CA 5B1KA 1AOZA 4AOWA 3IN0A 1AS6A 2I85A 4A09A 1ID2A 2BW5A 5D4IA 1GYCA 2PP9A 4BWTA 3JZHA 4IA9A 3T71A 4UAHA 3CG8A 1ASQA 2BHFA 4JHVA 3AG2B 1VLXA 5GXIA 2P9IC 3F3PA 2H68A 3B7FA 1BXAA 2JKWA 4J79A 1ZIBA 4JT5C 1AACA 2CJ3A 4JHUA 1SF5A 1A65A 5I6OA 1PLBA 3SXTD 3I2NA 1HAWA 2TSBA 3FYEB 1OCOB 3PVUB 2IH9A 2OK6A 5GMKn 4E54A 1CC3A 1AZRA 4X4KA 4JSNC 1ZDSA 1J9TA 3GFCA 3VGZA 4EF3A 3HB3B 2PM6B 1NTDA 2PM9B 3H4HA 3NSFA 4N4YB 5B3SB 7PCYA 3C75H 4OWRA 1HFUA 3CFSB 3V5WB 4XYIA 4KFMB 1SQJA 5FKRA 4AKQA 1GP2B 4FA4D 3RN0D 4A09B 3EF4A 1E30A 4DP6X 2XYIA 3JAMg 1SHYB 3QPKA 1Q47A 3FSAA 2IAAA 1RZQA 4D6VA 3RFHA 3PXSD 3QJSB 1OLZA 2TSAA 3MKQA 2DWSA 2YXVA 3IIWA 3PAUA 2PPDA 2ZONA 3OL2A 3PE7A 3CZUB 4Z8LA 1TU2A 4BK5C 3OQRA 1BQ5A 3EI1A 1N70A 5SXMA 4G7QB 1X9RA 4BXVA 4O9DA 5C2VB 4HALA 3I7NA 1GS7A 1ILSA 1JXDA 4A08A 3TASA 2EINB 3RRMC 3OKTA 3QQXA 4DP8X 2OJYA 5B7MA 3NJKA 1R1CA 5I6MA 3I7KA 3N0EA 4E54B 3SJLD 6PCYA 3N0DA 3UABA 5I26A 3VA6A 4J77A 1GXRA 4A2LA 2CN2A 1GW0A 3DIVA 2IDQA 4WKXA 5F7AA 4YSAA 1N6FA 3I89A 4A2DA 3NJGA 2CE8A 2AZAA 3X1FA 5I6KA 2AGXA 5EM2A 1GY1A 5IT9g 4KO7A 3CVBA 1J9RA 3OKYA 5EMJB 2YAQA 1MDAH 2XL3A 4FA5D 2AGWA 1GR7A 4KOBA 1PI6A 4CC9A 5LDUA 2IURA 3EU7A 4HZ1A 4HCFA 5HE0B 2YAEA 2YMUA 4Q8BA 3PAZA 4DP0X 4CZVA 1L9RA 3TU6A 3C9CA 1IBYA 2FWLB 1PF3A 3OL2B 3UVLA 2BP0A 4CZXA 4YSOA 2VMJA 4UANA 3EI1B 3EI2A 4YL4A 3NJJA 2J55H 4KO5A 2GC7A 2P9NC 5HYNB 1OE2A 1FWXA 2QPEB 2XVBA 4M3HA 1GG2B 1WAEA 5D4HA 2TRCB 4NSXA 5HE3B 4L0PB 5EMKB 4WTQA 1PGUA 5B1JA 2JXMA 2BZ7A 2EBSA 3IN2A 1CURA 2J56A 3MX0B 1SQ9A 2XU9A 2HKRA 5IGOA 5IJ8E 4J86A 3SMRA 4CY2A 1PY0A 1K8KC 3GXUB 2UXTA 3EHBB 4TZ4A 1PAZA 3W15A 2I0TA 2PPEA 2P80D 4NB7A 2XL2A 1W6LA 2XYBA 2MTAH 3NP4A 2Z2PA 4GQBB 2P9LC 1NPNA 2XLLA 1ZDQA 3S8FB 3JB9L 5EM2B 2GC4C 1JERA 5I5MA 3V9CA 4YSRA 1PCSA 4DP5X 5AKRA 2HXCA 3OKYB 1VYHC 4FA7B 3KRXB 3IJ0A 3SWSD 4X3EA 5H1MA 1PBYB 2H3XA 3EH4B 4P5SA 2NRDA 3CVCA 4YVUA 3S3BB 4PBZA 5B4WA 2W88A 1ZV2A 3EMHA 2IUQA 3AL9A 2BP0B 1L9TA 3S3CB 3SBQA 2OVPB 1N6EA 2P9PC 2A3TA 3FSZA 3EI4A 2XV3A 1GY2A 2DYRB 2I0RA 3EI2B 3WKPA 3I7HA 3OMNB 3I7PA 2YAMA 3H4FA 4QL1A 5EAMA 3SVWD 4G7RB 5PCYA 4O45A 4CSZA 2H9MA 1XB6A 1PZBA 5E9NA 3FSVA 2Y69B 3OD3A 2UXFA 4CSPA 3F3GA 1OCZB 2YNNA 4O3UB 3GYRA 4N8UA 1JMZB 3I7LA 3ZDWA 3NVXA 2IH8A 2BP8A 2VW6A 4YSTA 2IWFA 2H9PA 4F2EA 4MK0B 4Y7RA 1JXGA 1TYQC 3WNIA 5CXCA 5H17A 2H6KA 4ZOVA 1PEVA 3UVMA 2P80A 3I7OA 5KDOB 1SJMA 2PP8A 4I79A 1AS7A 2IDUA 1JZFA 1OOWA 2PPFA 3QJTB 5TEFA 3AZUA 2HYEA 1SDDA 4A7JA 1URIA 2DWTA 3OMIB 4L1QD 3BQVA 1CYWA 1J5DA 4GGCA 1MG2C 2CBPA 3UVNA 2YNOA 4BH6A 4ES0A 2IAAC 3RLMD 1V10A 8PAZA 3AFCA 4HIPA 4J0XA 2XXFA 3RFGA 2FQFA 2X88A 3NJMA 2BCJB 1MG3A 1AAJA 4J81A 5JWZA 1SNRA 2EIKB 2H13A 2IDFA 1TEGA 3EI4B 4K3ID 2H5UA 4OZUA 2OJ1A 1BYPA 3IE9A 3T9WA 4J73A 1AZUA 1J9QA 3ASOB 2DY2A 1NR0A 4E9XA 2HJ4A 4DP1X 2Z2OA 1ET8A 1M57B 3ABMB 4FA1D 4HDJA 4YSPA 2XV0A 2X87A 3U25A 3BG1A 4PSXB 4A2GA 4LG9A 4XYHA 2XX1A 2XX0A 5HE1B 3FPXA 2GI0A 3BWSA 4E9VA 1AR1B 1EHKB 3EWEA 1JJUB 1K32A 4QT8A 4PXWA 2R7EA 2BP8B 3KRWB 4G70B 1NINA 4CY3A 4W9ZA 3OMAB 1NIDA 2AGZA 4J84A 1GS8A 1NPJA 1SFHA 3D12B 4KO9A 4ZK8A 3TBBA 4AX3A 4E9TA 4G71B 2GBAA 4GQ1A 3ABKB 4BUJC 2XWZA 1JZJA 2I3SA 4TXVB 1JZGA 3ZBMA 4GM9A 1OE3A 1CUOA 1SDDB 4GY4A 1KCBA 1V54B 5I5JA 1N6DA 1OF0A 2VN3A 3F3FA 1KYAA 2J57A 3RYMA 3UACA 5ANHA 1PNDA 1AZCA 1L9PA 3MZKA 4QRJA 1T5KA 5B7EA 3AW5A 4ZOZA 1J5CA 1NDTA 3FU7A 4A66A 5EHFA 2EILB 3NJLA 5FKTA 1RZPA 2OV0A 3NVQA 4NAJA 3E0CA 4YSDA 3DXKC 2CE9A 4QKTA 2XU7A 1PLAA 2GC7C 3EH5B 2G9AA 2FT7A 2HKMA 2J56H 3FYIB 4AEZA 5K1CC 2GIMA 2AFNA 4GGDA 3JPXA 1BQRA 5B1JC 3S3DB 4J8BA 2OVRB 1OCRB 2OK4A 2R7EB 2AH1A 4HAKA 9PCYA 1SF3A 3AG4B 3QJQB 1BYOA 4HHGA 1ASPA 2Q5BA 3FQ1A 4PSWB 4A08B 3V9FA 2GSMB 1L0QA 1GS6X 1WA2X 2UX6A 2Y1AA 1AS8A 4E5ZA 2HX7A 4LG8A 3H56A 2VM4A 3UR4A 4CI8A 1RI6A 1JVLA 2CO0C 1DZ0A 1W8EA 1XHMA 1AANA 2VW4A 3PCYA 4ZN4A 1WA1X 4CY1A 2QDVA 3SN6B 2OIZA 1E65A 2H6NA 1A4AA 2E86A 3UVKA 4CI3A 2IDTA 4HCIA 2H3XC 4YSEA 4A68A 3HFQA 5K19A 3FSWA 2DYSB 2IUPA 2PM7B 3X1BA 4X63B 2PCYA 3L4MD 4QQEA 1A8ZA 1JZEA 2FTAA 4AZUA 1BXVA 3FU7B 4GP5B 3WG7B 3V7DB 2I7SA 4A2HA 2PPCA 4JSVC 1E67A 2AH0A 3EH3B 3MMYA 5TK2A 4A11A 3AY2A 4P5RA 4K9JA 3X2QB 1U4CA 3A0FA 4YSUA 2QT6A 3BVDB 4X60B 2CAKA 2HRHA 2YAOA 3JROA 1AG0A 1IKOP 2OCCB 3DWLC 3OTTA 4A0BA 3CDZA 4L3HD 2VW7A 3NSCA 4CI2A 2YQBA 1ET7A 2IWKA 4UF7C 1SFDA 5EARA 5C2WB 1XB8A 3I8CA 1KDIA 3NJHA 1JMXB 2H47A 3MKSB 4ZOXA 5FXYA 4E5ZB 2FNWA 1TEFA 4A2EA 3C99A 3J81g 4GP8B 4JD2C 3NJNA 4F7KA 2P9SC 1AIZA 2W18A 5B7FA 5GSAA 3UAAA 2IUVA 1NIBA 4GMBA 3SBRA 1AZNA 1JZHA 3FS9A 5AFAA 3AH8B 2IDSA 3FRXA 3T6VA 3AG3B 4KNUA 4RH4A 2B08A 1KCWA 2H9NA 1HAUA 1MDAA 3PAVA 4PC0A 1PLCA 3PLYA 2FQDA 5EALA 5FKQA 4PCYA 1AG6A 1KBVA 4YVNA 3T6WA 2J5WA 2H9LA 1NIFA 4MFHA 2HJBA 4FHLA 4YVDA 2ZOOA 3CFVA 3NP3A 2AZUA 2JFCA 4YSCA 2CALA 1NIEA 5IC7A 3UKRC 2UX7A 1B9YA 4O1QD 2Q9OA 4A11B 3AL8A 2BWIA 3J80g 3DKHA 3ERXA 2QXVA 1QHQA 5AMSA 1ERJA 1IBZA 2J55A 3RSEC 3IBOA 1KDJA 4FA9D 1RCYA 3CIKB 3JZNA 3NJIA 2PP7A 3S8GB 2I0SA 4A0BB 3CDZB 2PPAA 3FQYA 3QJRB 1A4BA 2EIMB 5I5IA 2FT8A 1GOTB 4FAVD 1BAWA 5F7BA 5IGQA 2GNQA 4PAZA 4UI9R 1PMYA 3PXLA 3FM0A 4KNSA 1X9UA 1BXUA 3ZIYA 3RMZD 3WNJA 1XMEB 4NERA 3L4OD 2BBKH 3IIYA 1R5MA 3K26A 2MTAA 1NICA 4DP9X 1P22A 2LLNA 4LGNA 3KW8A 2BWDA 2N0MA 3WKQA 3NSYA 2YBAA 4YSQA 4ERQA 2XV2A 5AZUA 2VSKB 5C9ZB 3FPYA 4E9QA 5IY5B 2CNXA 4GP4B 4O3TB 2FJSA 3ABLB 4BWWA 3N2JA 1GSKA 3T6ZA 1FA4A 2UZYB 2WSDA 3MXXA 3WI9A 4E9SA 1JOIA 2FQGA 4KOCA 4BWUA 1YLBB 2XXGA 4BXSV 3P4FA 3AL8B 4PNKB 5FA5B 4G72B 5HE2B 4FAND 1RKRA 4ERZA 3OW8A 4GGAA 5TDHB 6PAZA 4HCGA 3SFZA 2AGYA 4YSSA 1DYZA
chains in the Genus database with same CATH superfamily
3RWCB 3EI3A 3FT4B 4JQIL 1BAFL 3II3A 3MRGA 5I74C 1ZLSL 4HC1L 1MJ7L 1Q0YL 2NR6C 2NXZD 1OLLA 4XPHH 2JB5H 4HWBH 1ZVNA 4AGMA 1TJIH 4MX7B 1CLYH 1MCFA 2G2RA 4L1SA 4PW9A 4KKZA 3G5ZB 5JUEL 3D18B 3DXAA 4F5CA 1N6QH 4PGEB 1DP0A 2LU5A 4HJJL 1QFHA 1TBGA 2WZ5A 4M93B 2YD3A 1UM5H 3RI5K 2I32A 4N14A 4J2QA 1BEYH 4XCNB 4PCKA 4UYPA 2CIIA 4L4TE 5ICXB 4OF5A 5GRJH 4P5TD 1TSHA 2XXMB 1TEYA 3RA7H 1IBDA 1DVQA 4P49A 1LDPL 1Q94B 2BSTA 3C5JA 1WAAA 5BV7L 5CINL 3ZX1A 2CKBA 4W9HC 4DKEL 2D0FA 3RIFK 5ES4B 5ACLA 3NH7H 4PJAE 2H26A 4QT5A 5E00B 5I19L 3TEYA 1F4YL 4NBZB 5FKPB 3D39E 1DBBH 4JQVC 5DZPA 1WAAF 4H5JA 4YXKL 4IRSD 1JOFA 5CCKH 3FJTA 3B3IB 1DANT 2WXOA 5EPMB 3WHXB 3SLED 2IADA 3I2CL 4PG2A 4U1IA 3KM1A 5TF2A 3A21A 4BFIB 3IFNH 4DVRH 5HQGA 5FGBC 3EBAA 3KVDD 4GPVA 2WZPD 3BUYA 3CSGA 4P99A 3SGKC 1DLHA 1NC2D 2ADFH 2DIEA 3UP6A 1I7RB 1R5VA 3V9EA 2ZXAA 2DQIH 4F91B 3V10A 4J8GA 4JXMA 1DQJA 2NXYB 3TXAA 3RZCD 3DNKA 4ACPA 3CVIH 4XB3A 4LNRB 1RD6A 2XPYA 4A0AA 2HX8A 3EFFA 1ORQB 3GSRA 3PPSA 1CDIA 1AC6A 1ZHKA 5F9JA 3V4VB 5K9QI 1AGEB 1YUKB 2WBKA 3QJVB 4NDMA 5DLML 3SDDC 4FCHA 1MCCA 3TL5A 1EDYA 4HS8H 4WUKL 2DM2A 2CG9X 4GW1A 5D7IB 3L3KA 2CRMA 2R69H 2WXGA 3WLWD 5IVNA 4UQIM 4RFNB 2C7UA 1BDYA 4G83A 3QZLA 1J0KA 4RESB 4PJ8D 5IOPB 3KWXA 1WWBX 4NYLA 5HGDB 3GUFA 2VDQH 3I6KA 4BKLA 3GXTA 3FUNA 4AKOA 3CFDA 4ZNEE 1GC1C 4Z78B 4HJ0D 1EUUA 2IV9A 3ABGA 1UA6H 3MHZA 3Q1SL 4LL1A 4RMRA 4XC3L 4ZT1A 1RZ7H 3HLKA 3U9UB 4X7EC 5I6LA 1I1AA 3L6FA 1CDJA 4QPEA 5TF1H 4B96A 2A9NH 1DL7L 4F7MB 5H35A 2EYRB 4U1MA 5F7LB 2PW2A 1BBJA 2AK4D 1P7HL 3ZU8A 2GC4A 4DPBX 5T1MB 2R9HC 5FO9A 4JM2B 5HGBA 3LV3B 3DJSA 4NQUA 3UTPD 3ULUH 2HRPL 1RJZB 5LGJA 1X5YA 4JDVA 1UOWA 1H8SA 5GGTL 4Q9CA 4ZFFB 1GTNA 1D6VL 1INDH 3SPJA 1CR9L 3D52A 3UBXB 3NZHH 3JV0A 2RB8A 5FW8A 5JIQA 4TL4A 1HAWA 2XNAA 3BZ5A 3L3IA 4MVBD 4AVIA 3G6DL 4F7TB 1OTSD 3VGZA 4RA0C 1Z5YD 5KZCB 4JGUA 2XT1B 1K2DA 3Q1EA 5D6CA 4KUZH 1X7SA 4QJ4B 1O9ZA 5CZVH 5DU7A 1RPQA 4UNIA 3HMXL 5F44A 5IZ7A 2JKJA 4GKOA 4K8RD 1U92B 4A09B 1FAKT 4RGNC 1K8DB 2ZCLL 2AV7A 5JW4N 5GSRA 4O51A 4G8FA 4ZFZA 3BH9A 1EPFA 4Z7AA 3GWJA 1TJXA 2F54D 2B2XL 5IMOA 4LMQE 5FM4A 1A9BA 2DDQL 3VXRB 3QJFB 3N6YA 1THAA 4J4PC 2F1AA 3BGFC 5HDQH 1ZY9A 3V0JA 5CU5A 3ZHKA 1ZK5A 2AJZA 3MNWA 5FYKH 5CILL 5IGXL 4WHDA 4EI5C 2CO4A 1FZMB 1LQBC 1JSYA 1TMCB 2OMVA 3B8SA 3INUH 4H2CA 4EVNB 3D85B 2YD8A 4RA3A 3BAIA 2DICA 1DQKA 1E4XL 2V7NA 1UYWL 1U8IB 1TQSA 5KANG 3WMPA 4FXTA 4AH2A 1HL8A 3I89A 5MEQB 1VZ3A 5BS0D 1B9ZA 1S6NA 2GITB 4S1QL 2YPKB 3NIGE 1E5AA 5F3BB 2VLLA 2G5RA 5BZZA 2AP2A 3BMVA 4PRPA 5IJKA 3DOSA 2VC2A 2VN4A 5AWNH 1S7TA 3WEXA 4PWGA 1R47A 1KV3A 1IM9D 3IJYB 3QUKB 4O2WA 5E6ZA 3LXBA 4Q8BA 1T7YA 3VXMA 1VGEH 3C9CA 2FWLB 3CLWA 4HF5H 3QWOB 2E6QA 3BUBA 5IJDC 1UWXH 4LDCA 3K6FA 1FO0B 3D48R 12E8L 1XT5A 2V5SA 4U1SB 4Y9GA 1JZ7A 5IBTH 4P0DA 2A38A 4H26A 4L5FL 4D9LL 1W72A 2VE6B 4O00A 5C2UB 1EEQA 4TRPL 3N40F 4L0PB 1PG7L 4MA8H 2HLFC 2BRQA 1MELA 3C60A 2P1YA 4L05A 1H3WM 5F6IC 3R1GL 1UJ3A 5TE4L 3UPAA 5ACZA 1HYSC 3EW3B 4WFFE 4M8RA 3U82B 4HLEA 2X2UA 5E5RB 2XLLA 2GQHA 3QQ9C 4PJXE 1XCXA 3C8HA 4MHHI 1T80A 1YEHL 5JPNB 2YMXL 5EM2B 4P2RE 3B9EA 5D71L 2LLLA 1LK2A 3BZDA 2HXCA 3D09A 4ZUWA 4FA7B 4MB1A 4JL1A 5D7SL 5DJZA 3E1ZA 1IFRA 5JW5B 5E24E 3T0WA 1FZKA 1KGIA 2NRDA 3BT2L 1EDQA 1HQ4A 1ZV2A 1C8PA 3F05A 3FH5A 3IWVA 5FPIA 1N6EA 2H4EA 5F9AC 1GY2A 1OSZB 2BNUA 4HU2A 2W9DL 5IW6A 3GBNH 4QRAA 1LDSA 3JWOC 1BPLB 1L5GB 3LS5H 3D06A 3L5XH 4BBWA 3DGGA 1IAIM 3NTCL 1LWJA 4CSPA 3F3GA 2PMZA 4RQQA 2DAVA 3UTOA 1IAIH 3QR1A 4Y7RA 4FG2A 3MJWA 4XX1G 3Q43A 5DYOA 5A6LA 3Q8AA 1HN1A 1K3ZA 4X0KA 3SKMB 3GM0A 4CC4C 1FDLH 3AZUA 4JHPC 1URIA 2DWTA 3P30H 4XNAA 1AKPA 4OD2B 2YNOA 3CVHH 1MCDA 3RLMD 5AW3B 3LD8B 1IGFL 5F0MB 3OWEA 1A02N 4IQHA 1TPXB 2Z1KA 5E1AA 5E56A 5AZ2L 2Y07H 1DQDH 4XX1E 2DI7A 2VDNB 4HEMA 4LCCB 2FD6L 3WFCL 4HIIA 1ZGLP 3QO0B 2VDKL 2VNCA 4Y5YB 3VG9C 3BG1A 2I27N 4PSXB 1AMXA 2FCBA 1HNGA 4K7PX 3VFVA 4FKKA 1VSCA 5G4MA 5I1AB 3EZJB 4PJFB 3FFCB 4QT8A 2H0PA 4PXWA 3ZE0E 1FH5L 5F1NB 4ONGH 1KXQA 1UXSA 1S7QB 4I0PB 3P0YH 4JVPA 3P0VL 1XD0A 4O9HL 3D12B 4A08A 4ZK8A 2DS4A 4TQEH 3OLEA 5IW1B 3ZBMA 1SN5A 2KPNA 4HVBA 4E36A 4NQDA 4GMTL 3ZKXB 1XR8A 1B3JA 4XBGB 2DOCA 2VN5A 3TZVD 5HI3C 5ETUB 5DJAB 3QA3B 4V1DE 1O6VA 4QO1A 1AC0A 2CDGB 1F5WA 1SEQH 3WV0A 4FFZL 5LNEA 1HWGB 2NT1A 3GIZH 4O02B 4TLUA 1E9PB 2EILB 3PL6C 3HRZA 5HJDA 4B50A 4NRXA 5JPMC 3PABA 4JPVH 4X9IA 3A6BL 4UQDA 2GIMA 3MJ9L 2BWQA 3KWUA 2BY2A 3WGVB 1QG3A 2P5ED 4J8BA 4PJBA 4ZS6C 3G6AA 4Q74A 3DDFA 5LHDA 4M9PA 4PRIB 3V6FA 2ZOWA 3CXDH 5BO1H 3H7BA 4J3OD 4KTEL 3VE0B 1L0QA 2UX6A 3MAWA 4PJBF 1QAWA 3QZPA 3ZTNL 3FRPG 3BAEL 3FB7B 1I8KB 2VM4A 2N0KA 3ELQA 5CN1A 2HB0A 3LQZA 3NOIA 5IUCA 3C5XA 3JUYA 3SN6B 5LWYH 3O6FC 3E0GA 5D1XD 1T0NB 2KS0A 1TETL 3LKPB 4GMSL 4WTZG 3RKDD 1TUPA 4XP6H 5D7IF 3RVWD 1HZHL 1HHJB 3HZMA 1NBZA 4TQHA 3QIBC 2NDGA 3H6AA 2VXVL 1R3LB 2PPCA 4GINA 4KRPB 3TO4D 1KBGL 1YN7A 3WIFA 3V7AG 5J13C 1Q9KA 3MMYA 4U1KA 1RK0B 1Y18B 1PS3A 5E1HB 3RWIB 3W1ZA 1YJDC 3MRMA 4XPHL 2X42A 1TJIL 3TCLB 4WO4C 1AR1C 4ELKB 2ZD0A 5CLXA 4IIQB 3IUJA 2DQEH 3L4WA 4K07A 3E8VA 5EARA 1EAPA 4JLRA 3EUDA 1KDIA 4RZCB 5BQ7B 3N85H 5DRXA 3MA9H 1KPVB 3SGEH 2BFVH 2G75B 2XRAL 3OKNA 1AIZA 4G3YH 4LRIA 2Z91B 1JNNL 2EZ0C 4FXGC 4JG0H 4CGUB 3DVFA 2VLKA 4JM2F 1V27A 3AADB 4XZUA 5ALBL 5A40E 4OCLC 2AJUL 4JHWH 4KZCA 4RWHA 5DVPA 3W39B 5DJ2A 4MNQD 1P4BL 1DBBL 3VFSA 1MLCA 1UA7A 5CCKL 2ESVB 4UIMB 3TT1H 3OZ9H 4DVRL 2PPAA 1TQCC 3CIQA 3VWKC 1SDAB 4HUXB 4KXAA 5K1VA 1EZUA 2VUKA 1WE5A 2ADFL 2IWGA 4X9BA 2DQIL 4GEJA 2BX5A 2OFQA 3MROB 1FYTA 3CVIL 4FGMA 1R5MA 3UIZA 3E1F1 4HGWA 2J8UA 1P1ZA 4OGQC 2L04A 4AN0A 1S3KH 4YSQA 5BW7A 4H2AA 1L6XA 3QEQA 3QUZC 5HPOA 1PPIA 2VSKB 5GPRA 3MLUL 4R7DB 2Q3ZA 3ARED 3ABLB 4NPYA 2J8UF 1QQDB 4BIKA 3F12B 3MXXA 1D6EA 3JUZA 1JPGB 5ADPH 3MV7B 5KYUA 5FV2A 2FQGA 2CJSA 1HXYA 2NLJA 3DHJA 3NK3A 2NUTB 2R69L 1JD9A 1LE5B 1WCBA 4HS6B 2P48B 1KWKA 4IBUA 1X5GA 2VR3A 2HFEA 4X5RA 4LIQL 3VYNA 3BKML 2VDQL 4P2QD 3SDCC 2V8MA 1F42A 3ZRFC 4DP4X 3EDKA 5DJ8A 4CW1A 2FB4H 1U8CA 1UA6L 2A4EA 4YO0A 4RX4D 3NAAH 3FUJA 4HWZA 3PXTD 3CBKB 3LZOA 1ZMYA 3VGAC 4EXKA 1QNIA 2GIYA 1BFTA 1E4WL 2A9NL 1QLEB 2LT9A 4PGCA 3BZEA 3SBPA 4U7KA 3HI1B 2AKRB 4AMYA 4RFEB 1PYWA 5D7JC 3EJPA 2KDGA 3K2UL 2XWJA 4Z77B 2PCPB 4P4KD 5G55A 1YNTA 3RGHA 1KBPA 3X11B 4AQEB 2Q3AA 5EEYA 3I02A 3V95A 1WT5C 3TA4D 3QFDA 3UGEA 5A2IH 3UJIH 5T3ZE 2W65B 3GMLA 4FNLH 4HIXH 4PP2B 3EGSA 1INDL 3ARPA 1DANU 1B4RA 1G1YA 3MV9B 4PHZA 2R1YB 1H2WA 1LD9A 5F1IA 4HKBA 3RJQB 2HESX 3BP5B 1UATA 2OXHA 5HPMA 2XKNB 2FJGB 5GGUA 3M8OH 5HHNA 1FHGA 2ICWI 2WPGA 3U4YA 2XICA 1T2QL 1XEDA 3REWA 4M8VA 1PZ3A 2XZQH 2GEEA 3A47A 4ZD3L 3IJ9A 3RY4A 1E8WA 1KB9K 1K3IA 4YAQB 1WIOA 2ZUWA 4IBWA 1GOHA 5L2JA 5H14A 3ZDZA 3WBDA 1M3IA 3FZUD 1EMTH 4HEPA 3V6ZB 4RFOH 2YD0A 5LJYH 1HWWA 3SE3A 3BH8A 3N40P 2MHAB 4H13C 4M6AA 1CF8L 2XV6B 1N59A 2EIJB 2QBWA 1F8TL 2BMKB 4WTWA 3GJFB 2IV8A 1ILUA 2KERA 4XH2A 1BREA 1XDTT 4Y8DC 1MFAH 1Z9NA 1BJ1J 3WAKA 3TURA 5HDQL 4G11A 2DQTH 2O72A 2UYLB 4IK6A 4X5PA 1QTPA 3LY6A 1P2CA 5K9QG 4N2DA 3K6OA 1BMGA 4L37A 2ISDA 3MBEC 2AABL 2GB2A 1ZHNA 5ABAA 4D8PA 1AOHA 3BGFB 3LKSB 3BP6A 4ZX4A 1J86A 4TUJB 4L4JA 4U6HA 4D9QE 2JTYA 5I1LB 3VMNA 1MZZA 4FOMA 3PWJA 4LKCA 4LOFA 4MAYC 3TJHD 3WS3B 4EI5B 2CDFB 4KZDH 1FBIH 4QYAA 5EUKA 4F8PA 4QHNB 3VSUA 3NUKA 1PZUB 4GAFB 2R2CA 3L2MA 5C7XH 3JTTA 2VRKA 3BVNB 4N8PA 1RY7B 2IALA 5IIEB 4M7KL 4PGBA 3FTVA 5FXCH 2ZWNA 3OLIA 4IRJD 5D6DC 4CDGC 4L4VB 1RZ8B 3NA4A 1I9JL 2B59B 2GY7B 2WXKA 4AW7A 4B9GA 3GMPA 3VYOA 1MCIA 3B9KB 2EH7H 5EH1A 4PJFF 4XP4H 1KTKE 4ZBJA 5EN2B 4R84A 4ALAH 5C8JB 2ZKMX 4HULB 3PHQA 4Y16C 1G7LB 4PJDE 1ZIBA 2X70B 1IQDB 4JHUA 4ZNCD 4QRSB 2Y2TA 4ONFL 1IRAY 4C55A 4WWOA 1YMMD 2IBGA 4JSNC 3GFCA 1QFOA 2A6DA 1CFSB 2GJ6A 5DK2B 5F6IB 4N2CA 1JFQL 2PWEA 1CD0A 3DARA 3TESA 1MCWM 2DBJA 4NC1E 2J3SA 5DMJB 4LSSH 1MHCB 5IP4A 4G9DB 4UCFA 3OV6A 3AB0C 4G7VH 4X5LA 2K4WA 2P8LA 4ONHA 3OAYH 4B0MM 3WYRA 4QMEA 2FBRA 2Z92B 3N43F 3QPKA 4NHUB 4ZAKA 5ABZA 1Z3GL 4OCRL 3T1WA 2IAAA 2WN2A 3QXDA 2X4SB 3GBNL 5IVZA 1FNEB 1MI5E 3QUYD 3NCJH 2BERA 1OOAA 1WEJL 2CUMA 1YEFH 3L5XL 4Z8LA 1ZTXH 2DJ4A 4OUOA 4TVSa 2UWEE 3KYOA 3OQRA 3AAZB 2E8YA 4HALA 4QTIH 1FUNA 5B39A 3MJ7B 1IAIL 1HSAA 3F84A 4XCYA 4EPSA 5CEZD 5T3XL 2BINA 4G8GE 1X7TA 5L4IA 4KXZI 1VPOH 1F4XH 4X0NA 2R8SH 3LN4B 4IKNA 1S3RA 3DIVA 1U91A 4DKTA 2FECI 3F00A 4YFLF 2IC2A 1BVKB 5DURD 4F27A 1OAYL 4WSGA 3BUQA 4KRLB 4MS8D 3RTQD 4Z7NB 2J2ZA 3V0IA 3IPEA 2NR6A 2DRUA 4CC9A 4D0CB 2BCMA 1PBYA 2WBJC 3S36H 4C58B 2ADGA 4XVTL 3C6LC 2DLEA 3PAZA 5I82A 1MJUH 4X8JB 1VDGA 4Y19D 4X6CA 3SOBL 5EMYA 3G08B 4HS3B 3NQKA 3RB5A 2J6EL 2PYFB 2W07A 5HYNB 1OE2A 1JCKA 1WUZA 2XWEA 1VZ2A 4FEIA 3KH4A 2ZCHL 2CO1A 4ZUUB 4ZO8A 1ZGLM 4NXSA 1PZ5A 4TQEL 4FMKA 5DR5H 5BUPA 1BOYA 3K2MC 5L88H 4J39A 2LVCA 5AVWB 4I9XA 3SZ6A 1KIUB 2B4CL 2RFXB 2WXIA 4LCWA 4OI8A 1DO6A 3BWAA 5IFHH 5C09E 4HLZG 1NL0H 2RMNA 2P9LC 1N19A 4N6QA 1DDHA 3DUHA 1QSED 1DVUA 1JGDB 1NMBL 1DLFL 1ULVA 4P2YA 5I5MA 3GIZL 2QV2A 1ZA3A 4MNGB 4JRFA 1VYHC 5E8EA 8FABA 4NIYE 3U0TA 3N3EA 4TSAH 3O11B 1G1OA 2B14A 2NY5L 3CVCA 3EO1B 5FGBA 3WDIA 1I1RA 4AIZA 5ID0B 3AQXA 1G43A 4WI4A 3B2VL 3S3CB 3PL6B 3SGKA 1N5YH 2A9CA 3WIHH 4F7EA 4MHHG 4JY6A 5I75B 2O6EA 5JPMB 1RSFA 4XE5B 3QRBA 4X42A 1JPSH 1DE4A 4S1RL 3ESPA 1RUQL 3W0WD 2HFFB 1F11A 4KK6D 1I8IB 1U8NB 3IXTA 1UWEH 2KQMA 3D34A 4JFOA 2Y7QB 3F58L 3QARA 3RNKA 4YDZA 5KDOB 4WI5A 4LQFH 3SDDA 1QKZH 1KGCD 1PX8A 1NFAA 1S78D 2ZSWA 2J1XA 4WV1C 1ZANH 3O6FB 4MMZC 2AJVH 1N2RB 4JEGB 1J8HD 2E47A 2ZNWA 3MUJA 3Q3GB 1E50A 3CCHB 3VQLA 4J81A 4OI9A 1A3LH 1QFUH 2H5UA 2FJUB 1BYPA 1A5FH 3EHBD 1MLBA 5I76B 5J13B 2CKBH 4JN2B 5B1CA 1QUPA 2HJ4A 1FGNH 1WFOA 3TV3H 1ACCA 2X87A 4BA0A 5EOTB 4J7RA 4DN3H 1RJLA 5HE1B 3U4EB 1AGDB 2YXFA 2KH2B 1C08B 1YPZB 4H1LA 4ICWA 3SKJL 4ODXA 1AR1B 4Y1AD 4WWKD 4WK2A 1GGBL 2VXQH 3FQ4A 2IH1B 1KNOA 2CPUA 3TBBA 4JG0L 3QUHA 1AYRA 2NQDA 4UV7H 2VLMD 5ANMB 1VA9A 1GPOL 3T08A 3ZGHA 5GZNC 4J12A 3QDJD 5TGBA 3DYPA 5I5JA 4JHWL 2HN7A 1P0SE 3MKGA 4NWUH 2VN3A 1BIIB 4FXGB 1S7RB 4JRYE 3KXFD 3S4SG 3S34L 1XIWD 2CD0A 3FT2A 3OKKA 3LEYL 1L9PA 3KGTA 4ZOZA 4L8SA 2NNFA 2XWTB 5DMGC 5HI4C 3KPOB 1BG1A 3FHAA 3QHZL 4NSKA 4OF7A 3MOBL 4KJQD 4NUJA 4RMQA 1NKRA 5I17A 5ICZA 3TF7C 5FUOL 3I50L 2ENJA 1OCRB 2XN9A 2ZWZA 5GJTL 1TQCB 5F3HA 5JHDE 2Z6FA 3VWKB 4ZO9A 2C26A 2AAVA 3HHSA 3HPLA 3FQ1A 1S3KL 4IJTA 2GSMB 2P5WE 3T8MA 1H5BA 4JDEB 4WKZB 4XGZB 1A0QH 2EEDA 1DQML 1JVLA 1MWAA 2CO0C 3VWJD 4LF3B 4MQ7A 1AANA 3R06A 3NIGB 1C5BL 5ADPL 2X7LB 3LIZA 4YIQA 2H3XC 1OGAE 1PDKA 1NFDE 2IUPA 4X63B 1BQSA 2PCYA 5FYJE 1M05B 5I1DA 4G6AC 4MCYB 3N0PB 5GGVL 4M4PA 4YE0A 1OSPH 4Z1PA 4J3BA 4A11A 3TO2B 2BDNH 4Z7OA 4GW4B 1CICD 3KPMA 4GXVH 1NBYB 4YBQD 4YMPA 1YY9D 5I0ZA 1KJ2A 2FO1A 3AXLB 5H2BA 3TONA 4D9SA 1Q4NX 3BPCB 3FUDA 2Y24A 3NJHA 4KJWD 2VSCA 3QIWD 4ZOXA 1NBQA 3TWCH 4G8EA 1MREH 4Y2DD 1JPFB 3PYCA 4PM1A 5DJ0A 5E4OA 1FV1A 3C99A 4NC1C 2MH4A 3QQDB 3VGAB 4FG6C 5FOBA 1X5MA 4N2LA 4WEEA 3SGJA 2PXYB 4M5YH 3BH4A 2IDSA 3QYCA 5CJQH 4KNUA 3AH8B 3ZE2A 5D7JB 4WUUD 4FFYA 4KDVA 2V9UA 2H1PH 4HK3N 1NIFA 4N8CH 4QHKI 1RIHL 1GYAA 4XP9H 3VSQA 2QZ5A 5LXVA 2Q0ZX 3G9VA 2NNCA 3VXSB 5EFIB 5T1DL 1DQQA 3CBJB 2DTML 1I7ZA 5KVDH 5IEHB 3DMMA 4ZDHB 3UZVB 5KG9B 3Q48A 3MRQB 1BAWA 1ITCA 1M53A 5CSZA 4JM0A 2XZQL 3CMOL 3L16A 3L4XA 3ULUD 3BPNB 4ZOAA 3WNJA 1X5ZA 4H0GA 3AWEA 5I73C 7CGTA 5I24A 5J8OA 4W93A 1BD2A 1A7BA 2UZXA 2X4TA 4U3SB 4LGNA 2O6CA 1FC1A 3FOLB 3W5NA 4GRMB 1MH5A 4KTDH 5EIVA 4NKMA 3FONA 3CFTA 1S7WB 1KOAA 2ZCZA 3P9LB 4MBOA 4D3CH 4FKEA 2CGYA 1KCRL 3FB8A 3ARDD 2VERA 4PB0H 5F70A 1WFUA 4D8OA 1MFAL 2VITB 4UMGA 4R2GC 4HD5A 4WI6A 1I2MB 2VC2H 3HVNA 3WN5A 4P5MB 2YD9A 1N6VA 2QQKL 4L4TA 1XB3A 4PHXA 4X7DC 5GIRB 3TEWA 1V05A 3U6RA 3F7LA 2HLAB 2HX9A 4MZ2A 2VR6A 3UPRA 3L8QA 5E99L 1AHMA 2Z35A 1UUSA 5D4JA 4CC4A 1OCCB 5K9KB 1QEXA 3WNKA 2CJUH 3MBEB 3FB5B 4NZFA 4KZDL 3CHOA 1KZQA 4PJAA 4XOBA 4LPTA 3SCMB 3EJJX 3D39A 4YDIL 1PZ2A 3UKUC 3VH8B 3VNZA 4Z7VE 5A2JH 1TJGH 3QNYB 4OY9A 4A7GA 2VLJE 3H0TA 2J12B 4Z76A 4PJAF 4V1DB 1P6AB 5FYKD 4JZJC 3DO7A 2A2QT 2Z2NA 5C0JB 3CBRA 3T2NL 4MLIA 4MSWA 2NZIA 2P9UC 2DMGA 5FO2A 4R7NB 4E9WA 3E3QE 1U41A 3IT8D 1HL4A 3QEGL 4ZUVA 4P5TC 1JXFA 4G6KH 4JHZA 1KGXA 3FTGB 1VCBC 1ONQB 5AW9B 2FGWH 1H8OA 2H47C 4YLCA 4DAGH 2WUCH 4TM9A 2XA8L 1A9EA 1OP3H 4KUCD 4ETQB 4Y16B 4I7ZC 1NM4A 1EK3A 2FLBT 4UINL 3O8XC 5I1EL 3RWGB 1W0VA 2JQZA 4PTUB 1XKSA 1I9IH 3GZQA 1BVNT 1TTFA 2FEDD 4M9OA 4IBVA 1YYCA 4LSSL 4B9KC 3QJUB 1SHSA 1IUZA 1GZQA 2AK1L 5AMSA 4X9YA 4PD4J 4FQIH 2XI9A 4J3SA 1E7UA 5TDNA 3RN1D 4NRYB 3G6JB 3OX8A 4WGKA 4OCMC 1UB5A 3CQFA 3TBTA 2HVKB 4KTYA 3WY4A 4ZNEA 4K3EH 3WS6A 1QATA 1YFQA 3IVKA 3AB0B 4J1UB 4ABWA 4GZ8A 3B6SB 1UVQA 3F7YA 1ZTXL 4R6UA 3KBPA 4GQ2P 4MGXA 4F2FA 1N0XL 4QTIL 1QLFB 2APTA 3N55A 5BMFL 1TQWA 2DMHA 4YOKA 2XIBA 3OXSA 3VFGH 5IJ7E 1JPEA 1E0OB 1F4XL 1HIML 1VPOL 2DKSA 4M48L 4K5OA 4PJ5D 4Q6KA 1IVTA 4HP5A 2R2HA 3QT2A 4D0DA 4PRHD 2HJLB 4UNUA 3FT0A 4G6FD 5T1LD 2V3EA 4X5QA 3QIBA 4NENB 3OR7B 4BDVB 4QRPD 2XIDA 4HK0A 3TFKD 3TWYA 1X5HA 1Z9SB 1AFVH 4KFMA 3LS4H 2D3NA 2CBTA 3RPIB 5INCA 4XMTA 2ZUYA 4PSPA 2NY2D 2D03H 3VRIB 1MJUL 4OT1L 5EZLB 1AOZA 2Q76A 4JPWH 3BEWA 1A7PH 1GYCA 3EYFB 4FLOA 2JIXA 5CEXA 2WBJB 4NPKA 3C6LB 3DRTB 1A6AA 1U8LA 3ZKQD 1ASQA 4TNGA 1PQZA 1RZKL 3AG2B 1T66D 1PEZA 2I60L 5I1HL 2B20A 1MVUA 2Y2YA 3CSYA 1OXYA 2PWGA 4JFHD 5CCHE 5FM5M 3FOMA 3WMQA 2WLNA 5DD5H 2C9QA 1NL0L 1VE7A 4LLYB 3KPRD 4GAGH 3W11D 3V4VH 5DZVA 4TUOA 2PM6B 2DEXX 5FA4B 5AUMA 5B3SB 7PCYA 2VQ4A 3WAJA 2HKAA 3LKRA 3VFTA 3FN9A 2V0AA 4LHUA 3ZTDC 1YQ2A 2SEBA 4LAJH 2L3BA 5HYJD 2W38A 1YEIL 4XODA 1M4KA 5E6ID 1DEEB 2IAND 1QBMH 5DEGB 1LO0H 2HKHL 1J1OH 3HAEB 3C08H 4YLQT 4ODHH 3ILPB 1DUZB 1JPSL 3ULVH 3IIWA 1P7KA 3BIKB 4EIGB 3K4DA 5K59E 4OFYA 4K8RC 1N70A 1ZEAH 4AVJA 1RSYA 2R15A 4IKKA 2J71A 2P46B 3QUZA 5T8IA 2IQAB 1JK8B 4AQOA 4FQXD 3WFHA 5C0CD 1U58A 3KS0J 3NIGF 5I6XB 4LQFL 6PCYA 4LKXA 5SWQB 1UEMA 3LKQB 4CBPA 4A2LA 2VZ1A 2C4FT 2XWCA 1JWSA 4NJAH 5DRNB 4JO8A 3W9DA 1NUDA 1QI4A 5I6KA 1FIEA 2ZXCA 5IT9g 5DJYA 3TIDB 1A3LL 3CFJA 3MLXH 1TZAA 2VO8A 3CVBA 3QWRD 3SDCA 3Q2CA 2AGWA 2CUHA 3SKNA 1F58H 5IHZA 2CKBL 3TM6A 3TCXA 4QD2E 1FGNL 3PNWA 4HCFA 4AYEC 1J5HA 1U8HB 3CH1A 4G9FE 3TV3L 3US9A 4E0RB 1IE5A 1W8NA 1A3RH 1IFHH 3OL2B 1SY6A 2IH3A 1TU2B 3HB3D 1G84A 3NACL 1U9KA 4PJXA 5KSBB 3EI1B 4M62H 3B7YA 4P2RA 4KO5A 1GVIA 1OP5H 2QPEB 4M3HA 5HE3B 5I1JH 2ARJQ 2BJMH 3ARGD 3RY5A 3IGAB 3JWDH 3RJOA 2J21A 3RX9A 4PJXF 5IWLA 4P57B 5EUOA 5GGVY 4WSKA 3DTXB 4RIRA 5HHPB 43CAA 1B0RA 3MRFB 3NEOA 3AUWB 3KPQA 3KZ8A 4PGDA 1PAZA 2F8OA 1QSFD 3FQWA 5A43C 2NUPB 2HT2D 4NWUL 2WINA 1I3UA 4IKIA 2CR0A 4F3FA 2XL2A 1UH4A 3DWTA 4FDWA 2E9BA 2QKIC 1IBHA 4WI2A 3CTTA 1NANH 4K55A 4JCMA 4MKTA 3OKYB 2R59A 5E2VL 3B1UA 1ZHBB 1XCTB 1F1GA 1KG0A 4PBZA 3U30B 1JZ5A 4YHKH 1USQA 4WHTA 4ZFGL 1NCCH 3I2NA 3QPXH 2AEPH 4N87A 4PVBA 1NSNH 2YAMA 2ZAGA 4YUEH 4LSUH 4UM8B 5B8CA 5K69A 3PY9A 4AG4L 1TZHA 1JTPA 1NBVH 3UH8A 4N0CD 3VFOA 1H2YA 3PUUA 1L0XA 1A0QL 4V11A 5TE6H 5LN8A 2L7UA 3MXVL 2GKIA 2XZCL 4WHYG 5L4MA 5H17A 4M61B 4X4YB 3UVMA 3WJJA 4PBVC 2PTVA 3T1FB 4I79A 3QNXA 3NDZE 4HIHA 1JZFA 2ZOKA 3BGMA 1UD3A 4LPVA 1OSYA 5D96C 5L2KB 1FVDA 2MEJB 1X4XA 1MG2C 2M8XA 3UP1A 5HHMB 4LAQH 1PKQB 1FFNA 1ZVSA 3AFCA 3ZE0A 4OZIE 1UWGL 1XX9C 2K7PA 2FLMA 1CD1A 1D3CA 1G9MC 1DBKH 1I85C 1SNRA 3MV8A 5CIPA 5JOPD 32C2B 5AYTA 5EO0A 1J0IA 4OLUL 2DMBA 5KBPA 4BK8A 2EC9T 4BSVA 2K3HA 3Q6FA 4M1CD 5B3JE 2E5EA 2XACC 3CUPA 1M57B 4I1PA 3WJMA 4HDJA 2X9YA 3MRNA 4MAYA 3MDJA 3VCLA 1I9RL 3P2DA 2YN3A 2P26A 4KJPD 5JR1L 4H88H 3P4NB 1B88A 3SDYL 1TZGL 4LSVH 4L2LA 1UM6L 1XH0A 2O6FA 3GSOA 4LOUD 1BWWA 3JBG7 4JFPB 5CJQL 2OL3A 4HUMB 3ZGIA 5D6DA 3ILQC 3BJLA 4Z7UB 2HP4A 2DQJL 4HG4K 1V54B 1OF0A 1QRND 2D9QB 5FLVA 1JYWA 3X13B 3FAXA 5L8LB 4JS7A 4PTTB 3K6SA 5M5VA 3QDME 5AVQB 2H2SD 5FYLE 1I4FA 5EZOH 3GDBA 4P3DA 1I1YB 2AJSH 2JJTA 5KVDL 5E2WL 2NY7H 2ZP8A 3FQRB 4R5XA 2X89D 4XPBL 2KLSA 4AEZA 5JORA 1RVFH 4OZHB 2HPTA 3ARFA 3U46A 5LG6A 5GS0C 4FYRA 4ZPVA 3T4AA 4YHIB 3OB0K 5ESVA 3ROLB 1XGUB 4UNVA 2P7TA 4QWWD 4G8GB 1ITBB 3DUSA 3TPKA 3ZZQA 4WFHE 9PCYA 4G6JL 1XF3B 3GUTA 1IKNA 1KN4H 2IPUG 2Q5BA 3QUXD 3X3FH 1M1XA 4FQLL 1EJOH 3DIDA 3GTTA 2AXGA 2NY4C 1H6UA 4KTDL 2ZPKL 4DO5A 2ID5A 3WE1A 1SYSB 3S2AA 4BFRA 2H41A 3IJ8A 3Q8FA 4FF9A 4L3CA 3EZ8A 3G6JF 3UXFA 3VFRA 3K2IA 4NQCA 4LU5L 2OIZA 3ZR5A 4D3CL 1QO3B 4WTZA 4GO9A 4MJIB 3V0AC 2BXYA 3DSFL 2UUDK 2G30A 3ARWA 1UZ6F 4QQEA 3K5SA 2ED6A 2WLHA 1WZKA 1VENA 1RUPL 2VC2L 5HHOE 3TH2T 4OF3A 2YPVH 1OARH 1BM7A 1FAIL 1OAZH 2BHZA 3ISRA 5C0AB 4P5RA 4FA8A 5BZXA 4EN2A 1EEZA 4EO5A 1GOFA 2ZT9C 3QFJE 1GTFA 4H25B 3EGDA 3PDOA 3MRJB 2OZ4H 3QXAA 1G9NC 5E2UH 4Y88A 3A22A 4JDZA 3RVWC 5FECA 1FYHB 4LDEB 5HYIA 2CJUL 4L5FE 2DN7A 1W72L 2F58H 2GTWB 4OGYH 3U2SB 3VX1A 1D5MB 5I66B 3I8CA 4QXUL 1PG7X 1BFVH 1C5DB 3OZKA 4JPIA 5E08H 3QPQD 3FUIA 3KE0A 4DESA 3MCG1 3BRGC 4M6ML 3FT3B 3BVUA 3NJNA 3Q5TA 3UAAA 2HKFH 2OSXA 1RZJH 1HI6A 4O02H 1KTLB 4XNDA 4HYTB 3FQTB 4NQED 1NC4D 2WXQA 1KBVA 3DX3A 4FHLA 2AQ3A 4WNJA 1DO5A 3NP3A 4JZJB 5D1ZD 2P44B 3O3DA 5LBSA 5JQ6H 1X5LA 2W9LA 1GGUA 1M2VB 1G7HB 4B27A 2DQUH 2WTPA 3N50A 3ZQXA 1KDJA 2YGVA 4X99B 4FA9D 2F53E 2VDOA 4KGJA 1ZV9A 2VR8A 4P5TB 1KB5B 1CGXA 2OJZH 2J6WA 4JY5H 2P45B 3ZUNC 1YEKH 4UI9R 1T20B 4PCSA 3PXLA 4OLWH 2JI3A 4NNXA 4KNSA 3QXVA 5JXED 1AGBB 2D7PA 4X9FA 4ERSL 1FI8C 3TIEB 3SEPA 2MTAA 1NQBA 3HVDA 1VF5C 1WBYB 3O8XB 4GRWB 3D08A 4LLQB 5DD0H 5EIIB 4IRSB 1R3IH 3S3JA 2OP4H 3LJ3A 5DGQA 2LGNA 4X98B 1U8KB 5BV7C 2KZWA 4RDQF 5ITBH 4K3EL 4DF9A 5JQIB 1Y07A 2UZYB 5SX4H 3LZFH 1T1YB 2DQHH 2YPLB 4PPTA 3HC4L 1RKRA 2EO9A 3HJEA 2ZCKH 3RZCB 1JNHB 4JO3H 1A7NH 1IU1A 4ATTA 2X4QA 4D94A 3VFGL 3P3YA 4QTHA 3U0WH 5DJXA 3PP3H 1BZ7B 2CLRB 2VM3A 4M4RB 4DGVH 2P28B 1DBMH 3WFBH 4KNTA 4HPHA 1W16A 2XFXA 4WV1A 4B9JA 2B0SH 1QWUA 1JGUH 1OEZW 4MMZA 2IQ9H 4CNIA 2CBOA 5FDYA 5I0XA 1QTYT 1TJHH 4TNVF 5CP3A 2CO7B 3D3VE 1U4EA 2Y6SD 4JRYB 4KBPA 1ROCA 4G1EA 2FHCA 2CN3A 4R7AB 3LS4L 1PCXA 3MRLB 3Q01A 1F41A 2OYKA 2AQRA 3QQNA 3APDA 5DWUH 1X3DA 2DIBA 2DMCA 4JPWL 5D72H 5DI8B 4AV5A 3GKWH 1A7PL 3KYNB 4PBDA 5J6HA 1HE8A 1AQDA 3BCFA 4HBCL 2NW3A 5KSBF 2X4NA 3WSQL 3V5KA 4M8UA 4ESKA 5CD5C 3GD1I 1E2WA 4ZG1A 1G9HA 1XGRB 4P4KC 1NCBH 2HZHA 2VWEE 2Y2WA 1TR7A 2I07A 3B5TA 5A16B 1BGXH 1BYNA 2AK4B 4W9CC 3LKOB 1LMKA 5GZNA 4BV1A 3DSMA 2W95A 5DD5L 1TVDA 1VACB 2PCFA 4GYBA 1KPRB 5EZIL 5IFAL 4GAGL 2OMWA 5AVYB 2Z4QA 4EDXA 5C08A 1GHFH 1KJVB 4OV5A 1JWUA 3MRRA 3FCBA 4MJ2A 3BG0A 5GGSB 4I1RA 3UJTH 2JLLA 3NJXA 1JYNA 3F7KA 1WS7A 3TN0D 5HHXH 2C9UA 4QF1B 1OP5K 4BFEA 4FAAB 4JSXC 3LRKA 4GM3A 3DOIA 3D07A 5IR1A 3RFZA 2C7FA 3GIVA 1ZS8A 3O9WC 1H9VA 1H3PL 4XCCL 4X4XA 1J1OL 3GDCA 2R56H 3K0YA 4QHUB 3SPGA 2BVQB 2R83A 2C5DC 4ODHL 5HDWA 2FX8H 3ULVL 2GK0A 2Q7QA 4AQAB 2Z0UA 3ZN6A 3FZUC 1XH2A 4L0YA 1QVOA 4TNEA 5LGYA 3PQYE 1FNGB 3RVVD 1NZRA 1AIFB 2WO2B 3ZDYE 3V6OE 5A7EA 4KVNH 2CO0A 4Y5XC 2WLMA 3B2UD 3DGCR 3D4GA 1QLEH 1GC1H 2IPTH 3NVNA 2HPOA 2IOMA 1VFAB 1ZA6B 4ZPTB 1FLRL 1CFQA 3JT2A 4AK2A 1S7UA 4MA3A 2CNYA 1I7UA 4OZFB 5I8OH 3PNRB 3MRPB 4H1LH 3H54A 3EOAB 3MLRH 2F54B 2GK2A 4FJYA 4JB9H 1D2PA 1QNZH 5FM8A 2APSA 2E7LA 3E9UA 2VUYA 1S9WA 3L4ZA 4NKQB 2K9UA 5HYEA 4PJDA 1FZJB 4CI1A 1J1XH 4YZFE 4LDLB 4HIJB 1NIAA 1M56B 2YKLH 3KWWB 1HHKB 1C7SA 4BCXA 3KR3L 4JFWA 1A3RL 1XO8A 1CFTA 4OD3H 4O2EA 1YUHB 5DRZB 3T65A 3BD4A 2XWBB 2VDLA 3E6HB 1M2OA 2EE3A 1QPKA 2X10A 2X4RB 2A6JA 3C9NB 4IS6B 5IESH 5BS0B 2BJML 3JWDL 4IRJC 3POHA 3VA2C 3C6EA 5EO9A 1A65A 3OAWA 2ICEC 3VI4E 1G7IB 4NBYB 3D2UB 3FYEB 3IDJA 1OCOB 4PJ7B 4GLRI 5L9DH 1IM3D 2OK6A 4PMFA 4OV6F 2V9QA 4NM4L 1MI5A 1OTTC 4N2EA 2A74C 3HNSL 5G5DA 1DVTA 2UWEA 2NX5A 4LCIL 4JZNB 1MWAH 3ZRSA 1TG8A 1J05B 2EDJA 1XH3A 1FIGH 1XF1A 5GRXG 4AQ8C 5KSAC 3BAWA 3GMRA 3LIZH 4U1HA 3RN0D 3V5DB 1NCCL 1PX4A 2FBJH 2EKSB 3HE7C 3K74B 3KPSD 4OZHF 4NZRH 3VXNB 1A4KA 1D7BA 3CAFA 4LL9A 1SHYB 3OAZK 3DIFA 1JF1B 1S5IH 3MKQA 2ORBL 2K4AA 4LSUL 1S5HA 5ACMA 3L9RA 1BFOA 2Q2EB 4LIQE 5A2AA 1NBVL 1B2WH 1CZ8L 2B3RA 3CZUB 5TF0A 3WXVH 3QUGA 2A4CA 1MCWW 4N1HB 2H9GA 1HYRC 4YHYC 4IEFB 1XZ0A 1A1OA 1AGEA 3FRUB 5LAPA 3K91A 4LCYA 1OIOA 2BOLA 1DJGA 3L17A 4LPXA 3ZKMD 2MKLC 3QUYC 2C4FU 1XGTA 1R46A 3IS0X 4X7TA 1GXRA 2E6JA 2PW1B 3I75A 4JJOA 2VXUH 1N6FA 2B39A 3EDFA 2L0DA 1EANA 2QHRL 3QH3A 3GO1H 4BH8B 5T1JA 1DBKL 5CWSA 1T4KA 2X4PB 4KO7A 5D96B 4BP9A 3WLBB 4DPRA 4NC0B 1ZT7B 5ITFA 4K5MA 1OM3L 3HNVH 4FFYH 2C1PA 3UYRL 1U93B 3ES6B 3ZXAC 1FCGA 4DP0X 5C09A 3E2HC 1J0YA 4YSOA 4FFVC 3ZIMA 1WWCA 1GGIH 3EI2A 4LSVL 1HEZB 4MS8C 2FJFB 1GOGA 1I3RA 4JANA 4XP1L 4EQ3A 1PSKH 1WAEA 1EHLH 2O61A 3G9AB 2WAHA 1I3GH 1TO5A 3IN2A 3QQ4B 4NIKB 4P2AA 5DA4A 4B3EA 4BK4A 2FIKB 1A12A 4DZ8B 4J86A 1WD8A 4LEOA 3I9GH 1GZHC 2BRRH 3N41B 3WENA 3RL2A 1OB1A 3WMSA 1PY4A 3C6SA 4YHNB 4HUVB 1JWMA 2AAAA 1LYQA 1NMAL 5EZOL 1BW8A 2BM3A 2X4UA 1NUFA 2ZWLT 5GSVA 2XTJD 4HUUB 3L3HB 1XF4A 1MFMA 2H1LM 3DV4A 1E40A 2NZ9C 3EBIA 4Z8FL 2EUXA 4ZMVA 4KH9A 4ZYKB 5B4MD 5JIIA 4IGBD 4A04A 1GGTA 1EAJA 1SLXA 4M7ZC 4F7TA 2F7PA 1UZ8B 3NJVA 2XV3A 3JWOH 1TZOA 1BQLH 3U9PH 4URTB 5IM7A 3FQXA 4WI0B 5E0QA 3TZVB 1KN4L 4QRUA 3X3FL 3IMVA 4M43L 5F2FA 4GRWF 2IAMA 5F96H 3RX5A 4APQC 1D7FA 3SYAA 3H55A 1U92A 3WU1A 1AHWA 5KTEL 3U6XA 3I3DA 3JV4B 1WTLA 2NY4B 4XN2A 5HHVL 4AUYA 4CVXB 1AS7A 1KFGA 3DK2A 2PPFA 3REVA 2P5EB 3C8KB 2YRPA 5TPWL 4AQZA 1CD8A 3BQUA 4BH6A 4KXBA 5IBLD 4G80A 3IUQA 2ATAA 5T33H 5SX5H 3BN3B 3P0GB 1XCQB 4JDTH 5CHNA 5CGMA 2VWEC 4AN1A 2EXYD 3LEXB 3QG6B 2EICA 1VRSA 3VDCA 1A7RH 1S78C 4EVNA 4PLKD 1N8ZA 3ASOB 4FZ8H 5A2CA 3BEVA 3UTSD 3NEEA 3B5HA 3BYTA 2EXWD 1F90L 2F58L 4OVVA 5D1XB 5D7KD 3RKPA 5KYYA 4YSPA 3NEXA 4HXBL 1G7QA 4WI8A 5J9PA 4FJZA 4PRPD 2EO1A 1RUMH 1SLWA 4WNSA 1RUKH 4MDIA 3TO4B 3EHBC 3VB8A 1NINA 3VDAA 2NTSP 2YC1A 3N9GL 4X8GA 4XXDA 2HKFL 3VFNB 1ORSB 3MLVH 3ARUA 1RZJL 2EUWA 3VXMD 4GQ1A 4JO1H 5MENE 2AGJL 4L8CA 1TVHB 5E2JA 4J27A 1TQBB 2MSPA 1SDDB 2FE0A 1FO0A 3S4SA 3UTTD 5JHDA 2EXSA 4J8RA 2RA1A 3GPSA 3MQIA 2YA2A 2K1MA 3C60D 2ZJSH 4U1JA 1U8OA 4PG9B 3V6OC 2CLZB 2OJZL 1KEMH 3GSXA 5FO7B 4JFXB 2CE9A 1A7OH 4BGLA 3MGTA 2FT7A 1HE7A 1K4DB 1N8OE 1WVZA 2AFNA 3GLAA 5LQBL 5B1JC 1S8DA 4NN6C 1DN2A 4MS6A 1OGAA 4U1LB 1NFDA 1EO7A 1MRFL 5D7HA 4AEIH 2EIZB 1JV5B 4G7YH 1YAZA 4N0UB 3VI3B 3FQUA 3KCWA 4NQVA 1OAXL 3RVXD 3T04D 4MXVE 5DD0L 3P9WB 2Q6WA 5TDOB 4HOWA 5T3XE 3WUZA 5JW5A 3AWFA 1IAKB 3IAPA 5JTWA 3S3SA 1DZ0A 4XPTH 2XVKA 1CGSH 4Z7QB 5M61A 25C8L 1XD1A 4OSUH 4GUPA 3L3OA 2W91A 2DQHL 2CBQA 5FF6B 1UXWB 2GW5A 5AW8B 5BV7B 2DYSB 1BX2A 3IF1A 1BHGA 1A8JH 1NCDH 2R0KH 3MO1A 4OCYH 4UDUA 4ADGA 1OGPA 1QYGL 1X9QA 1A7NL 3V7DB 1IC1A 2WTRB 4NO0A 4AGOA 1E67A 1KFAH 1O7DE 1YJDH 2I24N 4PJ9C 4EUPB 5HYSA 4K9JA 4HH9B 3U0WL 3A0FA 4LVEA 2QT6A 4YHPB 2DI9A 2ITCB 5BZDA 3AXHA 5EU6E 3RP1A 4X60B 4A0BA 3UCQA 2ADJA 3AREB 1PX3A 4Q9QH 4L3HD 3IYLW 5JOEA 1TVBB 5C07E 1C9SA 4LOEA 4I3SL 2IWKA 1KYUA 1XQ4A 3BHBB 1X5AA 2VXTH 4Z95L 5GGRY 1JYXA 2IQ9L 3ZE1E 2JCCE 3HIZA 2PTUA 3L5HA 5ENWB 1XGYL 3DYMA 4R4FH 4GP8B 1YY9C 5C0EA 4LCCA 5B7FA 2A9DA 4P2QB 2I5YL 2QQLH 3GKWL 2XIIA 4Z5RB 4KJWC 3QIWC 4XCEB 2GT9B 1DJZA 4CDHA 1YY8A 2J5WA 4ODBD 4Y2DC 2ZOOA 3CFVA 5DHXB 2UV3A 2DQCH 5DJDA 1DJWA 5ID1A 1O6GA 1NAKH 2NY1D 3BT0A 1NCBL 1SGKA 3OKOA 3QUMA 4HSQA 2Z1PA 3L9EA 4IU2B 3CFNA 3IBOA 4L8BA 4N6RA 4N9OB 3SYQA 3X17A 4ECNA 3S8GB 5IJCC 3W38A 3Q8BA 4NQDD 5LVEA 4GW5A 2EIMB 3CZNA 3U4AA 4P4KB 2ZUSA 4MJ4A 4PJ7F 4E41E 5KVEE 3GZPA 4JAMB 3I3EA 4XNYL 4BUQA 3WDJA 5M7QA 2QKIA 2YJQA 4XVJH 5I18L 3WFEH 4QRRA 2V3FA 5KAQF 4OCWL 1DBJH 1IC4H 1A66A 2CRZA 5HHXL 4FYSA 4WF7A 5IOKA 3W5MA 1M42A 5DS1A 1Q1JH 3SE4A 1SYVB 1UWYA 1T04A 3CFCL 3OJVC 5MHSE 2WXJA 4GG6B 1FGVL 1G7MA 3L7FA 4KV5E 1SXBA 4U6YB 4BWUA 3BLBA 3BP4B 1TQUA 5F7DA 1CTMA 3STBA 2ZAIA 3KJ6L 3HC2A 5C2BH 3P4MB 3SFZA 3P69A 1RK1B 4PRBA 1BZDA 1EGJA 1DYZA 4PJIB 2CSPA 4OZGE 4Z7VA 1CT8A 4PRNB 5E23A 1B0WA 1JL8A 2K8MA 2VLJA 2VDPB 3AQDA 3GJFK 3I6LD 4XWOC 2V2XA 4I3RH 4XX5A 2UXVA 3NFPB 4F7PA 4ZO6A 2M26A 3ARDC 4OU3A 4C4UA 2Y1YA 2QSCL 3L1GA 2YD1A 5I8OL 3IJHA 2CO3A 1MY5A 1ZPUA 2WV3A 3TNMB 3ULVD 1MG2A 4FTVE 1YYLL 2A1WL 1IFGA 3MODL 4AITA 4F2MB 4ZMAT 1OAKH 1NCAH 1MFDH 2LU7A 5HDOA 4XO9A 5CXBA 2L4OA 1J1XL 4DP7X 1I85A 4HU8A 3WIAA 2WO4A 1JN6A 4HWEH 4MD5A 1C1EH 5EAPA 1FFRA 3BMWA 4OD3L 4WSJA 3E7JA 1ZE3C 4YWGL 3IVMA 4CMMB 3N1QC 4L1TA 2EUVA 4X5WA 2EABA 4R97C 1FNLA 1M6OA 1X9LA 4IRZA 3FB6B 2NQ3A 4CL7A 2A83A 3NN8A 1JPTH 1BBDH 1Q0EA 1GXEA 3RILA 4YHMH 4YEFA 1E43A 4QIRA 4YDJB 1BZ9B 4WDIA 4UZUA 2KL6A 5E0FA 2KHAA 2OXGA 5C97A 4IRJB 3N41F 3T3PB 2JF1A 1UH2A 1F4AA 3LRSA 5JDSB 4ZOCA 3D87B 1IT9H 4ABUA 5C0IB 2CIKB 1FN4B 3QDGE 1DVFA 1RJYB 4ZRGA 2FR4A 2ADIB 3A4EA 2ICWA 1FIGL 2CU9A 1T3FA 5C0BE 3RUGE 3LIZL 3FF7A 1SQ2N 4MMYA 4KNQA 2QPDB 4CY5A 4NZRL 3NPSC 4LSQH 3L3GB 4K7PH 2W0LA 4FE9A 5KSAB 2CDEA 4UV4H 3X1GA 7PAZA 3GJEA 4NM8H 1NCNA 2FSEA 2W60A 1QHPA 2FSDA 3HE7B 5AG8A 3FO2A 1ESOA 1KJMA 1UOVA 1YEDB 3ECVA 1D7DA 3QEQD 5F9DC 5LCVA 5IV2A 5CIPH 4UQ2A 5EIIG 3QJZA 1XBRA 1U4FA 2O9KA 1MIMH 1KJ2L 3LB6C 1CG9B 4FL4C 1UD8A 2QL1A 3ROOA 1TQTA 3L2LA 2Q87A 2AJXH 3UJJH 2X09A 1KCKA 5T5FA 1MRDH 3STZB 4YHYB 2IPKA 1G6VK 1GMIA 2Z93A 3AT8A 3PWVB 1KEGH 2IG2H 3QUYB 3K4AA 3ISYA 4E9RA 1TDQA 1U3HC 4ADJA 1H6FA 5DO2C 2ATPB 2OL3H 3QSKB 5IB5B 4KKNA 3DX1A 3HTLX 1HH9A 1SOKA 1T7XA 1P1VA 4A1RA 5JHLA 5FQDA 3LOWA 1VKXA 5C7ZA 3EO9H 2DD8L 1N64H 1OF2A 4XN4A 3RWEA 1MOEA 1Q38A 1H19A 3ELAT 3BZFB 4BWTA 4R9HA 4GT0A 4AGPA 4IA9A 3HI1A 4HSAC 5DURB 3QDHA 3CG8A 4UAHA 1Z5LA 2VJ0A 4I2XA 3FCGA 4K4KA 1XF5A 5CGYD 2ENYA 3E2HB 4LVHB 5D5MB 4H8QA 5IKCA 2CHZA 5SX5K 4IU3A 3GRGA 3RTQB 3R4RA 4MD4B 5DSCA 4UTCA 1CF1A 4AEEA 3VO0A 3FN0L 2AQNA 1ACXA 4E54A 5DVLA 5AG9A 3IDNA 4JFYB 4Y19B 5DUJA 1UD2A 3VMPA 1PZDA 1VERA 3UCRA 3D33A 3HZ3A 5LAXB 1AGFB 1K8IB 3ZT7A 4PR5B 1MDTA 2DYPA 1IAOB 5DHYB 3IK2A 2OTWA 3HN3A 1E6JL 2AXWA 1K5NB 5CP7A 3WEBA 2IPUK 3JAMg 4PBWD 4QTFA 3EADA 4X50A 1LEKA 1BQLL 2CK0H 3KLAB 4QAWA 2X6AA 4R5TA 2VDKB 4M02A 2WVTA 3SYPA 4RAVA 3KCPB 1Q9LA 4FRWA 4ISVA 4ODTL 4PJEB 4ZZKA 4XBEL 1NGZB 3IDIB 4AXWA 3PE7A 2EEFA 4HJGA 4GQ9H 1P5VB 5E4EC 5D2LE 1X9RA 4H0HB 5E6IC 1TZIB 5DF0A 2B4CC 2F7QA 2Y7NA 3A4AA 1OP9A 4Z3EA 4Z7QF 1D2OA 1IARB 1B2YA 4AWJC 1MW3A 3MX0A 3I7KA 4TNWF 3N0EA 2FEEL 2HA1A 2CQVA 4G9FA 2XBDA 3K1DA 2F18A 4J77A 3Q9PA 4KQ4L 4LVNC 2ADYA 1KCUH 2GBUA 1I1FA 5T33L 1HILA 2ED8A 2AGXA 4JDTL 2NY5C 3GSWA 3CXHJ 3JSSA 1WUNT 3HE6A 4XN8A 3SE9H 4PWFA 1KLFA 1A7RL 1GR7A 1M71B 1V5JA 2XL3A 4I5BB 1LWHA 2OTUA 3AITA 3QCTL 4OIFA 4IOFD 4OZFG 3BAXA 4Y4HA 2G9HB 3O41A 4LP8A 1I1CA 3ESNA 3ALPA 3K72B 4IKLA 3DX0A 3UAFA 4P59H 3FCUA 4ORGB 1HQRA 1V3LA 4ETYA 5EC2A 4YHOH 4ZMZA 3U7WL 4JG1H 4NLAA 1FVCA 2V3DA 2XU9A 4HUCA 2WM0A 4CY2A 5IB4A 3JV6B 1UASA 1DVZA 3HB3C 4PLJD 3EHBB 4UIKH 5IMMB 4CRPA 4NP4L 5I8KH 4F80A 4LGSB 1KIRB 1ZLEA 2MTAH 2RGSA 2VL5B 5DHDA 1ZDQA 3HUJA 5TQ2L 1U8QB 2IJ0C 4JFZH 1I7TB 3S35L 4QAMB 4ZMNA 3HAEH 5E2TH 2BFGA 4XNUL 4EI6B 4Y1AB 1EFXA 3TT3H 5KS9B 5M5RA 3IJ0A 4QRSA 1FLTX 1KEML 4N0FA 2XPGA 1A7OL 4ANVA 3APCA 1F6AB 2BY1A 5LGHH 2IUQA 1LO4H 2CMRH 1L9TA 1OHZA 2G60H 5EEZA 3JZ7A 2GJ6D 3RU8H 3QDJB 3WCYA 4N1EA 1CFSA 4AEIL 3K71B 3L7EA 1A6VL 2PYEE 3OMNB 5DD1H 1JTDB 2MQGA 4N8VB 2V7HB 4QL1A 2OR9H 2FO4A 4CSZA 4OZIA 2EKJA 3RWJB 3T3MB 1E42A 1E9OA 1GSMA 1NGPH 2IH8A 3EOTH 4XPTL 3E8UH 1CGSL 4CU7A 5A3ID 1DQIA 1MFBH 3O9WA 1V7ML 4Y4KA 2N59A 3DV6B 3J27A 4Z18A 5T3ZH 2E46A 2UY7B 3KYMB 3CIAA 1RU9H 1U2HA 2AV1B 3HI6H 3QJTB 4N0CC 3ZZLA 2H8PA 1NCDL 4L8DB 2HYEA 3PGCB 1M7XA 1MHPL 4OCYL 2VAAA 2YUXA 5CP3H 3GSVA 3TBWA 3P3TA 1AO7A 4PJIF 4FABL 2XXFA 1KB3A 4MXWL 1KZYA 4Y5XA 3D51A 4J3WA 1R24A 4PP1D 1VZHA 2BIOA 4AYFA 3L4TA 3P40A 3V0EA 1BA9A 3LN4A 1J9QA 3WL9A 1CO1A 5CEYB 5DZ9A 1BVKA 1IC7L 1YDPA 4KU1A 2VDRA 3ZSSA 2C9SA 4IM8A 3VI4B 3HMXA 3QDMA 4MD0B 3IB4A 3DUUA 2NNAB 3MRIA 2BP8B 4Y9FA 2NR6D 4P4RB 4JRXE 4CY3A 1PKOA 3OMAB 4W9ZA 4M1CC 2BY0A 2ZOLA 3ARZA 1SMAA 2CO6B 4FQCH 2VRQA 1WHOA 4F8QA 3U2IA 5J6GA 1P9MC 5HY9B 2OJEA 1NMCC 4LRNL 1E6OL 2Q8AH 1HWHB 2JKLA 4EE2A 5I15L 5KVGL 1EWHA 3QI9A 1LTXA 3QS3A 5F6HI 1IGML 3H3PH 1BZQK 3QIWB 1GL4B 1KTDB 4QY8A 4Y2DB 4NQSB 5EHFA 1Y1DA 5JZ7C 1AXSA 4AYGA 4PREB 1RFDH 2Y3AA 2ICEA 2XU7A 1O6TA 2VDQB 1BLNB 1U8MA 4I87A 4HUWA 5F72S 3THMH 2J56H 5ECJE 3DDGA 2HYMA 1CGYA 3F5WA 4WUUB 1FPTH 2MOVA 4UQBA 2A74A 3QFGA 4NZJA 1IC4L 2K8QA 3N1FC 1UUNA 3MNVA 5F1OB 4GG8A 5HHOA 4MA7H 2XG5A 3P4LA 4P2OA 1LP9B 1IC5L 3G5YB 4TQ8A 4N68A 1A9VA 4AQ8A 4F5CE 3KLHC 4H8WL 4LG8A 5C0DB 2BIIA 2X12A 3QFJA 1RERA 1T83C 1W8EA 2H32B 4BELD 2FAUA 1IGJA 2RALA 4Z3IA 3P2BA 4XNQB 3MRCB 2FJHB 3QUXC 1WIUA 5DEFB 1ODAA 5BO0D 3UVKA 1UCBH 1F3JA 2R1XB 5F93C 5JHLL 1T1XB 2LW3A 2WNXA 1JZEA 3NFSH 4AZUA 3OKMA 3MKKA 5GS1C 4A2HA 2FHFA 1S9XA 2VGLM 2BZDA 2Z3FA 4I8DA 2F7RA 3X2QB 4LLWA 2QZQA 3L3JB 4WU5A 5FGSA 3SD2A 2X1QA 1CK0L 1JXKA 3SDDD 1TITA 1MCOL 1SY6L 2A6KB 5AEAA 4BCZA 1FZOB 2C4XA 3LSOB 4K2UH 3H9SE 2VDLH 4NBXB 5IHUL 4WK0A 2P4AB 4IOIB 4OKVA 1RIVL 1LILA 5F89B 3ARDB 1MFDL 2GI7A 4YDLC 4PCTA 2G3MA 1RZGA 4J3OG 4KH2A 2OMZA 3QIUC 3UOAB 2AXJA 5A2BA 2VH5L 3SE6A 1SJHA 2F53A 2WK2A 3BDXA 3POCA 5GISL 4BQ6A 1DSFH 1C1EL 2XETA 4JN2A 3FS9A 3MLWH 5JIMA 4PWIA 4RH4A 2B08A 5KJRL 3PF2A 1AGCB 4NHCH 4WTXA 5DQJA 3S5LG 5CBAA 5HDBE 1FL3B 3QPQC 1AGDA 2YEQA 1EHXA 2AEQH 4GIOA 5IC7A 1NIEA 1SDYA 3ESOA 2CM6A 5E7BA 5GGQH 1B9YA 4PI2A 5JHBA 4UZSA 4XHQA 1PAMA 5D5MF 1QHQA 3NFNA 4YHML 4GKNA 2Q1EA 4HV8A 3ZHFA 2QXVA 2ED7A 1FQ9C 1MRCH 3OKLB 5IMKA 3RBGA 2R9HD 2NSQA 2GSGA 2VR4A 4M1GL 1YN6B 4NCC2 5I1GL 4X6DE 4AM0A 2YBGA 4FLSA 2EDWA 4UUJB 2XXCB 5I8EB 1NEZB 1PMYA 1SXNA 3U7YL 3DBXA 5C9KA 5BRZE 1H2ZA 3L5WA 4JE4B 3L9YA 3K26A 1ZSHA 1INEH 1TTAA 5IMLB 4BSWB 4GI6A 1FL5A 2X41A 1QEWA 2OMTA 3NSXA 1VFUA 3LKNB 1BSIA 5IY5B 4DQOH 5LNDA 1NFIB 1A1NB 2XN9D 2KBGA 2H3NA 4JO5A 4UV4L 2QSVA 4IBZA 3KBEA 4TLKA 3AVEA 1T21A 4AJ0A 1OO2A 1S4IA 3MREA 3NPSB 4G72B 4PJEF 4XPFH 4QXVA 2E4FA 3BRDA 1G0XA 4APQA 2N7SA 3VQMA 2O5NA 4GB9A 4R4BB 1CQYA 3D3VA 2WKGA 4RGND 1MFNA 4U6TA 1ED3A 4LP5A 5SWZE 3HNTH 4DK6A 5LKNA 2PABA 4OZ4B 2AJXL 5IQ9A 4NNYA 1XV8A 1MRDL 2QSTA 1BMWA 3II1A 4Z3JA 1EHNA 1XZWA 4P9ML 4ZOBA 4ZSOB 4FL4B 3RDTA 3L1OL 2IG2L 5EA0H 1KEGL 4MNQE 3KMDA 3SBWA 3RWDA 1JUFA 1II4E 5J4MA 4EUPG 1ETZB 2YD2A 1CE1L 2J25A 1A6TB 4EI5D 2GTZA 3RL1B 3CDGB 3EOBB 3MJ9A 4Y5VA 5K9JH 1IO4C 4B95C 1U3HB 3EO9L 2HG5B 1N64L 4PJ5B 2E9IA 2PO6A 2BNQE 2I9TA 3K27A 3QI0A 4PRHB 1P6FA 3WFZA 3OF7A 2GG1A 1KB5H 4UT7H 5LG1A 3CFEB 4Q0XH 4G6FB 5T1LB 1H3VA 2Y6SC 4CSTA 1OSEA 2QELA 5G4OA 1KLGB 1R5IB 4P8QA 3LXAA 4QRPB 4W4NA 5DEJA 3KLQA 3MBWB 3FFDA 4R26L 3HPJA 4GRWH 1WBZB 3O4LE 1X7QA 4J6RH 5IVXE 1P4LB 3J7HA 8CGTA 3VRJB 3OF6A 2DLFH 3LHPH 1AQ8A 4QXTB 1XIPA 2VTFA 1Z0MA 4PY8I 1JK9B 2PF6A 4UQ9A 5JW4M 2VCOA 1T5WB 2W8CA 4I85A 3PQYA 5D8JH 3Q13A 2YRZA 3I8EA 4CVZB 5DQ9A 5KS9F 3ZDYA 3VU2A 4LPUA 5E8OB 4XP5L 1A0RB 1KPUB 2XZZA 1HYSD 4ANKA 2P8PA 3M1BA 4APXB 4AT6B 3DURB 1ZVHA 4M6NL 2FL5B 5BVJA 1OT1A 5FUCE 3GSUA 3VG0H 2AW2A 3TN0C 1RZKC 2QR5A 2NSMA 3KPRB 4P3CH 3LHAA 4X4ZA 3ORVD 4LSPH 5DZLA 3VD9A 4EBQL 5KUKA 2AQTA 4LASH 5DUPH 3MVDK 1C9IA 5C07B 5D70L 4RZKA 1ET5A 4PIBA 2YAFA 2RACA 4TULH 4GBXC 3T3MF 3F3HA 3ATFA 3UPCA 4IMLB 5FB8B 3CJJA 4EZKA 5E4EB 1I8MB 5E6IB 5H94A 2CGRL 4QLWA 3EQ9A 1QOKA 1HEHC 3D30A 5CD3A 1E3ZA 4L4TD 2Z8VC 3HG1E 4PJ9A 3BKCL 1TF4A 2ATKA 1QA9A 4FQ2H 1W9XA 1N4XH 2YSSA 4LVNB 4PB9L 3U2JA 4JKLA 1N0LA 2WWKT 1S9VA 3TBCA 3NIDB 4I18B 4PJGE 1KIQB 3KPTA 5B1AB 2JLPA 4UTAA 4YX2H 4XNZC 5HHQA 3FGBA 5C0CB 2JVUA 5LBSL 4TNVK 5ABDE 4YR6B 3IN0A 1AKJB 1AS6A 3DTDA 1ID2A 1LO2L 2BC4A 3OG6B 1QBLH 3D39D 4IHBA 1IL1A 2XDHA 3JZHA 2EH8H 3ME0A 4YGVB 3VI4F 4P59L 2VDOL 3GS4A 4DH2A 4QOKE 2YQ3A 1BXAA 2JQAA 3IDGB 2DEWX 2BSCA 3SE8H 1B90A 3ASWA 3WJLA 2C3VB 3EGXA 1JZ6A 3PV7A 4UIKL 5I6OA 1M7IA 1LEIB 5I8KL 1HXMA 5D1QA 2TSBA 1AXTL 3IURA 3PVUB 5FYJH 1LK3H 1AZRA 2WSPA 1HCYA 3CN0A 2Q7YB 5IREA 2NY6C 1UOLA 3HB3B 3EYVB 3H4HA 3E6FA 1R19A 1I9EA 3P4OA 5FDWB 3GSQA 4QGTA 3TT3L 3U4BL 2KI6A 3FCTB 1NOFA 1T1ZA 3A3YB 1E9QA 2P3YA 4BZYA 4R0LC 4LLDA 3C09C 1G4MA 3GMOA 5LGHL 3NIFB 2G60L 5AOLA 5HI3D 3FW6A 4PD4K 4ZQKB 2C1OA 1RZQA 3WTSA 1QSFB 3H53A 3BVWA 5DD1L 3PXSD 1WSST 4FI8A 4K8RH 2W92A 4PG2C 5T1KB 2V2WA 5AOMA 3DVGB 3VXUE 4QHPA 3PHOA 4GIAA 1R3JA 4JPKL 4CU8A 4J3UA 3UERA 5GZOC 3IDYC 3FU6A 3EOTL 5AOIA 2JK5B 2R29H 3G5XB 5EOQL 1JBJA 4ZX3A 2ZNXA 3UTZA 4V2BA 2IBZY 4ZS6D 2MPAH 3P77A 4PS7A 5T3ZL 5KW9H 1J87A 1RU9L 3PP4H 4U1NA 2G9KA 3NCWA 4FNTA 4YSAA 2BVOA 3MCKB 4WW2A 2AERT 4ODUA 1E3FA 4O2FA 5DQDH 1WD9A 2X9XA 3KM2A 2QGEA 1IKFH 4OQ1A 3UTQB 1A4JA 1D7CA 1Q72L 1XF2B 4OM0H 3WUWB 1T5XB 5DGRA 5IEKA 4BKTC 5I0VA 2VERN 1I8AA 3RX7A 1YMME 3IXAB 1RHHB 5EZJA 2BSRB 3BO8A 3QIBD 3RWHA 3E38A 1MJJA 1OALA 2YFNA 3LPWA 2HT3C 1MEXH 3CLEH 4WNQB 5EMKB 1H6TA 2AMGA 4WO4D 1AR1D 4FQCL 5ISZA