3OW8A

Crystal structure of the wd repeat-containing protein 61
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
300
structure length
293
Chain Sequence
YGILFKQEQAHDDAIWSVAWGETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD repeat-containing protein 61
publication title Structure and function of WD40 domain proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 293
sequence length 300
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3ow8A00
3V7DB 1OMWB 3SN6B 3NVNA 3MXXA 3PXTD 5EARA 3BG0A 2B5NA 4G56B 3ORVD 4H5IA 1R5MA 4GMBA 3MMYA 4A11A 3I2NA 3OKYA 4FA5D 3JAMg 2GC7A 5EMKB 4O9DA 3L4MD 4LG9A 4J77A 5GSAA 1XIPA 3VH0A 3N0DA 5EM2A 4GQBB 4K3ID 4GGCA 2G9AA 2H9PA 4XYHA 5CXCA 5H14A 4I79A 4JD2C 1SHYB 1NR0A 4J0WA 5AJAA 3PE7A 5IJ7E 4A08A 2OVQB 3JZGA 4XYIA 4X3EA 5C2WB 4PSXB 3EI1B 4FA9D 2I3TA 4A0BA 3K26A 5JWZA 5EMMB 3JZNA 1JMXB 4J79A 1JOFA 1PGUA 4FAVD 5FA5B 2CO0C 5IT9g 4UI9R 1U2VC 1N6DA 2HKMA 3AH8B 3SBQA 3IJCA 4CY3A 4J8GA 4XEIC 1GXRA 2GC4A 1GOTB 4IA9A 4FA1D 5C2VB 3AL8A 2QXVA 4CY1A 2H9NA 3I8EA 1OLZA 3F3GA 5TEFA 2HXCA 3PXWD 2H9LA 2QC5A 2YB8B 1ERJA 4NSXA 4QQEA 3JZHA 2J57G 4BUJC 1GP2B 3SWSD 3JROA 2H47A 4ZN4A 2CN3A 2YNPA 3DXMC 2UZXB 4OWRA 4A2LA 3DWLC 3J81g 2AH0A 1MDAH 3IIYA 1U4CA 1RI6A 1MG3A 3ULEC 5IGQA 2IAAA 5CXBB 2XL3A 2PM7B 3RN0D 5SXMA 2YNOA 4GQ1A 5IJ8E 4U7AA 1N6FA 2P9NC 5HE1B 3J80g 3V5WB 2P9IC 3SHFA 4ES0A 5FLXg 4IMMA 4E5ZA 2HKRA 3PXSD 4J0XA 5FXYA 4QL1A 2PBIB 4A0AA 3W15A 4J84A 4X60B 3U4YA 3FM0A 5FQDA 2YMUA 5HE2B 4JT5C 3UVKA 3VA6A 2YNNA 4JT6C 3I7LA 4PBYA 1YFQA 5FKTA 3GREA 3KRWB 5K1CC 3GFCA 4AEZA 1B9XA 4CZXA 4A09A 3OTTA 4Z8LA 3MZKA 3MKQA 3SBPA 5TDHB 4L1QD 4H5JA 4GQ2P 4J78A 3PVWB 5TEEA 4ERZA 2J56H 4J81A 3HFQA 1PBYB 1P22A 2Z2OA 3KRXB 3UKRC 4O45A 3SJLD 3JRPA 4JSVC 3OL2B 2H3XA 3RSEC 2AGZA 4ZOVA 2OVPB 2AGYA 2IWKA 1A0RB 3UVOA 3BWSA 2CE8A 4J82A 3I8CA 3JPXA 4LG8A 3AL8B 3EI2A 4A2MA 4Y5RD 3EI4B 5CYKA 4J8BA 4BH6A 3FGBA 3N0EA 1K32A 2I0SA 2IUVA 2HESX 3RFGA 3UR4A 1XKSA 2YBAA 3C9CA 4L9OA 1PEVA 2PM6B 4TZ4A 3VGZA 3SVWD 2H13A 4FHLA 3E0CA 3EI1A 4CY2A 5FKQA 4JSXC 2B5LA 4J73A 1JJUB 3SCYA 4EWRA 5AMSA 3MKSB 4OZUA 3F3FA 3MZLA 1PI6A 3DSMA 3IKOA 2XYIA 3SFZA 3IJ0A 4KFMB 3I7HA 2I0TA 2I0RA 1N6EA 4PSWB 2PM9B 4E54B 3EWEA 4GGAA 3K27A 5IGOA 4CY5A 2P9UC 1MG2A 2AGXA 4ERQA 2IUPA 4K3JB 3SXTD 4PBZA 5THAA 5GXHA 4A0AB 2XU7A 2AGLA 5I5MA 1K8KC 4A11B 4FA4D 3OKYB 3JB9L 4JXMA 5HE3B 2P9PC 3PSLA 4QRJA 4O1QD 5C9ZB 5EM2B 4ZOYA 4JSPC 3OKTA 2W18A 3ODTA 5CXCB 4FAND 1JMZB 4AOWA 3RFHA 2CE9A 2H6QA 3B7FA 5HQGA 4CI1A 3SBRA 5AFU3 1QNIA 4A09B 3DM0A 4PNKB 3PSCB 4A08B 3CFSB 3EI3A 4A7JA 5CXBA 5EMJB 2HJBA 2IURA 3UVMA 4R7AB 5IC7A 4X63B 5EAPA 3DXKC 4ERYA 5HE0B 4ESGA 1L0QA 4A0BB 2BCJB 1B9YA 2Q7QA 2UZYB 3ZWLB 4LGNA 1NEXB 3A0FA 3I7KA 2AH1A 4N14A 2HYEA 4CI3A 2OJYA 4ZOZA 3EI2B 4X61B 1SQ9A 1TYQC 2AGWA 5CYKB 3OKWA 3CFVA 2OIZA 3NVXA 2H6NA 1VYHC 4YVDA 2H14A 3I7OA 4PXWA 2AQ5A 1XHMA 5K19A 5A2Qg 3IJ1A 3FRXA 4BL0A 5FKRA 2OVRB 2MTAH 3RN1D 4GM3A 2EBSA 2H6KA 2HJ4A 5EAMA 4J86A 4GM8A 4U1EI 3C99A 4D0KA 5EALA 3I7PA 3RRMC 3UKUC 3RLMD 2O9KA 3P4FA 4ZOXA 2CNXA 3F3PA 4HDJA 5H1MA 5HYNB 4JSNC 3V9FA 2CO0A 5B4WA 3EG6A 4D6VA 3OL2A 3I7NA 3AFCA 1S4UX 3SMRA 4Y7RA 2IUQA 5H17A 1GG2B 4FWWA 3UVLA 3C75H 4CZYA 3NVQA 3BG1A 3OW8A 2GNQA 4GZ8A 4CZVA 2B5MA 3I89A 4L3GD 3EI4A 5I5JA 2OK4A 3L4OD 3EMHA 5I5IA 4MK0B 4O3UB 4CI8A 5GXIA 2CN2A 4CI2A 2OK6A 4O3TB 2TRCB 3IIWA 2J55H 5TF2A 2Z2PA 2I3SA 1FWXA 4E5ZB 2H68A 2H9MA 2IWFA 3AL9A 4GGDA 5EMLB 1TBGA 3SLED 3EU7A 5KDOB 4GM9A 2P9LC 4CC9A 4FB1D 3EI3B 2G99A 2P9KC 3PVUB 5GMKn 3CIKB 2B4EA 2XL2A 2P9SC 4QT8A 4L3HD 5FKSA 1SQJA 3UVNA 4J87A 2Z2NA 2PM9A 4E54A 2BBKH 1Q47A 3C5MA 3RMZD 4PC0A
chains in the Genus database with same CATH superfamily
3MUOA 1OMWB 3V7DB 3SN6B 3NVNA 3MXXA 3PXTD 5EARA 3BG0A 2B5NA 4G56B 3ORVD 4H5IA 1R5MA 4GMBA 3MMYA 4A11A 3I2NA 3OKYA 4BCCA 4FA5D 3JAMg 1U8CA 2GC7A 3EQ8A 1VZ2A 5EMKB 4O9DA 3L4MD 4LG9A 4J77A 5GSAA 1XIPA 3VH0A 3N0DA 5EM2A 4NENA 4GQBB 4K3ID 2QR5A 2G9AA 4GGCA 2H9PA 4XYHA 5CXCA 5H14A 4I79A 4JD2C 3K71A 1SHYB 1NR0A 4J0WA 4BP8A 5AJAA 3PE7A 5M61A 3ZE2A 1A12A 4BCDA 3ZE1A 5IJ7E 5M5SA 4A08A 2OVQB 3JZGA 4XYIA 4X3EA 5C2WB 4PSXB 1H2ZA 3EI1B 1TYEA 4FA9D 2I3TA 3IUMA 3ZE0A 4WK2A 4A0BA 3K26A 3O4JA 5EMMB 5JWZA 3JZNA 1JMXB 4J79A 1JOFA 3GC3B 1PGUA 5C92A 2VZ1A 1GOFA 4FAVD 3K6SA 5FA5B 3MVDK 2CO0C 5IT9g 4JHPC 4MMXA 4UI9R 1U2VC 1N6DA 2HKMA 3AH8B 3QHYB 4G1MA 3SBQA 3IJCA 4CY3A 4J8GA 4BP9A 4XEIC 1GXRA 2GC4A 1GOTB 4IA9A 4FA1D 5C2VB 3AL8A 2QXVA 4CY1A 1UOOA 3QI0A 2H9NA 3I8EA 4Z7QA 1K3IA 4RE6A 1OLZA 1UOPA 3F3GA 5TEFA 2HXCA 3PXWD 2H9LA 5C86A 2QC5A 2HU5A 2YB8B 1ERJA 4NSXA 2EICA 4QQEA 4JHNA 3JZHA 3O4IA 2J57G 4BUJC 1GP2B 3SWSD 3JROA 4AN1A 2H47A 1T2XA 2CN3A 2YNPA 3DXMC 2UZXB 4ZN4A 4OWRA 5FFGA 4A2LA 3DWLC 3J81g 2AH0A 1MDAH 3IIYA 1H2YA 1U4CA 1QFSA 3IJEA 1RI6A 1MG3A 3ULEC 4AN0A 5IGQA 4DNVA 4NBMA 2IAAA 5CXBB 2XL3A 3K72A 2PM7B 2VDQA 3RN0D 5SXMA 2YNOA 3GD1I 4GQ1A 5IJ8E 4U7AA 1N6FA 2P9NC 5HE1B 3J80g 1E8MA 2JKXA 3V5WB 2P9IC 5E6SA 3SHFA 4ES0A 5FLXg 4IMMA 4E5ZA 2HKRA 3PXSD 4J0XA 5FXYA 4QL1A 1M1XA 3O4HA 2PBIB 4A0AA 3W15A 4J84A 4X60B 3U4YA 4G55A 3EQ7A 4QAMA 3FM0A 5FQDA 5M5VA 2YMUA 5HE2B 2VDPA 4JT5C 2EIBA 3UVKA 3VA6A 2YNNA 3VI4A 4JT6C 3I7LA 2EIDA 4PBYA 4RE5A 1YFQA 5FKTA 3GREA 3KRWB 5K1CC 3GFCA 4AEZA 4NC4A 1B9XA 4CZXA 4O2WA 4NAAA 4A09A 3OTTA 4Z8LA 3NIFA 3MZKA 3MKQA 3SBPA 5TDHB 4L1QD 4H5JA 4GQ2P 4J78A 3PVWB 5TEEA 4ERZA 2J56H 4J81A 3HFQA 1PBYB 2VDRA 1P22A 2Z2OA 3KRXB 2WQ8A 3UKRC 2XZGA 4O45A 3SJLD 3JRPA 4JSVC 3OL2B 2H3XA 3RSEC 3KCIA 2AGZA 4ZOVA 2OVPB 2AGYA 1YR2A 3IUNA 2IWKA 2HU7A 1UTCA 1A0RB 2BKLA 3UVOA 3BWSA 2CE8A 3FCSA 4G1EA 5M5UA 4J82A 3I8CA 3JPXA 4LG8A 3AL8B 3EI2A 1GOHA 4A2MA 4Y5RD 3EI4B 5CYKA 3T3MA 1L5GA 4J8BA 4Z7OA 4MMYA 1BPOA 3FGBA 4BH6A 3NIDA 3N0EA 1K32A 2I0SA 2IUVA 2HESX 3RFGA 3UR4A 1XKSA 2YBAA 3C9CA 4L9OA 1PEVA 2PM6B 4TZ4A 3VGZA 3SVWD 2H13A 3OF7A 4FHLA 3E0CA 3EI1A 4CY2A 5FKQA 4Z7NA 4JSXC 2B5LA 2VZ3A 4J73A 1JJUB 3EQ9A 3SCYA 4EWRA 5AMSA 3MKSB 4OZUA 3F3FA 3MZLA 1PI6A 4AMYA 3DSMA 3IKOA 2XYIA 3IUQA 3SFZA 4L1MA 3IJ0A 1JV2A 2XDWA 3I7HA 4KFMB 2I0TA 2I0RA 1N6EA 4UM8A 4PSWB 2PM9B 4E54B 3EWEA 4GGAA 3K27A 5IGOA 1VE6A 4CY5A 2P9UC 1MG2A 2AGXA 4ERQA 2IUPA 4K3JB 3O4GA 3SXTD 4PBZA 5THAA 5GXHA 4A0AB 2XU7A 4IRZA 2AGLA 5I5MA 1K8KC 4A11B 3FCUA 3OKYB 4FA4D 4D9SA 5M5TA 3JB9L 4JXMA 5HE3B 2P9PC 3PSLA 4QRJA 4O1QD 3IUJA 5C9ZB 5EM2B 4ZOYA 3T3PA 4JSPC 1H2XA 3OKTA 2W18A 3ODTA 5CXCB 4FAND 1JMZB 4AOWA 3RFHA 2CE9A 2H6QA 3B7FA 1VZ3A 5HQGA 4CI1A 3SBRA 5AFU3 1QFMA 1QNIA 4A09B 3DM0A 4PNKB 4MMZA 3PSCB 4A08B 3CFSB 3EI3A 4A7JA 3MUNA 1E5TA 5CXBA 5EMJB 2HJBA 2IURA 2VDMA 3UVMA 4R7AB 5IC7A 4X63B 5EAPA 3DXKC 4ERYA 2VC2A 5HE0B 1GOGA 4ESGA 1C9LA 3NIGA 3VI3A 1L0QA 4A0BB 2BCJB 1B9YA 3IULA 2Q7QA 2UZYB 3ZWLB 4LGNA 1NEXB 3A0FA 3I7KA 2AH1A 4N14A 2HYEA 4CI3A 2OJYA 4WK4A 4ZOZA 3EI2B 4X61B 1SQ9A 1TYQC 2AGWA 5CYKB 3OKWA 3CFVA 2OIZA 3NVXA 2H6NA 1VYHC 3ZDYA 4YVDA 2H14A 3I7OA 4WJKA 4PXWA 2AQ5A 1XHMA 5K19A 5A2Qg 2EIEA 3IJ1A 3FRXA 4AX4A 4BL0A 5FKRA 2OVRB 2MTAH 2VDLA 3RN1D 4GM3A 1H2WA 4DNUA 2EBSA 2H6KA 2HJ4A 5EAMA 4J86A 4GM8A 4U1EI 3C99A 4D0KA 5EALA 4BCBA 3I7PA 3RRMC 3UKUC 3RLMD 1JTDB 2O9KA 3P4FA 4ZOXA 2CNXA 3F3PA 4HDJA 5H1MA 5HYNB 4JSNC 3V9FA 2CO0A 5B4WA 3EG6A 4D6VA 3OL2A 4AMZA 3I7NA 3AFCA 3IVMA 5FFOA 3IURA 1S4UX 1O6FA 3SMRA 4Y7RA 2IUQA 5H17A 1GG2B 4FWWA 2QZPA 3UVLA 2VDOA 3C75H 4CZYA 3NVQA 3BG1A 3OW8A 2GNQA 4GZ8A 4CZVA 2B5MA 3I89A 4L3GD 3EI4A 5HDBA 2OK4A 3L4OD 3EMHA 5I5JA 5I5IA 2HU8A 5M5RA 4MK0B 4O3UB 4CI8A 5GXIA 2CN2A 4CI2A 4WK0A 2OK6A 4O3TB 2TRCB 3IIWA 4O02A 2J55H 5TF2A 4DNWA 2Z2PA 2I3SA 1FWXA 4E5ZB 2H68A 2H9MA 2IWFA 4UM9A 1C9IA 1I2MB 2VDNA 3AL9A 5E6UA 4GGDA 5EMLB 2VDKA 1VE7A 1UOQA 1TBGA 3SLED 3EU7A 3ZDZA 5KDOB 4GM9A 2P9LC 3ZDXA 4CC9A 4FB1D 3EI3B 2G99A 2P9KC 3PVUB 5GMKn 3CIKB 2B4EA 2XL2A 2P9SC 4QT8A 3V4PA 4L3HD 5FKSA 1SQJA 3UVNA 4J87A 2Z2NA 2PM9A 4E54A 1E8NA 2BBKH 3DDUA 1Q47A 3C5MA 5E6RA 2XE4A 1O6GA 3RMZD 3V4VA 4PC0A
chains in the Genus database with same CATH topology
3V7DB 1OMWB 3SN6B 3NVNA 3MXXA 3PXTD 5EARA 3BG0A 2B5NA 4G56B 3ORVD 4H5IA 1R5MA 4GMBA 3MMYA 4A11A 3I2NA 3OKYA 4FA5D 3JAMg 2GC7A 5EMKB 4O9DA 3L4MD 4LG9A 4J77A 5GSAA 1XIPA 3VH0A 3N0DA 5EM2A 4GQBB 4K3ID 4GGCA 2G9AA 2H9PA 4XYHA 5CXCA 5H14A 4I79A 4JD2C 1SHYB 1NR0A 4J0WA 5AJAA 3PE7A 5IJ7E 4A08A 2OVQB 3JZGA 4XYIA 4X3EA 5C2WB 4PSXB 3EI1B 4FA9D 2I3TA 4A0BA 3K26A 5JWZA 5EMMB 3JZNA 1JMXB 4J79A 1JOFA 1PGUA 4FAVD 5FA5B 2CO0C 5IT9g 4UI9R 1U2VC 1N6DA 2HKMA 3AH8B 3SBQA 3IJCA 4CY3A 4J8GA 4XEIC 1GXRA 2GC4A 1GOTB 4IA9A 4FA1D 5C2VB 3AL8A 2QXVA 4CY1A 2H9NA 3I8EA 1OLZA 3F3GA 5TEFA 2HXCA 3PXWD 2H9LA 2QC5A 2YB8B 1ERJA 4NSXA 4QQEA 3JZHA 2J57G 4BUJC 1GP2B 3SWSD 3JROA 2H47A 4ZN4A 2CN3A 2YNPA 3DXMC 2UZXB 4OWRA 4A2LA 3DWLC 3J81g 2AH0A 1MDAH 3IIYA 1U4CA 1RI6A 1MG3A 3ULEC 5IGQA 2IAAA 5CXBB 2XL3A 2PM7B 3RN0D 5SXMA 2YNOA 4GQ1A 5IJ8E 4U7AA 1N6FA 2P9NC 5HE1B 3J80g 3V5WB 2P9IC 3SHFA 4ES0A 5FLXg 4IMMA 4E5ZA 2HKRA 3PXSD 4J0XA 5FXYA 4QL1A 2PBIB 4A0AA 3W15A 4J84A 4X60B 3U4YA 3FM0A 5FQDA 2YMUA 5HE2B 4JT5C 3UVKA 3VA6A 2YNNA 4JT6C 3I7LA 4PBYA 1YFQA 5FKTA 3GREA 3KRWB 5K1CC 3GFCA 4AEZA 1B9XA 4CZXA 4A09A 3OTTA 4Z8LA 3MZKA 3MKQA 3SBPA 5TDHB 4L1QD 4H5JA 4GQ2P 4J78A 3PVWB 5TEEA 4ERZA 2J56H 4J81A 3HFQA 1PBYB 1P22A 2Z2OA 3KRXB 3UKRC 4O45A 3SJLD 3JRPA 4JSVC 3OL2B 2H3XA 3RSEC 2AGZA 4ZOVA 2OVPB 2AGYA 2IWKA 1A0RB 3UVOA 3BWSA 2CE8A 4J82A 3I8CA 3JPXA 4LG8A 3AL8B 3EI2A 4A2MA 4Y5RD 3EI4B 5CYKA 4J8BA 4BH6A 3FGBA 3N0EA 1K32A 2I0SA 2IUVA 2HESX 3RFGA 3UR4A 1XKSA 2YBAA 3C9CA 4L9OA 1PEVA 2PM6B 4TZ4A 3VGZA 3SVWD 2H13A 4FHLA 3E0CA 3EI1A 4CY2A 5FKQA 4JSXC 2B5LA 4J73A 1JJUB 3SCYA 4EWRA 5AMSA 3MKSB 4OZUA 3F3FA 3MZLA 1PI6A 3DSMA 3IKOA 2XYIA 3SFZA 3IJ0A 4KFMB 3I7HA 2I0TA 2I0RA 1N6EA 4PSWB 2PM9B 4E54B 3EWEA 4GGAA 3K27A 5IGOA 4CY5A 2P9UC 1MG2A 2AGXA 4ERQA 2IUPA 4K3JB 3SXTD 4PBZA 5THAA 5GXHA 4A0AB 2XU7A 2AGLA 5I5MA 1K8KC 4A11B 4FA4D 3OKYB 3JB9L 4JXMA 5HE3B 2P9PC 3PSLA 4QRJA 4O1QD 5C9ZB 5EM2B 4ZOYA 4JSPC 3OKTA 2W18A 3ODTA 5CXCB 4FAND 1JMZB 4AOWA 3RFHA 2CE9A 2H6QA 3B7FA 5HQGA 4CI1A 3SBRA 5AFU3 1QNIA 4A09B 3DM0A 4PNKB 3PSCB 4A08B 3CFSB 3EI3A 4A7JA 5CXBA 5EMJB 2HJBA 2IURA 3UVMA 4R7AB 5IC7A 4X63B 5EAPA 3DXKC 4ERYA 5HE0B 4ESGA 1L0QA 4A0BB 2BCJB 1B9YA 2Q7QA 2UZYB 3ZWLB 4LGNA 1NEXB 3A0FA 3I7KA 2AH1A 4N14A 2HYEA 4CI3A 2OJYA 4ZOZA 3EI2B 4X61B 1SQ9A 1TYQC 2AGWA 5CYKB 3OKWA 3CFVA 2OIZA 3NVXA 2H6NA 1VYHC 4YVDA 2H14A 3I7OA 4PXWA 2AQ5A 1XHMA 5K19A 5A2Qg 3IJ1A 3FRXA 4BL0A 5FKRA 2OVRB 2MTAH 3RN1D 4GM3A 2EBSA 2H6KA 2HJ4A 5EAMA 4J86A 4GM8A 4U1EI 3C99A 4D0KA 5EALA 3I7PA 3RRMC 3UKUC 3RLMD 2O9KA 3P4FA 4ZOXA 2CNXA 3F3PA 4HDJA 5H1MA 5HYNB 4JSNC 3V9FA 2CO0A 5B4WA 3EG6A 4D6VA 3OL2A 3I7NA 3AFCA 1S4UX 3SMRA 4Y7RA 2IUQA 5H17A 1GG2B 4FWWA 3UVLA 3C75H 4CZYA 3NVQA 3BG1A 3OW8A 2GNQA 4GZ8A 4CZVA 2B5MA 3I89A 4L3GD 3EI4A 5I5JA 2OK4A 3L4OD 3EMHA 5I5IA 4MK0B 4O3UB 4CI8A 5GXIA 2CN2A 4CI2A 2OK6A 4O3TB 2TRCB 3IIWA 2J55H 5TF2A 2Z2PA 2I3SA 1FWXA 4E5ZB 2H68A 2H9MA 2IWFA 3AL9A 4GGDA 5EMLB 1TBGA 3SLED 3EU7A 5KDOB 4GM9A 2P9LC 4CC9A 4FB1D 3EI3B 2G99A 2P9KC 3PVUB 5GMKn 3CIKB 2B4EA 2XL2A 2P9SC 4QT8A 4L3HD 5FKSA 1SQJA 3UVNA 4J87A 2Z2NA 2PM9A 4E54A 2BBKH 1Q47A 3C5MA 3RMZD 4PC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7D B;  1OMW B;  3SN6 B;  3NVN A;  3MXX A;  3PXT D;  5EAR A;  3BG0 A;  2B5N A;  4G56 B;  3ORV D;  4H5I A;  1R5M A;  4GMB A;  3MMY A;  4A11 A;  3I2N A;  3OKY A;  4FA5 D;  3JAM g;  2GC7 A;  5EMK B;  4O9D A;  3L4M D;  4LG9 A;  4J77 A;  5GSA A;  1XIP A;  3VH0 A;  3N0D A;  5EM2 A;  4GQB B;  4K3I D;  4GGC A;  2G9A A;  2H9P A;  4XYH A;  5CXC A;  5H14 A;  4I79 A;  4JD2 C;  1SHY B;  1NR0 A;  4J0W A;  5AJA A;  3PE7 A;  5IJ7 E;  4A08 A;  2OVQ B;  3JZG A;  4XYI A;  4X3E A;  5C2W B;  4PSX B;  3EI1 B;  4FA9 D;  2I3T A;  4A0B A;  3K26 A;  5JWZ A;  5EMM B;  3JZN A;  1JMX B;  4J79 A;  1JOF A;  1PGU A;  4FAV D;  5FA5 B;  2CO0 C;  5IT9 g;  4UI9 R;  1U2V C;  1N6D A;  2HKM A;  3AH8 B;  3SBQ A;  3IJC A;  4CY3 A;  4J8G A;  4XEI C;  1GXR A;  2GC4 A;  1GOT B;  4IA9 A;  4FA1 D;  5C2V B;  3AL8 A;  2QXV A;  4CY1 A;  2H9N A;  3I8E A;  1OLZ A;  3F3G A;  5TEF A;  2HXC A;  3PXW D;  2H9L A;  2QC5 A;  2YB8 B;  1ERJ A;  4NSX A;  4QQE A;  3JZH A;  2J57 G;  4BUJ C;  1GP2 B;  3SWS D;  3JRO A;  2H47 A;  4ZN4 A;  2CN3 A;  2YNP A;  3DXM C;  2UZX B;  4OWR A;  4A2L A;  3DWL C;  3J81 g;  2AH0 A;  1MDA H;  3IIY A;  1U4C A;  1RI6 A;  1MG3 A;  3ULE C;  5IGQ A;  2IAA A;  5CXB B;  2XL3 A;  2PM7 B;  3RN0 D;  5SXM A;  2YNO A;  4GQ1 A;  5IJ8 E;  4U7A A;  1N6F A;  2P9N C;  5HE1 B;  3J80 g;  3V5W B;  2P9I C;  3SHF A;  4ES0 A;  5FLX g;  4IMM A;  4E5Z A;  2HKR A;  3PXS D;  4J0X A;  5FXY A;  4QL1 A;  2PBI B;  4A0A A;  3W15 A;  4J84 A;  4X60 B;  3U4Y A;  3FM0 A;  5FQD A;  2YMU A;  5HE2 B;  4JT5 C;  3UVK A;  3VA6 A;  2YNN A;  4JT6 C;  3I7L A;  4PBY A;  1YFQ A;  5FKT A;  3GRE A;  3KRW B;  5K1C C;  3GFC A;  4AEZ A;  1B9X A;  4CZX A;  4A09 A;  3OTT A;  4Z8L A;  3MZK A;  3MKQ A;  3SBP A;  5TDH B;  4L1Q D;  4H5J A;  4GQ2 P;  4J78 A;  3PVW B;  5TEE A;  4ERZ A;  2J56 H;  4J81 A;  3HFQ A;  1PBY B;  1P22 A;  2Z2O A;  3KRX B;  3UKR C;  4O45 A;  3SJL D;  3JRP A;  4JSV C;  3OL2 B;  2H3X A;  3RSE C;  2AGZ A;  4ZOV A;  2OVP B;  2AGY A;  2IWK A;  1A0R B;  3UVO A;  3BWS A;  2CE8 A;  4J82 A;  3I8C A;  3JPX A;  4LG8 A;  3AL8 B;  3EI2 A;  4A2M A;  4Y5R D;  3EI4 B;  5CYK A;  4J8B A;  4BH6 A;  3FGB A;  3N0E A;  1K32 A;  2I0S A;  2IUV A;  2HES X;  3RFG A;  3UR4 A;  1XKS A;  2YBA A;  3C9C A;  4L9O A;  1PEV A;  2PM6 B;  4TZ4 A;  3VGZ A;  3SVW D;  2H13 A;  4FHL A;  3E0C A;  3EI1 A;  4CY2 A;  5FKQ A;  4JSX C;  2B5L A;  4J73 A;  1JJU B;  3SCY A;  4EWR A;  5AMS A;  3MKS B;  4OZU A;  3F3F A;  3MZL A;  1PI6 A;  3DSM A;  3IKO A;  2XYI A;  3SFZ A;  3IJ0 A;  4KFM B;  3I7H A;  2I0T A;  2I0R A;  1N6E A;  4PSW B;  2PM9 B;  4E54 B;  3EWE A;  4GGA A;  3K27 A;  5IGO A;  4CY5 A;  2P9U C;  1MG2 A;  2AGX A;  4ERQ A;  2IUP A;  4K3J B;  3SXT D;  4PBZ A;  5THA A;  5GXH A;  4A0A B;  2XU7 A;  2AGL A;  5I5M A;  1K8K C;  4A11 B;  4FA4 D;  3OKY B;  3JB9 L;  4JXM A;  5HE3 B;  2P9P C;  3PSL A;  4QRJ A;  4O1Q D;  5C9Z B;  5EM2 B;  4ZOY A;  4JSP C;  3OKT A;  2W18 A;  3ODT A;  5CXC B;  4FAN D;  1JMZ B;  4AOW A;  3RFH A;  2CE9 A;  2H6Q A;  3B7F A;  5HQG A;  4CI1 A;  3SBR A;  5AFU 3;  1QNI A;  4A09 B;  3DM0 A;  4PNK B;  3PSC B;  4A08 B;  3CFS B;  3EI3 A;  4A7J A;  5CXB A;  5EMJ B;  2HJB A;  2IUR A;  3UVM A;  4R7A B;  5IC7 A;  4X63 B;  5EAP A;  3DXK C;  4ERY A;  5HE0 B;  4ESG A;  1L0Q A;  4A0B B;  2BCJ B;  1B9Y A;  2Q7Q A;  2UZY B;  3ZWL B;  4LGN A;  1NEX B;  3A0F A;  3I7K A;  2AH1 A;  4N14 A;  2HYE A;  4CI3 A;  2OJY A;  4ZOZ A;  3EI2 B;  4X61 B;  1SQ9 A;  1TYQ C;  2AGW A;  5CYK B;  3OKW A;  3CFV A;  2OIZ A;  3NVX A;  2H6N A;  1VYH C;  4YVD A;  2H14 A;  3I7O A;  4PXW A;  2AQ5 A;  1XHM A;  5K19 A;  5A2Q g;  3IJ1 A;  3FRX A;  4BL0 A;  5FKR A;  2OVR B;  2MTA H;  3RN1 D;  4GM3 A;  2EBS A;  2H6K A;  2HJ4 A;  5EAM A;  4J86 A;  4GM8 A;  4U1E I;  3C99 A;  4D0K A;  5EAL A;  3I7P A;  3RRM C;  3UKU C;  3RLM D;  2O9K A;  3P4F A;  4ZOX A;  2CNX A;  3F3P A;  4HDJ A;  5H1M A;  5HYN B;  4JSN C;  3V9F A;  2CO0 A;  5B4W A;  3EG6 A;  4D6V A;  3OL2 A;  3I7N A;  3AFC A;  1S4U X;  3SMR A;  4Y7R A;  2IUQ A;  5H17 A;  1GG2 B;  4FWW A;  3UVL A;  3C75 H;  4CZY A;  3NVQ A;  3BG1 A;  3OW8 A;  2GNQ A;  4GZ8 A;  4CZV A;  2B5M A;  3I89 A;  4L3G D;  3EI4 A;  5I5J A;  2OK4 A;  3L4O D;  3EMH A;  5I5I A;  4MK0 B;  4O3U B;  4CI8 A;  5GXI A;  2CN2 A;  4CI2 A;  2OK6 A;  4O3T B;  2TRC B;  3IIW A;  2J55 H;  5TF2 A;  2Z2P A;  2I3S A;  1FWX A;  4E5Z B;  2H68 A;  2H9M A;  2IWF A;  3AL9 A;  4GGD A;  5EML B;  1TBG A;  3SLE D;  3EU7 A;  5KDO B;  4GM9 A;  2P9L C;  4CC9 A;  4FB1 D;  3EI3 B;  2G99 A;  2P9K C;  3PVU B;  5GMK n;  3CIK B;  2B4E A;  2XL2 A;  2P9S C;  4QT8 A;  4L3H D;  5FKS A;  1SQJ A;  3UVN A;  4J87 A;  2Z2N A;  2PM9 A;  4E54 A;  2BBK H;  1Q47 A;  3C5M A;  3RMZ D;  4PC0 A; 
#chains in the Genus database with same CATH topology
 3MUO A;  1OMW B;  3V7D B;  3SN6 B;  3NVN A;  3MXX A;  3PXT D;  5EAR A;  3BG0 A;  2B5N A;  4G56 B;  3ORV D;  4H5I A;  1R5M A;  4GMB A;  3MMY A;  4A11 A;  3I2N A;  3OKY A;  4BCC A;  4FA5 D;  3JAM g;  1U8C A;  2GC7 A;  3EQ8 A;  1VZ2 A;  5EMK B;  4O9D A;  3L4M D;  4LG9 A;  4J77 A;  5GSA A;  1XIP A;  3VH0 A;  3N0D A;  5EM2 A;  4NEN A;  4GQB B;  4K3I D;  2QR5 A;  2G9A A;  4GGC A;  2H9P A;  4XYH A;  5CXC A;  5H14 A;  4I79 A;  4JD2 C;  3K71 A;  1SHY B;  1NR0 A;  4J0W A;  4BP8 A;  5AJA A;  3PE7 A;  5M61 A;  3ZE2 A;  1A12 A;  4BCD A;  3ZE1 A;  5IJ7 E;  5M5S A;  4A08 A;  2OVQ B;  3JZG A;  4XYI A;  4X3E A;  5C2W B;  4PSX B;  1H2Z A;  3EI1 B;  1TYE A;  4FA9 D;  2I3T A;  3IUM A;  3ZE0 A;  4WK2 A;  4A0B A;  3K26 A;  3O4J A;  5EMM B;  5JWZ A;  3JZN A;  1JMX B;  4J79 A;  1JOF A;  3GC3 B;  1PGU A;  5C92 A;  2VZ1 A;  1GOF A;  4FAV D;  3K6S A;  5FA5 B;  3MVD K;  2CO0 C;  5IT9 g;  4JHP C;  4MMX A;  4UI9 R;  1U2V C;  1N6D A;  2HKM A;  3AH8 B;  3QHY B;  4G1M A;  3SBQ A;  3IJC A;  4CY3 A;  4J8G A;  4BP9 A;  4XEI C;  1GXR A;  2GC4 A;  1GOT B;  4IA9 A;  4FA1 D;  5C2V B;  3AL8 A;  2QXV A;  4CY1 A;  1UOO A;  3QI0 A;  2H9N A;  3I8E A;  4Z7Q A;  1K3I A;  4RE6 A;  1OLZ A;  1UOP A;  3F3G A;  5TEF A;  2HXC A;  3PXW D;  2H9L A;  5C86 A;  2QC5 A;  2HU5 A;  2YB8 B;  1ERJ A;  4NSX A;  2EIC A;  4QQE A;  4JHN A;  3JZH A;  3O4I A;  2J57 G;  4BUJ C;  1GP2 B;  3SWS D;  3JRO A;  4AN1 A;  2H47 A;  1T2X A;  2CN3 A;  2YNP A;  3DXM C;  2UZX B;  4ZN4 A;  4OWR A;  5FFG A;  4A2L A;  3DWL C;  3J81 g;  2AH0 A;  1MDA H;  3IIY A;  1H2Y A;  1U4C A;  1QFS A;  3IJE A;  1RI6 A;  1MG3 A;  3ULE C;  4AN0 A;  5IGQ A;  4DNV A;  4NBM A;  2IAA A;  5CXB B;  2XL3 A;  3K72 A;  2PM7 B;  2VDQ A;  3RN0 D;  5SXM A;  2YNO A;  3GD1 I;  4GQ1 A;  5IJ8 E;  4U7A A;  1N6F A;  2P9N C;  5HE1 B;  3J80 g;  1E8M A;  2JKX A;  3V5W B;  2P9I C;  5E6S A;  3SHF A;  4ES0 A;  5FLX g;  4IMM A;  4E5Z A;  2HKR A;  3PXS D;  4J0X A;  5FXY A;  4QL1 A;  1M1X A;  3O4H A;  2PBI B;  4A0A A;  3W15 A;  4J84 A;  4X60 B;  3U4Y A;  4G55 A;  3EQ7 A;  4QAM A;  3FM0 A;  5FQD A;  5M5V A;  2YMU A;  5HE2 B;  2VDP A;  4JT5 C;  2EIB A;  3UVK A;  3VA6 A;  2YNN A;  3VI4 A;  4JT6 C;  3I7L A;  2EID A;  4PBY A;  4RE5 A;  1YFQ A;  5FKT A;  3GRE A;  3KRW B;  5K1C C;  3GFC A;  4AEZ A;  4NC4 A;  1B9X A;  4CZX A;  4O2W A;  4NAA A;  4A09 A;  3OTT A;  4Z8L A;  3NIF A;  3MZK A;  3MKQ A;  3SBP A;  5TDH B;  4L1Q D;  4H5J A;  4GQ2 P;  4J78 A;  3PVW B;  5TEE A;  4ERZ A;  2J56 H;  4J81 A;  3HFQ A;  1PBY B;  2VDR A;  1P22 A;  2Z2O A;  3KRX B;  2WQ8 A;  3UKR C;  2XZG A;  4O45 A;  3SJL D;  3JRP A;  4JSV C;  3OL2 B;  2H3X A;  3RSE C;  3KCI A;  2AGZ A;  4ZOV A;  2OVP B;  2AGY A;  1YR2 A;  3IUN A;  2IWK A;  2HU7 A;  1UTC A;  1A0R B;  2BKL A;  3UVO A;  3BWS A;  2CE8 A;  3FCS A;  4G1E A;  5M5U A;  4J82 A;  3I8C A;  3JPX A;  4LG8 A;  3AL8 B;  3EI2 A;  1GOH A;  4A2M A;  4Y5R D;  3EI4 B;  5CYK A;  3T3M A;  1L5G A;  4J8B A;  4Z7O A;  4MMY A;  1BPO A;  3FGB A;  4BH6 A;  3NID A;  3N0E A;  1K32 A;  2I0S A;  2IUV A;  2HES X;  3RFG A;  3UR4 A;  1XKS A;  2YBA A;  3C9C A;  4L9O A;  1PEV A;  2PM6 B;  4TZ4 A;  3VGZ A;  3SVW D;  2H13 A;  3OF7 A;  4FHL A;  3E0C A;  3EI1 A;  4CY2 A;  5FKQ A;  4Z7N A;  4JSX C;  2B5L A;  2VZ3 A;  4J73 A;  1JJU B;  3EQ9 A;  3SCY A;  4EWR A;  5AMS A;  3MKS B;  4OZU A;  3F3F A;  3MZL A;  1PI6 A;  4AMY A;  3DSM A;  3IKO A;  2XYI A;  3IUQ A;  3SFZ A;  4L1M A;  3IJ0 A;  1JV2 A;  2XDW A;  3I7H A;  4KFM B;  2I0T A;  2I0R A;  1N6E A;  4UM8 A;  4PSW B;  2PM9 B;  4E54 B;  3EWE A;  4GGA A;  3K27 A;  5IGO A;  1VE6 A;  4CY5 A;  2P9U C;  1MG2 A;  2AGX A;  4ERQ A;  2IUP A;  4K3J B;  3O4G A;  3SXT D;  4PBZ A;  5THA A;  5GXH A;  4A0A B;  2XU7 A;  4IRZ A;  2AGL A;  5I5M A;  1K8K C;  4A11 B;  3FCU A;  3OKY B;  4FA4 D;  4D9S A;  5M5T A;  3JB9 L;  4JXM A;  5HE3 B;  2P9P C;  3PSL A;  4QRJ A;  4O1Q D;  3IUJ A;  5C9Z B;  5EM2 B;  4ZOY A;  3T3P A;  4JSP C;  1H2X A;  3OKT A;  2W18 A;  3ODT A;  5CXC B;  4FAN D;  1JMZ B;  4AOW A;  3RFH A;  2CE9 A;  2H6Q A;  3B7F A;  1VZ3 A;  5HQG A;  4CI1 A;  3SBR A;  5AFU 3;  1QFM A;  1QNI A;  4A09 B;  3DM0 A;  4PNK B;  4MMZ A;  3PSC B;  4A08 B;  3CFS B;  3EI3 A;  4A7J A;  3MUN A;  1E5T A;  5CXB A;  5EMJ B;  2HJB A;  2IUR A;  2VDM A;  3UVM A;  4R7A B;  5IC7 A;  4X63 B;  5EAP A;  3DXK C;  4ERY A;  2VC2 A;  5HE0 B;  1GOG A;  4ESG A;  1C9L A;  3NIG A;  3VI3 A;  1L0Q A;  4A0B B;  2BCJ B;  1B9Y A;  3IUL A;  2Q7Q A;  2UZY B;  3ZWL B;  4LGN A;  1NEX B;  3A0F A;  3I7K A;  2AH1 A;  4N14 A;  2HYE A;  4CI3 A;  2OJY A;  4WK4 A;  4ZOZ A;  3EI2 B;  4X61 B;  1SQ9 A;  1TYQ C;  2AGW A;  5CYK B;  3OKW A;  3CFV A;  2OIZ A;  3NVX A;  2H6N A;  1VYH C;  3ZDY A;  4YVD A;  2H14 A;  3I7O A;  4WJK A;  4PXW A;  2AQ5 A;  1XHM A;  5K19 A;  5A2Q g;  2EIE A;  3IJ1 A;  3FRX A;  4AX4 A;  4BL0 A;  5FKR A;  2OVR B;  2MTA H;  2VDL A;  3RN1 D;  4GM3 A;  1H2W A;  4DNU A;  2EBS A;  2H6K A;  2HJ4 A;  5EAM A;  4J86 A;  4GM8 A;  4U1E I;  3C99 A;  4D0K A;  5EAL A;  4BCB A;  3I7P A;  3RRM C;  3UKU C;  3RLM D;  1JTD B;  2O9K A;  3P4F A;  4ZOX A;  2CNX A;  3F3P A;  4HDJ A;  5H1M A;  5HYN B;  4JSN C;  3V9F A;  2CO0 A;  5B4W A;  3EG6 A;  4D6V A;  3OL2 A;  4AMZ A;  3I7N A;  3AFC A;  3IVM A;  5FFO A;  3IUR A;  1S4U X;  1O6F A;  3SMR A;  4Y7R A;  2IUQ A;  5H17 A;  1GG2 B;  4FWW A;  2QZP A;  3UVL A;  2VDO A;  3C75 H;  4CZY A;  3NVQ A;  3BG1 A;  3OW8 A;  2GNQ A;  4GZ8 A;  4CZV A;  2B5M A;  3I89 A;  4L3G D;  3EI4 A;  5HDB A;  2OK4 A;  3L4O D;  3EMH A;  5I5J A;  5I5I A;  2HU8 A;  5M5R A;  4MK0 B;  4O3U B;  4CI8 A;  5GXI A;  2CN2 A;  4CI2 A;  4WK0 A;  2OK6 A;  4O3T B;  2TRC B;  3IIW A;  4O02 A;  2J55 H;  5TF2 A;  4DNW A;  2Z2P A;  2I3S A;  1FWX A;  4E5Z B;  2H68 A;  2H9M A;  2IWF A;  4UM9 A;  1C9I A;  1I2M B;  2VDN A;  3AL9 A;  5E6U A;  4GGD A;  5EML B;  2VDK A;  1VE7 A;  1UOQ A;  1TBG A;  3SLE D;  3EU7 A;  3ZDZ A;  5KDO B;  4GM9 A;  2P9L C;  3ZDX A;  4CC9 A;  4FB1 D;  3EI3 B;  2G99 A;  2P9K C;  3PVU B;  5GMK n;  3CIK B;  2B4E A;  2XL2 A;  2P9S C;  4QT8 A;  3V4P A;  4L3H D;  5FKS A;  1SQJ A;  3UVN A;  4J87 A;  2Z2N A;  2PM9 A;  4E54 A;  1E8N A;  2BBK H;  3DDU A;  1Q47 A;  3C5M A;  5E6R A;  2XE4 A;  1O6G A;  3RMZ D;  3V4V A;  4PC0 A; 
#chains in the Genus database with same CATH homology
 3V7D B;  1OMW B;  3SN6 B;  3NVN A;  3MXX A;  3PXT D;  5EAR A;  3BG0 A;  2B5N A;  4G56 B;  3ORV D;  4H5I A;  1R5M A;  4GMB A;  3MMY A;  4A11 A;  3I2N A;  3OKY A;  4FA5 D;  3JAM g;  2GC7 A;  5EMK B;  4O9D A;  3L4M D;  4LG9 A;  4J77 A;  5GSA A;  1XIP A;  3VH0 A;  3N0D A;  5EM2 A;  4GQB B;  4K3I D;  4GGC A;  2G9A A;  2H9P A;  4XYH A;  5CXC A;  5H14 A;  4I79 A;  4JD2 C;  1SHY B;  1NR0 A;  4J0W A;  5AJA A;  3PE7 A;  5IJ7 E;  4A08 A;  2OVQ B;  3JZG A;  4XYI A;  4X3E A;  5C2W B;  4PSX B;  3EI1 B;  4FA9 D;  2I3T A;  4A0B A;  3K26 A;  5JWZ A;  5EMM B;  3JZN A;  1JMX B;  4J79 A;  1JOF A;  1PGU A;  4FAV D;  5FA5 B;  2CO0 C;  5IT9 g;  4UI9 R;  1U2V C;  1N6D A;  2HKM A;  3AH8 B;  3SBQ A;  3IJC A;  4CY3 A;  4J8G A;  4XEI C;  1GXR A;  2GC4 A;  1GOT B;  4IA9 A;  4FA1 D;  5C2V B;  3AL8 A;  2QXV A;  4CY1 A;  2H9N A;  3I8E A;  1OLZ A;  3F3G A;  5TEF A;  2HXC A;  3PXW D;  2H9L A;  2QC5 A;  2YB8 B;  1ERJ A;  4NSX A;  4QQE A;  3JZH A;  2J57 G;  4BUJ C;  1GP2 B;  3SWS D;  3JRO A;  2H47 A;  4ZN4 A;  2CN3 A;  2YNP A;  3DXM C;  2UZX B;  4OWR A;  4A2L A;  3DWL C;  3J81 g;  2AH0 A;  1MDA H;  3IIY A;  1U4C A;  1RI6 A;  1MG3 A;  3ULE C;  5IGQ A;  2IAA A;  5CXB B;  2XL3 A;  2PM7 B;  3RN0 D;  5SXM A;  2YNO A;  4GQ1 A;  5IJ8 E;  4U7A A;  1N6F A;  2P9N C;  5HE1 B;  3J80 g;  3V5W B;  2P9I C;  3SHF A;  4ES0 A;  5FLX g;  4IMM A;  4E5Z A;  2HKR A;  3PXS D;  4J0X A;  5FXY A;  4QL1 A;  2PBI B;  4A0A A;  3W15 A;  4J84 A;  4X60 B;  3U4Y A;  3FM0 A;  5FQD A;  2YMU A;  5HE2 B;  4JT5 C;  3UVK A;  3VA6 A;  2YNN A;  4JT6 C;  3I7L A;  4PBY A;  1YFQ A;  5FKT A;  3GRE A;  3KRW B;  5K1C C;  3GFC A;  4AEZ A;  1B9X A;  4CZX A;  4A09 A;  3OTT A;  4Z8L A;  3MZK A;  3MKQ A;  3SBP A;  5TDH B;  4L1Q D;  4H5J A;  4GQ2 P;  4J78 A;  3PVW B;  5TEE A;  4ERZ A;  2J56 H;  4J81 A;  3HFQ A;  1PBY B;  1P22 A;  2Z2O A;  3KRX B;  3UKR C;  4O45 A;  3SJL D;  3JRP A;  4JSV C;  3OL2 B;  2H3X A;  3RSE C;  2AGZ A;  4ZOV A;  2OVP B;  2AGY A;  2IWK A;  1A0R B;  3UVO A;  3BWS A;  2CE8 A;  4J82 A;  3I8C A;  3JPX A;  4LG8 A;  3AL8 B;  3EI2 A;  4A2M A;  4Y5R D;  3EI4 B;  5CYK A;  4J8B A;  4BH6 A;  3FGB A;  3N0E A;  1K32 A;  2I0S A;  2IUV A;  2HES X;  3RFG A;  3UR4 A;  1XKS A;  2YBA A;  3C9C A;  4L9O A;  1PEV A;  2PM6 B;  4TZ4 A;  3VGZ A;  3SVW D;  2H13 A;  4FHL A;  3E0C A;  3EI1 A;  4CY2 A;  5FKQ A;  4JSX C;  2B5L A;  4J73 A;  1JJU B;  3SCY A;  4EWR A;  5AMS A;  3MKS B;  4OZU A;  3F3F A;  3MZL A;  1PI6 A;  3DSM A;  3IKO A;  2XYI A;  3SFZ A;  3IJ0 A;  4KFM B;  3I7H A;  2I0T A;  2I0R A;  1N6E A;  4PSW B;  2PM9 B;  4E54 B;  3EWE A;  4GGA A;  3K27 A;  5IGO A;  4CY5 A;  2P9U C;  1MG2 A;  2AGX A;  4ERQ A;  2IUP A;  4K3J B;  3SXT D;  4PBZ A;  5THA A;  5GXH A;  4A0A B;  2XU7 A;  2AGL A;  5I5M A;  1K8K C;  4A11 B;  4FA4 D;  3OKY B;  3JB9 L;  4JXM A;  5HE3 B;  2P9P C;  3PSL A;  4QRJ A;  4O1Q D;  5C9Z B;  5EM2 B;  4ZOY A;  4JSP C;  3OKT A;  2W18 A;  3ODT A;  5CXC B;  4FAN D;  1JMZ B;  4AOW A;  3RFH A;  2CE9 A;  2H6Q A;  3B7F A;  5HQG A;  4CI1 A;  3SBR A;  5AFU 3;  1QNI A;  4A09 B;  3DM0 A;  4PNK B;  3PSC B;  4A08 B;  3CFS B;  3EI3 A;  4A7J A;  5CXB A;  5EMJ B;  2HJB A;  2IUR A;  3UVM A;  4R7A B;  5IC7 A;  4X63 B;  5EAP A;  3DXK C;  4ERY A;  5HE0 B;  4ESG A;  1L0Q A;  4A0B B;  2BCJ B;  1B9Y A;  2Q7Q A;  2UZY B;  3ZWL B;  4LGN A;  1NEX B;  3A0F A;  3I7K A;  2AH1 A;  4N14 A;  2HYE A;  4CI3 A;  2OJY A;  4ZOZ A;  3EI2 B;  4X61 B;  1SQ9 A;  1TYQ C;  2AGW A;  5CYK B;  3OKW A;  3CFV A;  2OIZ A;  3NVX A;  2H6N A;  1VYH C;  4YVD A;  2H14 A;  3I7O A;  4PXW A;  2AQ5 A;  1XHM A;  5K19 A;  5A2Q g;  3IJ1 A;  3FRX A;  4BL0 A;  5FKR A;  2OVR B;  2MTA H;  3RN1 D;  4GM3 A;  2EBS A;  2H6K A;  2HJ4 A;  5EAM A;  4J86 A;  4GM8 A;  4U1E I;  3C99 A;  4D0K A;  5EAL A;  3I7P A;  3RRM C;  3UKU C;  3RLM D;  2O9K A;  3P4F A;  4ZOX A;  2CNX A;  3F3P A;  4HDJ A;  5H1M A;  5HYN B;  4JSN C;  3V9F A;  2CO0 A;  5B4W A;  3EG6 A;  4D6V A;  3OL2 A;  3I7N A;  3AFC A;  1S4U X;  3SMR A;  4Y7R A;  2IUQ A;  5H17 A;  1GG2 B;  4FWW A;  3UVL A;  3C75 H;  4CZY A;  3NVQ A;  3BG1 A;  3OW8 A;  2GNQ A;  4GZ8 A;  4CZV A;  2B5M A;  3I89 A;  4L3G D;  3EI4 A;  5I5J A;  2OK4 A;  3L4O D;  3EMH A;  5I5I A;  4MK0 B;  4O3U B;  4CI8 A;  5GXI A;  2CN2 A;  4CI2 A;  2OK6 A;  4O3T B;  2TRC B;  3IIW A;  2J55 H;  5TF2 A;  2Z2P A;  2I3S A;  1FWX A;  4E5Z B;  2H68 A;  2H9M A;  2IWF A;  3AL9 A;  4GGD A;  5EML B;  1TBG A;  3SLE D;  3EU7 A;  5KDO B;  4GM9 A;  2P9L C;  4CC9 A;  4FB1 D;  3EI3 B;  2G99 A;  2P9K C;  3PVU B;  5GMK n;  3CIK B;  2B4E A;  2XL2 A;  2P9S C;  4QT8 A;  4L3H D;  5FKS A;  1SQJ A;  3UVN A;  4J87 A;  2Z2N A;  2PM9 A;  4E54 A;  2BBK H;  1Q47 A;  3C5M A;  3RMZ D;  4PC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...