5AFU3

Cryo-em structure of dynein tail-dynactin-bicd2n complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
350
structure length
350
Chain Sequence
HYLVPYNQRANHSKPIPPFLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLATGCNKTTQVYRVSDGSLVARLSDSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSSLGPEYNVFATGSGDCKARIWKYKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords DYNEIN TAIL
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
total genus 34
structure length 350
sequence length 350
chains with identical sequence 4
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5afu300
4ERYA 2B5LA 3VH0A 4U7AA 4LG9A 3EI3B 5H17A 2IUQA 3HFQA 5IJ7E 4CI1A 3DWLC 5EM2A 2P9PC 5GXHA 1U4CA 3CFVA 4CY3A 2TRCB 2YMUA 3PSLA 5H1MA 4PSXB 3SWSD 5IGQA 4IA9A 2H9LA 3FRXA 4LG8A 4PC0A 4JT5C 1XIPA 2XYIA 3EMHA 4A09A 1XKSA 2H6QA 2YNPA 1U2VC 3EU7A 3SBRA 3K26A 2OK4A 3PVUB 2PM9B 3CIKB 2W18A 3CFSB 4JSVC 2PM6B 3RN1D 2P9KC 4YVDA 2HESX 4J81A 1GP2B 2CO0A 3NVNA 3UKRC 1YFQA 3V9FA 4PNKB 3JRPA 2Z2OA 4GQ2P 3JZNA 1P22A 2GC4A 2PM9A 3JROA 5CYKB 4ERQA 3GFCA 3SFZA 2OK6A 4PBZA 1GXRA 4FHLA 3IJCA 2IUPA 2OVPB 4GMBA 4AOWA 2H6KA 4FA9D 5CYKA 3V7DB 3EG6A 4FAVD 2I3SA 1N6EA 2AGWA 3RLMD 1OLZA 2YNNA 5KDOB 3JAMg 4LGNA 2P9NC 4PXWA 4A0AB 4ERZA 5C2WB 1Q47A 2I0SA 4XYHA 2AQ5A 1N6DA 2GNQA 1MG3A 3I7LA 2HJBA 4CI8A 4FWWA 4FAND 1PI6A 2AH1A 4ZOVA 4A0AA 4J0WA 5FKRA 2Z2NA 3IIYA 2IAAA 4J84A 3PXWD 4CI2A 2IURA 3VA6A 3C99A 4E54A 5HE3B 4OWRA 3UVOA 2MTAH 4JXMA 4ES0A 3I8EA 5THAA 4GQ1A 4CY5A 5I5IA 2HYEA 1PBYB 4NSXA 4H5JA 3MKQA 5C9ZB 5K1CC 2H14A 3I2NA 5FKQA 1PGUA 4A09B 4D0KA 4QL1A 2P9IC 3AL9A 3IKOA 4R7AB 4K3ID 5EMLB 3OTTA 3UVLA 3N0DA 3E0CA 5B4WA 3C5MA 4J79A 1VYHC 2EBSA 4X61B 4JSNC 2H47A 3SVWD 4O3UB 4ESGA 3I7HA 1SHYB 2YBAA 3UR4A 1JJUB 4I79A 1NR0A 4Y5RD 2CO0C 5FXYA 3PSCB 4Z8LA 5I5MA 4U1EI 3PXSD 1PEVA 3RFHA 3PE7A 4A2LA 4UI9R 2AGLA 3V5WB 1FWXA 5C2VB 4PSWB 3SJLD 3I7PA 5FA5B 5K19A 4OZUA 2I0TA 1K32A 5HQGA 5GSAA 5HYNB 5H14A 4D6VA 1A0RB 4J78A 3C9CA 4H5IA 4J8BA 4CZYA 5FKSA 3RRMC 4GM9A 3SBQA 5IJ8E 4J73A 3SHFA 2H9PA 1TYQC 4A7JA 3JPXA 3EI2B 4JSPC 3JB9L 2O9KA 1N6FA 2HKMA 2UZYB 4ZN4A 3OKTA 4GZ8A 3SXTD 1SQ9A 2H6NA 2P9UC 2PBIB 3A0FA 4GGAA 4JT6C 4L3HD 4GM3A 5FQDA 4EWRA 5EMMB 3OL2B 4HDJA 2H3XA 3EI2A 5HE1B 2HJ4A 4X60B 1QNIA 3UKUC 3RN0D 3UVNA 4N14A 5FKTA 4KFMB 4FB1D 2I3TA 4O1QD 2P9LC 4ZOZA 4CZVA 2J56H 3OL2A 2OJYA 3EWEA 2CN2A 3GREA 3AFCA 3F3PA 4E54B 4QT8A 2AGXA 3RFGA 4CY2A 5AFU3 3AH8B 3KRWB 1NEXB 2HXCA 3IIWA 5IT9g 4BL0A 5EAPA 2CE8A 3PXTD 2QC5A 2G9AA 2H9NA 2I0RA 3F3FA 3JZGA 1XHMA 4A11B 3SBPA 5EALA 3OKWA 5CXCB 3C75H 1JOFA 3ULEC 4CZXA 2CNXA 3OKYB 4E5ZB 1GOTB 2XU7A 3I7NA 4MK0B 2XL3A 2B5MA 2P9SC 4K3JB 3BWSA 4XEIC 3VGZA 4A11A 3P4FA 4J8GA 3EI1B 1L0QA 4TZ4A 4CC9A 5CXCA 3PVWB 1MDAH 4X3EA 3DM0A 2Q7QA 5TF2A 4GGDA 3OKYA 1ERJA 3MZLA 4E5ZA 5IC7A 3FM0A 3RSEC 5TDHB 4FA4D 2AGYA 3ZWLB 2H9MA 3UVMA 3BG0A 3EI1A 1JMXB 1GG2B 3W15A 2IWFA 3F3GA 3SN6B 2G99A 3EI3A 4BH6A 4FA1D 1OMWB 4FA5D 4O9DA 2PM7B 3DXKC 5IGOA 5TEEA 4ZOXA 5EAMA 1TBGA 3JZHA 3NVXA 2BBKH 5I5JA 2B4EA 3FGBA 3SLED 4AEZA 4GM8A 2OIZA 3MMYA 2AGZA 4XYIA 4CI3A 2H68A 4J86A 4ZOYA 3I7KA 4JSXC 3N0EA 2GC7A 3K27A 2QXVA 3MKSB 2J55H 4Y7RA 3KRXB 2YB8B 5EARA 3DSMA 2CE9A 2XL2A 4J77A 2AH0A 1S4UX 5SXMA 5EMKB 5CXBB 1RI6A 1B9XA 4IMMA 1B9YA 3DXMC 4O3TB 2H13A 3B7FA 2CN3A 2Z2PA 5A2Qg 3OW8A 5FLXg 4G56B 3MXXA 4PBYA 5HE2B 4X63B 3L4OD 3EI4B 4L3GD 3ODTA 3I89A 4A08B 3MZKA 5CXBA 5TEFA 3AL8B 5GMKn 2IUVA 4QRJA 1MG2A 5JWZA 4J87A 1SQJA 4L9OA 4A2MA 2YNOA 5AMSA 3EI4A 2BCJB 1R5MA 3SMRA 4J82A 4A0BB 4A08A 4CY1A 3J81g 4BUJC 3AL8A 3IJ0A 3SCYA 2OVRB 2UZXB 4QQEA 4JD2C 2J57G 3I7OA 4GQBB 3UVKA 1K8KC 3NVQA 3L4MD 3U4YA 4O45A 2IWKA 5AJAA 2HKRA 4J0XA 3J80g 4L1QD 4A0BA 2B5NA 3IJ1A 3I8CA 4GGCA 5EM2B 5HE0B 3ORVD 5EMJB 3RMZD 5GXIA 3BG1A 1JMZB 2OVQB
chains in the Genus database with same CATH superfamily
3K72A 2B5LA 1H2YA 4ERYA 3VH0A 4U7AA 1K3IA 4LG9A 3EI3B 4Z7OA 5H17A 2IUQA 3HFQA 1UTCA 5IJ7E 4CI1A 3DWLC 5EM2A 4G55A 2P9PC 5GXHA 1U4CA 4Z7NA 3CFVA 4CY3A 2TRCB 4NBMA 4MMYA 2YMUA 3PSLA 2BKLA 5H1MA 4PSXB 3SWSD 5IGQA 4IA9A 4WK2A 2H9LA 3FRXA 4LG8A 3NIDA 4JT5C 4PC0A 1XIPA 4JHNA 2XYIA 3EMHA 2VDOA 3FCSA 4A09A 1XKSA 2H6QA 2YNPA 1U2VC 3EU7A 3SBRA 3K26A 2OK4A 3PVUB 1L5GA 3MVDK 2PM9B 3CIKB 1UOPA 2W18A 3CFSB 3IURA 4JSVC 2PM6B 3RN1D 2P9KC 3IUJA 4YVDA 2HESX 4J81A 1GP2B 5M5VA 2CO0A 3NVNA 3UKRC 1YFQA 3QHYB 3V9FA 4PNKB 3JRPA 2Z2OA 4GQ2P 3JZNA 1P22A 2GC4A 2PM9A 3JROA 4QAMA 5CYKB 4ERQA 4WJKA 5M61A 3GFCA 3SFZA 2OK6A 3IUQA 3IUNA 2HU5A 4PBZA 1GXRA 4FHLA 3IJCA 2IUPA 3ZE2A 2OVPB 4GMBA 4AOWA 2H6KA 4FA9D 4WK0A 5CYKA 4AN0A 3V7DB 3EG6A 4FAVD 1QFMA 4RE6A 4UM8A 2I3SA 1N6EA 2AGWA 3RLMD 4G1MA 1JTDB 3MUOA 4AN1A 1OLZA 3IJEA 3EQ9A 2YNNA 5E6SA 5KDOB 5FFGA 3JAMg 4LGNA 2P9NC 4PXWA 4A0AB 4ERZA 5C2WB 3GD1I 1A12A 1Q47A 2I0SA 4BCBA 4XYHA 2AQ5A 1E5TA 1N6DA 3ZDZA 2GNQA 4G1EA 1MG3A 3VI4A 3I7LA 2HJBA 4CI8A 2VDRA 4FWWA 4FAND 1PI6A 2AH1A 4ZOVA 1TYEA 2EIBA 3GC3B 4A0AA 4J0WA 2VDKA 1GOFA 3O4JA 5FKRA 2Z2NA 3IIYA 2IAAA 4J84A 3PXWD 4DNVA 4CI2A 2IURA 3VA6A 3C99A 4E54A 5HE3B 4OWRA 3UVOA 2MTAH 4JXMA 3QI0A 5E6RA 1O6GA 4ES0A 3I8EA 5THAA 4GQ1A 4CY5A 5I5IA 2HYEA 3DDUA 1PBYB 4NSXA 4H5JA 3MKQA 5C9ZB 5K1CC 2H14A 3I2NA 5FKQA 1PGUA 4A09B 4D0KA 4QL1A 1H2ZA 2P9IC 3AL9A 3IKOA 4R7AB 4UM9A 4K3ID 5EMLB 3NIFA 3OTTA 3UVLA 3N0DA 3FCUA 4MMXA 3E0CA 5B4WA 3C5MA 4J79A 1VYHC 2EBSA 4X61B 4JSNC 1BPOA 4BP8A 2H47A 4IRZA 3SVWD 4NENA 4O3UB 4ESGA 3I7HA 1SHYB 2YBAA 3UR4A 1JJUB 4AMYA 3IUMA 1NR0A 4I79A 4Y5RD 2CO0C 5FXYA 2VDLA 3PSCB 4Z8LA 5I5MA 4U1EI 4BCDA 3PXSD 4Z7QA 1PEVA 3RFHA 3PE7A 4A2LA 4UI9R 2AGLA 3IVMA 3V5WB 4D9SA 1FWXA 1YR2A 5C2VB 4PSWB 3SJLD 3I7PA 5FA5B 5K19A 4OZUA 2I0TA 1K32A 5HQGA 5GSAA 5HYNB 3ZDXA 5H14A 4D6VA 4BP9A 1A0RB 4J78A 5FFOA 3C9CA 4H5IA 4J8BA 4CZYA 5FKSA 3RRMC 4GM9A 3SBQA 1UOQA 5IJ8E 4J73A 3SHFA 2HU8A 2H9PA 1TYQC 4A7JA 3JPXA 3EI2B 4JSPC 3JB9L 2O9KA 1N6FA 2HKMA 2UZYB 4L1MA 3ZE1A 4ZN4A 3OKTA 2EICA 4GZ8A 3SXTD 1SQ9A 2H6NA 2P9UC 2PBIB 3A0FA 4GGAA 4GM3A 4JT6C 4L3HD 5FQDA 4EWRA 5EMMB 3NIGA 3OL2B 4HDJA 4AX4A 2H3XA 3EI2A 5HE1B 1C9LA 2HJ4A 4X60B 1QNIA 3UKUC 3RN0D 3UVNA 4N14A 5FKTA 4KFMB 4FB1D 1H2WA 2I3TA 4DNWA 4NC4A 4O1QD 2P9LC 4ZOZA 4CZVA 2J56H 3OL2A 2OJYA 1GOGA 3EWEA 2CN2A 3EQ8A 3GREA 3ZE0A 3AFCA 3F3PA 4E54B 4QT8A 4O02A 2AGXA 3RFGA 4CY2A 5AFU3 3AH8B 3KRWB 1NEXB 2HXCA 3IIWA 5IT9g 2VDPA 3K6SA 4BL0A 5EAPA 1VE6A 2CE8A 3PXTD 4MMZA 5E6UA 2QC5A 2G9AA 2H9NA 2I0RA 3F3FA 3JZGA 1QFSA 1XHMA 3V4VA 4A11B 3SBPA 2JKXA 5EALA 3OKWA 5CXCB 3C75H 1JOFA 4O2WA 1JV2A 3ULEC 4CZXA 2CNXA 3OKYB 3O4IA 4E5ZB 1GOTB 2XU7A 3I7NA 4MK0B 2XL3A 2B5MA 2P9SC 4K3JB 3BWSA 4XEIC 3VGZA 4A11A 3P4FA 4J8GA 3EI1B 1L0QA 4TZ4A 4CC9A 2VC2A 2VDMA 3PVWB 5CXCA 1MDAH 4X3EA 3T3MA 3DM0A 2Q7QA 1U8CA 5TF2A 3MUNA 4GGDA 3OKYA 1ERJA 3MZLA 4E5ZA 4BCCA 5IC7A 1VZ2A 3FM0A 2XZGA 3RSEC 5M5UA 5TDHB 4NAAA 3OF7A 4FA4D 2AGYA 3ZWLB 2H9MA 3UVMA 3BG0A 3EI1A 1JMXB 1GG2B 3W15A 2IWFA 3F3GA 5M5TA 3SN6B 4WK4A 2G99A 3EI3A 4BH6A 4FA1D 1OMWB 4FA5D 4O9DA 2QZPA 2PM7B 3DXKC 5IGOA 5TEEA 4ZOXA 5EAMA 1TBGA 3JZHA 2VZ1A 3T3PA 2EIEA 3NVXA 2VDNA 1UOOA 2BBKH 1E8NA 5I5JA 2B4EA 3FGBA 3SLED 4AEZA 5M5SA 4GM8A 2OIZA 3MMYA 2AGZA 3K71A 4XYIA 4CI3A 2H68A 5HDBA 2VDQA 4J86A 4ZOYA 3I7KA 4JSXC 3N0EA 1C9IA 2GC7A 3ZDYA 3K27A 2QXVA 2EIDA 3MKSB 3VI3A 2J55H 4Y7RA 3KRXB 2YB8B 1M1XA 5EARA 2XE4A 3DSMA 2CE9A 2XL2A 4J77A 2AH0A 1S4UX 1VZ3A 5SXMA 5EMKB 5CXBB 1RI6A 1B9XA 4IMMA 1B9YA 3DXMC 4AMZA 4O3TB 1GOHA 2H13A 3B7FA 1I2MB 2CN3A 2Z2PA 5A2Qg 3OW8A 5FLXg 4G56B 4RE5A 3MXXA 4PBYA 5HE2B 4X63B 5C86A 3L4OD 3O4HA 1O6FA 3EI4B 4L3GD 3ODTA 3I89A 4A08B 3MZKA 5CXBA 5C92A 5TEFA 1T2XA 3AL8B 5M5RA 5GMKn 2IUVA 4QRJA 2WQ8A 1MG2A 3KCIA 4J87A 5JWZA 3EQ7A 1SQJA 3O4GA 4L9OA 4A2MA 2YNOA 5AMSA 3EI4A 4DNUA 2BCJB 1R5MA 3SMRA 4J82A 4A0BB 4A08A 4JHPC 4CY1A 3V4PA 3IULA 4BUJC 3J81g 3AL8A 3IJ0A 3SCYA 2OVRB 2UZXB 4QQEA 4JD2C 2J57G 3I7OA 4GQBB 3UVKA 1K8KC 2HU7A 3NVQA 3L4MD 3U4YA 2VZ3A 4O45A 2IWKA 5AJAA 2HKRA 4J0XA 3J80g 4L1QD 1VE7A 4A0BA 2B5NA 1E8MA 3IJ1A 3I8CA 4GGCA 5EM2B 2XDWA 5HE0B 3ORVD 2QR5A 5EMJB 3RMZD 1H2XA 3BG1A 5GXIA 1JMZB 2OVQB
chains in the Genus database with same CATH topology
4ERYA 2B5LA 3VH0A 4U7AA 4LG9A 3EI3B 5H17A 2IUQA 3HFQA 5IJ7E 4CI1A 3DWLC 5EM2A 2P9PC 5GXHA 1U4CA 3CFVA 4CY3A 2TRCB 2YMUA 3PSLA 5H1MA 4PSXB 3SWSD 5IGQA 4IA9A 2H9LA 3FRXA 4LG8A 4PC0A 4JT5C 1XIPA 2XYIA 3EMHA 4A09A 1XKSA 2H6QA 2YNPA 1U2VC 3EU7A 3SBRA 3K26A 2OK4A 3PVUB 2PM9B 3CIKB 2W18A 3CFSB 4JSVC 2PM6B 3RN1D 2P9KC 4YVDA 2HESX 4J81A 1GP2B 2CO0A 3NVNA 3UKRC 1YFQA 3V9FA 4PNKB 3JRPA 2Z2OA 4GQ2P 3JZNA 1P22A 2GC4A 2PM9A 3JROA 5CYKB 4ERQA 3GFCA 3SFZA 2OK6A 4PBZA 1GXRA 4FHLA 3IJCA 2IUPA 2OVPB 4GMBA 4AOWA 2H6KA 4FA9D 5CYKA 3V7DB 3EG6A 4FAVD 2I3SA 1N6EA 2AGWA 3RLMD 1OLZA 2YNNA 5KDOB 3JAMg 4LGNA 2P9NC 4PXWA 4A0AB 4ERZA 5C2WB 1Q47A 2I0SA 4XYHA 2AQ5A 1N6DA 2GNQA 1MG3A 3I7LA 2HJBA 4CI8A 4FWWA 4FAND 1PI6A 2AH1A 4ZOVA 4A0AA 4J0WA 5FKRA 2Z2NA 3IIYA 2IAAA 4J84A 3PXWD 4CI2A 2IURA 3VA6A 3C99A 4E54A 5HE3B 4OWRA 3UVOA 2MTAH 4JXMA 4ES0A 3I8EA 5THAA 4GQ1A 4CY5A 5I5IA 2HYEA 1PBYB 4NSXA 4H5JA 3MKQA 5C9ZB 5K1CC 2H14A 3I2NA 5FKQA 1PGUA 4A09B 4D0KA 4QL1A 2P9IC 3AL9A 3IKOA 4R7AB 4K3ID 5EMLB 3OTTA 3UVLA 3N0DA 3E0CA 5B4WA 3C5MA 4J79A 1VYHC 2EBSA 4X61B 4JSNC 2H47A 3SVWD 4O3UB 4ESGA 3I7HA 1SHYB 2YBAA 3UR4A 1JJUB 4I79A 1NR0A 4Y5RD 2CO0C 5FXYA 3PSCB 4Z8LA 5I5MA 4U1EI 3PXSD 1PEVA 3RFHA 3PE7A 4A2LA 4UI9R 2AGLA 3V5WB 1FWXA 5C2VB 4PSWB 3SJLD 3I7PA 5FA5B 5K19A 4OZUA 2I0TA 1K32A 5HQGA 5GSAA 5HYNB 5H14A 4D6VA 1A0RB 4J78A 3C9CA 4H5IA 4J8BA 4CZYA 5FKSA 3RRMC 4GM9A 3SBQA 5IJ8E 4J73A 3SHFA 2H9PA 1TYQC 4A7JA 3JPXA 3EI2B 4JSPC 3JB9L 2O9KA 1N6FA 2HKMA 2UZYB 4ZN4A 3OKTA 4GZ8A 3SXTD 1SQ9A 2H6NA 2P9UC 2PBIB 3A0FA 4GGAA 4JT6C 4L3HD 4GM3A 5FQDA 4EWRA 5EMMB 3OL2B 4HDJA 2H3XA 3EI2A 5HE1B 2HJ4A 4X60B 1QNIA 3UKUC 3RN0D 3UVNA 4N14A 5FKTA 4KFMB 4FB1D 2I3TA 4O1QD 2P9LC 4ZOZA 4CZVA 2J56H 3OL2A 2OJYA 3EWEA 2CN2A 3GREA 3AFCA 3F3PA 4E54B 4QT8A 2AGXA 3RFGA 4CY2A 5AFU3 3AH8B 3KRWB 1NEXB 2HXCA 3IIWA 5IT9g 4BL0A 5EAPA 2CE8A 3PXTD 2QC5A 2G9AA 2H9NA 2I0RA 3F3FA 3JZGA 1XHMA 4A11B 3SBPA 5EALA 3OKWA 5CXCB 3C75H 1JOFA 3ULEC 4CZXA 2CNXA 3OKYB 4E5ZB 1GOTB 2XU7A 3I7NA 4MK0B 2XL3A 2B5MA 2P9SC 4K3JB 3BWSA 4XEIC 3VGZA 4A11A 3P4FA 4J8GA 3EI1B 1L0QA 4TZ4A 4CC9A 5CXCA 3PVWB 1MDAH 4X3EA 3DM0A 2Q7QA 5TF2A 4GGDA 3OKYA 1ERJA 3MZLA 4E5ZA 5IC7A 3FM0A 3RSEC 5TDHB 4FA4D 2AGYA 3ZWLB 2H9MA 3UVMA 3BG0A 3EI1A 1JMXB 1GG2B 3W15A 2IWFA 3F3GA 3SN6B 2G99A 3EI3A 4BH6A 4FA1D 1OMWB 4FA5D 4O9DA 2PM7B 3DXKC 5IGOA 5TEEA 4ZOXA 5EAMA 1TBGA 3JZHA 3NVXA 2BBKH 5I5JA 2B4EA 3FGBA 3SLED 4AEZA 4GM8A 2OIZA 3MMYA 2AGZA 4XYIA 4CI3A 2H68A 4J86A 4ZOYA 3I7KA 4JSXC 3N0EA 2GC7A 3K27A 2QXVA 3MKSB 2J55H 4Y7RA 3KRXB 2YB8B 5EARA 3DSMA 2CE9A 2XL2A 4J77A 2AH0A 1S4UX 5SXMA 5EMKB 5CXBB 1RI6A 1B9XA 4IMMA 1B9YA 3DXMC 4O3TB 2H13A 3B7FA 2CN3A 2Z2PA 5A2Qg 3OW8A 5FLXg 4G56B 3MXXA 4PBYA 5HE2B 4X63B 3L4OD 3EI4B 4L3GD 3ODTA 3I89A 4A08B 3MZKA 5CXBA 5TEFA 3AL8B 5GMKn 2IUVA 4QRJA 1MG2A 5JWZA 4J87A 1SQJA 4L9OA 4A2MA 2YNOA 5AMSA 3EI4A 2BCJB 1R5MA 3SMRA 4J82A 4A0BB 4A08A 4CY1A 3J81g 4BUJC 3AL8A 3IJ0A 3SCYA 2OVRB 2UZXB 4QQEA 4JD2C 2J57G 3I7OA 4GQBB 3UVKA 1K8KC 3NVQA 3L4MD 3U4YA 4O45A 2IWKA 5AJAA 2HKRA 4J0XA 3J80g 4L1QD 4A0BA 2B5NA 3IJ1A 3I8CA 4GGCA 5EM2B 5HE0B 3ORVD 5EMJB 3RMZD 5GXIA 3BG1A 1JMZB 2OVQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ERY A;  2B5L A;  3VH0 A;  4U7A A;  4LG9 A;  3EI3 B;  5H17 A;  2IUQ A;  3HFQ A;  5IJ7 E;  4CI1 A;  3DWL C;  5EM2 A;  2P9P C;  5GXH A;  1U4C A;  3CFV A;  4CY3 A;  2TRC B;  2YMU A;  3PSL A;  5H1M A;  4PSX B;  3SWS D;  5IGQ A;  4IA9 A;  2H9L A;  3FRX A;  4LG8 A;  4PC0 A;  4JT5 C;  1XIP A;  2XYI A;  3EMH A;  4A09 A;  1XKS A;  2H6Q A;  2YNP A;  1U2V C;  3EU7 A;  3SBR A;  3K26 A;  2OK4 A;  3PVU B;  2PM9 B;  3CIK B;  2W18 A;  3CFS B;  4JSV C;  2PM6 B;  3RN1 D;  2P9K C;  4YVD A;  2HES X;  4J81 A;  1GP2 B;  2CO0 A;  3NVN A;  3UKR C;  1YFQ A;  3V9F A;  4PNK B;  3JRP A;  2Z2O A;  4GQ2 P;  3JZN A;  1P22 A;  2GC4 A;  2PM9 A;  3JRO A;  5CYK B;  4ERQ A;  3GFC A;  3SFZ A;  2OK6 A;  4PBZ A;  1GXR A;  4FHL A;  3IJC A;  2IUP A;  2OVP B;  4GMB A;  4AOW A;  2H6K A;  4FA9 D;  5CYK A;  3V7D B;  3EG6 A;  4FAV D;  2I3S A;  1N6E A;  2AGW A;  3RLM D;  1OLZ A;  2YNN A;  5KDO B;  3JAM g;  4LGN A;  2P9N C;  4PXW A;  4A0A B;  4ERZ A;  5C2W B;  1Q47 A;  2I0S A;  4XYH A;  2AQ5 A;  1N6D A;  2GNQ A;  1MG3 A;  3I7L A;  2HJB A;  4CI8 A;  4FWW A;  4FAN D;  1PI6 A;  2AH1 A;  4ZOV A;  4A0A A;  4J0W A;  5FKR A;  2Z2N A;  3IIY A;  2IAA A;  4J84 A;  3PXW D;  4CI2 A;  2IUR A;  3VA6 A;  3C99 A;  4E54 A;  5HE3 B;  4OWR A;  3UVO A;  2MTA H;  4JXM A;  4ES0 A;  3I8E A;  5THA A;  4GQ1 A;  4CY5 A;  5I5I A;  2HYE A;  1PBY B;  4NSX A;  4H5J A;  3MKQ A;  5C9Z B;  5K1C C;  2H14 A;  3I2N A;  5FKQ A;  1PGU A;  4A09 B;  4D0K A;  4QL1 A;  2P9I C;  3AL9 A;  3IKO A;  4R7A B;  4K3I D;  5EML B;  3OTT A;  3UVL A;  3N0D A;  3E0C A;  5B4W A;  3C5M A;  4J79 A;  1VYH C;  2EBS A;  4X61 B;  4JSN C;  2H47 A;  3SVW D;  4O3U B;  4ESG A;  3I7H A;  1SHY B;  2YBA A;  3UR4 A;  1JJU B;  4I79 A;  1NR0 A;  4Y5R D;  2CO0 C;  5FXY A;  3PSC B;  4Z8L A;  5I5M A;  4U1E I;  3PXS D;  1PEV A;  3RFH A;  3PE7 A;  4A2L A;  4UI9 R;  2AGL A;  3V5W B;  1FWX A;  5C2V B;  4PSW B;  3SJL D;  3I7P A;  5FA5 B;  5K19 A;  4OZU A;  2I0T A;  1K32 A;  5HQG A;  5GSA A;  5HYN B;  5H14 A;  4D6V A;  1A0R B;  4J78 A;  3C9C A;  4H5I A;  4J8B A;  4CZY A;  5FKS A;  3RRM C;  4GM9 A;  3SBQ A;  5IJ8 E;  4J73 A;  3SHF A;  2H9P A;  1TYQ C;  4A7J A;  3JPX A;  3EI2 B;  4JSP C;  3JB9 L;  2O9K A;  1N6F A;  2HKM A;  2UZY B;  4ZN4 A;  3OKT A;  4GZ8 A;  3SXT D;  1SQ9 A;  2H6N A;  2P9U C;  2PBI B;  3A0F A;  4GGA A;  4JT6 C;  4L3H D;  4GM3 A;  5FQD A;  4EWR A;  5EMM B;  3OL2 B;  4HDJ A;  2H3X A;  3EI2 A;  5HE1 B;  2HJ4 A;  4X60 B;  1QNI A;  3UKU C;  3RN0 D;  3UVN A;  4N14 A;  5FKT A;  4KFM B;  4FB1 D;  2I3T A;  4O1Q D;  2P9L C;  4ZOZ A;  4CZV A;  2J56 H;  3OL2 A;  2OJY A;  3EWE A;  2CN2 A;  3GRE A;  3AFC A;  3F3P A;  4E54 B;  4QT8 A;  2AGX A;  3RFG A;  4CY2 A;  5AFU 3;  3AH8 B;  3KRW B;  1NEX B;  2HXC A;  3IIW A;  5IT9 g;  4BL0 A;  5EAP A;  2CE8 A;  3PXT D;  2QC5 A;  2G9A A;  2H9N A;  2I0R A;  3F3F A;  3JZG A;  1XHM A;  4A11 B;  3SBP A;  5EAL A;  3OKW A;  5CXC B;  3C75 H;  1JOF A;  3ULE C;  4CZX A;  2CNX A;  3OKY B;  4E5Z B;  1GOT B;  2XU7 A;  3I7N A;  4MK0 B;  2XL3 A;  2B5M A;  2P9S C;  4K3J B;  3BWS A;  4XEI C;  3VGZ A;  4A11 A;  3P4F A;  4J8G A;  3EI1 B;  1L0Q A;  4TZ4 A;  4CC9 A;  5CXC A;  3PVW B;  1MDA H;  4X3E A;  3DM0 A;  2Q7Q A;  5TF2 A;  4GGD A;  3OKY A;  1ERJ A;  3MZL A;  4E5Z A;  5IC7 A;  3FM0 A;  3RSE C;  5TDH B;  4FA4 D;  2AGY A;  3ZWL B;  2H9M A;  3UVM A;  3BG0 A;  3EI1 A;  1JMX B;  1GG2 B;  3W15 A;  2IWF A;  3F3G A;  3SN6 B;  2G99 A;  3EI3 A;  4BH6 A;  4FA1 D;  1OMW B;  4FA5 D;  4O9D A;  2PM7 B;  3DXK C;  5IGO A;  5TEE A;  4ZOX A;  5EAM A;  1TBG A;  3JZH A;  3NVX A;  2BBK H;  5I5J A;  2B4E A;  3FGB A;  3SLE D;  4AEZ A;  4GM8 A;  2OIZ A;  3MMY A;  2AGZ A;  4XYI A;  4CI3 A;  2H68 A;  4J86 A;  4ZOY A;  3I7K A;  4JSX C;  3N0E A;  2GC7 A;  3K27 A;  2QXV A;  3MKS B;  2J55 H;  4Y7R A;  3KRX B;  2YB8 B;  5EAR A;  3DSM A;  2CE9 A;  2XL2 A;  4J77 A;  2AH0 A;  1S4U X;  5SXM A;  5EMK B;  5CXB B;  1RI6 A;  1B9X A;  4IMM A;  1B9Y A;  3DXM C;  4O3T B;  2H13 A;  3B7F A;  2CN3 A;  2Z2P A;  5A2Q g;  3OW8 A;  5FLX g;  4G56 B;  3MXX A;  4PBY A;  5HE2 B;  4X63 B;  3L4O D;  3EI4 B;  4L3G D;  3ODT A;  3I89 A;  4A08 B;  3MZK A;  5CXB A;  5TEF A;  3AL8 B;  5GMK n;  2IUV A;  4QRJ A;  1MG2 A;  5JWZ A;  4J87 A;  1SQJ A;  4L9O A;  4A2M A;  2YNO A;  5AMS A;  3EI4 A;  2BCJ B;  1R5M A;  3SMR A;  4J82 A;  4A0B B;  4A08 A;  4CY1 A;  3J81 g;  4BUJ C;  3AL8 A;  3IJ0 A;  3SCY A;  2OVR B;  2UZX B;  4QQE A;  4JD2 C;  2J57 G;  3I7O A;  4GQB B;  3UVK A;  1K8K C;  3NVQ A;  3L4M D;  3U4Y A;  4O45 A;  2IWK A;  5AJA A;  2HKR A;  4J0X A;  3J80 g;  4L1Q D;  4A0B A;  2B5N A;  3IJ1 A;  3I8C A;  4GGC A;  5EM2 B;  5HE0 B;  3ORV D;  5EMJ B;  3RMZ D;  5GXI A;  3BG1 A;  1JMZ B;  2OVQ B; 
#chains in the Genus database with same CATH topology
 3K72 A;  2B5L A;  1H2Y A;  4ERY A;  3VH0 A;  4U7A A;  1K3I A;  4LG9 A;  3EI3 B;  4Z7O A;  5H17 A;  2IUQ A;  3HFQ A;  1UTC A;  5IJ7 E;  4CI1 A;  3DWL C;  5EM2 A;  4G55 A;  2P9P C;  5GXH A;  1U4C A;  4Z7N A;  3CFV A;  4CY3 A;  2TRC B;  4NBM A;  4MMY A;  2YMU A;  3PSL A;  2BKL A;  5H1M A;  4PSX B;  3SWS D;  5IGQ A;  4IA9 A;  4WK2 A;  2H9L A;  3FRX A;  4LG8 A;  3NID A;  4JT5 C;  4PC0 A;  1XIP A;  4JHN A;  2XYI A;  3EMH A;  2VDO A;  3FCS A;  4A09 A;  1XKS A;  2H6Q A;  2YNP A;  1U2V C;  3EU7 A;  3SBR A;  3K26 A;  2OK4 A;  3PVU B;  1L5G A;  3MVD K;  2PM9 B;  3CIK B;  1UOP A;  2W18 A;  3CFS B;  3IUR A;  4JSV C;  2PM6 B;  3RN1 D;  2P9K C;  3IUJ A;  4YVD A;  2HES X;  4J81 A;  1GP2 B;  5M5V A;  2CO0 A;  3NVN A;  3UKR C;  1YFQ A;  3QHY B;  3V9F A;  4PNK B;  3JRP A;  2Z2O A;  4GQ2 P;  3JZN A;  1P22 A;  2GC4 A;  2PM9 A;  3JRO A;  4QAM A;  5CYK B;  4ERQ A;  4WJK A;  5M61 A;  3GFC A;  3SFZ A;  2OK6 A;  3IUQ A;  3IUN A;  2HU5 A;  4PBZ A;  1GXR A;  4FHL A;  3IJC A;  2IUP A;  3ZE2 A;  2OVP B;  4GMB A;  4AOW A;  2H6K A;  4FA9 D;  4WK0 A;  5CYK A;  4AN0 A;  3V7D B;  3EG6 A;  4FAV D;  1QFM A;  4RE6 A;  4UM8 A;  2I3S A;  1N6E A;  2AGW A;  3RLM D;  4G1M A;  1JTD B;  3MUO A;  4AN1 A;  1OLZ A;  3IJE A;  3EQ9 A;  2YNN A;  5E6S A;  5KDO B;  5FFG A;  3JAM g;  4LGN A;  2P9N C;  4PXW A;  4A0A B;  4ERZ A;  5C2W B;  3GD1 I;  1A12 A;  1Q47 A;  2I0S A;  4BCB A;  4XYH A;  2AQ5 A;  1E5T A;  1N6D A;  3ZDZ A;  2GNQ A;  4G1E A;  1MG3 A;  3VI4 A;  3I7L A;  2HJB A;  4CI8 A;  2VDR A;  4FWW A;  4FAN D;  1PI6 A;  2AH1 A;  4ZOV A;  1TYE A;  2EIB A;  3GC3 B;  4A0A A;  4J0W A;  2VDK A;  1GOF A;  3O4J A;  5FKR A;  2Z2N A;  3IIY A;  2IAA A;  4J84 A;  3PXW D;  4DNV A;  4CI2 A;  2IUR A;  3VA6 A;  3C99 A;  4E54 A;  5HE3 B;  4OWR A;  3UVO A;  2MTA H;  4JXM A;  3QI0 A;  5E6R A;  1O6G A;  4ES0 A;  3I8E A;  5THA A;  4GQ1 A;  4CY5 A;  5I5I A;  2HYE A;  3DDU A;  1PBY B;  4NSX A;  4H5J A;  3MKQ A;  5C9Z B;  5K1C C;  2H14 A;  3I2N A;  5FKQ A;  1PGU A;  4A09 B;  4D0K A;  4QL1 A;  1H2Z A;  2P9I C;  3AL9 A;  3IKO A;  4R7A B;  4UM9 A;  4K3I D;  5EML B;  3NIF A;  3OTT A;  3UVL A;  3N0D A;  3FCU A;  4MMX A;  3E0C A;  5B4W A;  3C5M A;  4J79 A;  1VYH C;  2EBS A;  4X61 B;  4JSN C;  1BPO A;  4BP8 A;  2H47 A;  4IRZ A;  3SVW D;  4NEN A;  4O3U B;  4ESG A;  3I7H A;  1SHY B;  2YBA A;  3UR4 A;  1JJU B;  4AMY A;  3IUM A;  1NR0 A;  4I79 A;  4Y5R D;  2CO0 C;  5FXY A;  2VDL A;  3PSC B;  4Z8L A;  5I5M A;  4U1E I;  4BCD A;  3PXS D;  4Z7Q A;  1PEV A;  3RFH A;  3PE7 A;  4A2L A;  4UI9 R;  2AGL A;  3IVM A;  3V5W B;  4D9S A;  1FWX A;  1YR2 A;  5C2V B;  4PSW B;  3SJL D;  3I7P A;  5FA5 B;  5K19 A;  4OZU A;  2I0T A;  1K32 A;  5HQG A;  5GSA A;  5HYN B;  3ZDX A;  5H14 A;  4D6V A;  4BP9 A;  1A0R B;  4J78 A;  5FFO A;  3C9C A;  4H5I A;  4J8B A;  4CZY A;  5FKS A;  3RRM C;  4GM9 A;  3SBQ A;  1UOQ A;  5IJ8 E;  4J73 A;  3SHF A;  2HU8 A;  2H9P A;  1TYQ C;  4A7J A;  3JPX A;  3EI2 B;  4JSP C;  3JB9 L;  2O9K A;  1N6F A;  2HKM A;  2UZY B;  4L1M A;  3ZE1 A;  4ZN4 A;  3OKT A;  2EIC A;  4GZ8 A;  3SXT D;  1SQ9 A;  2H6N A;  2P9U C;  2PBI B;  3A0F A;  4GGA A;  4GM3 A;  4JT6 C;  4L3H D;  5FQD A;  4EWR A;  5EMM B;  3NIG A;  3OL2 B;  4HDJ A;  4AX4 A;  2H3X A;  3EI2 A;  5HE1 B;  1C9L A;  2HJ4 A;  4X60 B;  1QNI A;  3UKU C;  3RN0 D;  3UVN A;  4N14 A;  5FKT A;  4KFM B;  4FB1 D;  1H2W A;  2I3T A;  4DNW A;  4NC4 A;  4O1Q D;  2P9L C;  4ZOZ A;  4CZV A;  2J56 H;  3OL2 A;  2OJY A;  1GOG A;  3EWE A;  2CN2 A;  3EQ8 A;  3GRE A;  3ZE0 A;  3AFC A;  3F3P A;  4E54 B;  4QT8 A;  4O02 A;  2AGX A;  3RFG A;  4CY2 A;  5AFU 3;  3AH8 B;  3KRW B;  1NEX B;  2HXC A;  3IIW A;  5IT9 g;  2VDP A;  3K6S A;  4BL0 A;  5EAP A;  1VE6 A;  2CE8 A;  3PXT D;  4MMZ A;  5E6U A;  2QC5 A;  2G9A A;  2H9N A;  2I0R A;  3F3F A;  3JZG A;  1QFS A;  1XHM A;  3V4V A;  4A11 B;  3SBP A;  2JKX A;  5EAL A;  3OKW A;  5CXC B;  3C75 H;  1JOF A;  4O2W A;  1JV2 A;  3ULE C;  4CZX A;  2CNX A;  3OKY B;  3O4I A;  4E5Z B;  1GOT B;  2XU7 A;  3I7N A;  4MK0 B;  2XL3 A;  2B5M A;  2P9S C;  4K3J B;  3BWS A;  4XEI C;  3VGZ A;  4A11 A;  3P4F A;  4J8G A;  3EI1 B;  1L0Q A;  4TZ4 A;  4CC9 A;  2VC2 A;  2VDM A;  3PVW B;  5CXC A;  1MDA H;  4X3E A;  3T3M A;  3DM0 A;  2Q7Q A;  1U8C A;  5TF2 A;  3MUN A;  4GGD A;  3OKY A;  1ERJ A;  3MZL A;  4E5Z A;  4BCC A;  5IC7 A;  1VZ2 A;  3FM0 A;  2XZG A;  3RSE C;  5M5U A;  5TDH B;  4NAA A;  3OF7 A;  4FA4 D;  2AGY A;  3ZWL B;  2H9M A;  3UVM A;  3BG0 A;  3EI1 A;  1JMX B;  1GG2 B;  3W15 A;  2IWF A;  3F3G A;  5M5T A;  3SN6 B;  4WK4 A;  2G99 A;  3EI3 A;  4BH6 A;  4FA1 D;  1OMW B;  4FA5 D;  4O9D A;  2QZP A;  2PM7 B;  3DXK C;  5IGO A;  5TEE A;  4ZOX A;  5EAM A;  1TBG A;  3JZH A;  2VZ1 A;  3T3P A;  2EIE A;  3NVX A;  2VDN A;  1UOO A;  2BBK H;  1E8N A;  5I5J A;  2B4E A;  3FGB A;  3SLE D;  4AEZ A;  5M5S A;  4GM8 A;  2OIZ A;  3MMY A;  2AGZ A;  3K71 A;  4XYI A;  4CI3 A;  2H68 A;  5HDB A;  2VDQ A;  4J86 A;  4ZOY A;  3I7K A;  4JSX C;  3N0E A;  1C9I A;  2GC7 A;  3ZDY A;  3K27 A;  2QXV A;  2EID A;  3MKS B;  3VI3 A;  2J55 H;  4Y7R A;  3KRX B;  2YB8 B;  1M1X A;  5EAR A;  2XE4 A;  3DSM A;  2CE9 A;  2XL2 A;  4J77 A;  2AH0 A;  1S4U X;  1VZ3 A;  5SXM A;  5EMK B;  5CXB B;  1RI6 A;  1B9X A;  4IMM A;  1B9Y A;  3DXM C;  4AMZ A;  4O3T B;  1GOH A;  2H13 A;  3B7F A;  1I2M B;  2CN3 A;  2Z2P A;  5A2Q g;  3OW8 A;  5FLX g;  4G56 B;  4RE5 A;  3MXX A;  4PBY A;  5HE2 B;  4X63 B;  5C86 A;  3L4O D;  3O4H A;  1O6F A;  3EI4 B;  4L3G D;  3ODT A;  3I89 A;  4A08 B;  3MZK A;  5CXB A;  5C92 A;  5TEF A;  1T2X A;  3AL8 B;  5M5R A;  5GMK n;  2IUV A;  4QRJ A;  2WQ8 A;  1MG2 A;  3KCI A;  4J87 A;  5JWZ A;  3EQ7 A;  1SQJ A;  3O4G A;  4L9O A;  4A2M A;  2YNO A;  5AMS A;  3EI4 A;  4DNU A;  2BCJ B;  1R5M A;  3SMR A;  4J82 A;  4A0B B;  4A08 A;  4JHP C;  4CY1 A;  3V4P A;  3IUL A;  4BUJ C;  3J81 g;  3AL8 A;  3IJ0 A;  3SCY A;  2OVR B;  2UZX B;  4QQE A;  4JD2 C;  2J57 G;  3I7O A;  4GQB B;  3UVK A;  1K8K C;  2HU7 A;  3NVQ A;  3L4M D;  3U4Y A;  2VZ3 A;  4O45 A;  2IWK A;  5AJA A;  2HKR A;  4J0X A;  3J80 g;  4L1Q D;  1VE7 A;  4A0B A;  2B5N A;  1E8M A;  3IJ1 A;  3I8C A;  4GGC A;  5EM2 B;  2XDW A;  5HE0 B;  3ORV D;  2QR5 A;  5EMJ B;  3RMZ D;  1H2X A;  3BG1 A;  5GXI A;  1JMZ B;  2OVQ B; 
#chains in the Genus database with same CATH homology
 4ERY A;  2B5L A;  3VH0 A;  4U7A A;  4LG9 A;  3EI3 B;  5H17 A;  2IUQ A;  3HFQ A;  5IJ7 E;  4CI1 A;  3DWL C;  5EM2 A;  2P9P C;  5GXH A;  1U4C A;  3CFV A;  4CY3 A;  2TRC B;  2YMU A;  3PSL A;  5H1M A;  4PSX B;  3SWS D;  5IGQ A;  4IA9 A;  2H9L A;  3FRX A;  4LG8 A;  4PC0 A;  4JT5 C;  1XIP A;  2XYI A;  3EMH A;  4A09 A;  1XKS A;  2H6Q A;  2YNP A;  1U2V C;  3EU7 A;  3SBR A;  3K26 A;  2OK4 A;  3PVU B;  2PM9 B;  3CIK B;  2W18 A;  3CFS B;  4JSV C;  2PM6 B;  3RN1 D;  2P9K C;  4YVD A;  2HES X;  4J81 A;  1GP2 B;  2CO0 A;  3NVN A;  3UKR C;  1YFQ A;  3V9F A;  4PNK B;  3JRP A;  2Z2O A;  4GQ2 P;  3JZN A;  1P22 A;  2GC4 A;  2PM9 A;  3JRO A;  5CYK B;  4ERQ A;  3GFC A;  3SFZ A;  2OK6 A;  4PBZ A;  1GXR A;  4FHL A;  3IJC A;  2IUP A;  2OVP B;  4GMB A;  4AOW A;  2H6K A;  4FA9 D;  5CYK A;  3V7D B;  3EG6 A;  4FAV D;  2I3S A;  1N6E A;  2AGW A;  3RLM D;  1OLZ A;  2YNN A;  5KDO B;  3JAM g;  4LGN A;  2P9N C;  4PXW A;  4A0A B;  4ERZ A;  5C2W B;  1Q47 A;  2I0S A;  4XYH A;  2AQ5 A;  1N6D A;  2GNQ A;  1MG3 A;  3I7L A;  2HJB A;  4CI8 A;  4FWW A;  4FAN D;  1PI6 A;  2AH1 A;  4ZOV A;  4A0A A;  4J0W A;  5FKR A;  2Z2N A;  3IIY A;  2IAA A;  4J84 A;  3PXW D;  4CI2 A;  2IUR A;  3VA6 A;  3C99 A;  4E54 A;  5HE3 B;  4OWR A;  3UVO A;  2MTA H;  4JXM A;  4ES0 A;  3I8E A;  5THA A;  4GQ1 A;  4CY5 A;  5I5I A;  2HYE A;  1PBY B;  4NSX A;  4H5J A;  3MKQ A;  5C9Z B;  5K1C C;  2H14 A;  3I2N A;  5FKQ A;  1PGU A;  4A09 B;  4D0K A;  4QL1 A;  2P9I C;  3AL9 A;  3IKO A;  4R7A B;  4K3I D;  5EML B;  3OTT A;  3UVL A;  3N0D A;  3E0C A;  5B4W A;  3C5M A;  4J79 A;  1VYH C;  2EBS A;  4X61 B;  4JSN C;  2H47 A;  3SVW D;  4O3U B;  4ESG A;  3I7H A;  1SHY B;  2YBA A;  3UR4 A;  1JJU B;  4I79 A;  1NR0 A;  4Y5R D;  2CO0 C;  5FXY A;  3PSC B;  4Z8L A;  5I5M A;  4U1E I;  3PXS D;  1PEV A;  3RFH A;  3PE7 A;  4A2L A;  4UI9 R;  2AGL A;  3V5W B;  1FWX A;  5C2V B;  4PSW B;  3SJL D;  3I7P A;  5FA5 B;  5K19 A;  4OZU A;  2I0T A;  1K32 A;  5HQG A;  5GSA A;  5HYN B;  5H14 A;  4D6V A;  1A0R B;  4J78 A;  3C9C A;  4H5I A;  4J8B A;  4CZY A;  5FKS A;  3RRM C;  4GM9 A;  3SBQ A;  5IJ8 E;  4J73 A;  3SHF A;  2H9P A;  1TYQ C;  4A7J A;  3JPX A;  3EI2 B;  4JSP C;  3JB9 L;  2O9K A;  1N6F A;  2HKM A;  2UZY B;  4ZN4 A;  3OKT A;  4GZ8 A;  3SXT D;  1SQ9 A;  2H6N A;  2P9U C;  2PBI B;  3A0F A;  4GGA A;  4JT6 C;  4L3H D;  4GM3 A;  5FQD A;  4EWR A;  5EMM B;  3OL2 B;  4HDJ A;  2H3X A;  3EI2 A;  5HE1 B;  2HJ4 A;  4X60 B;  1QNI A;  3UKU C;  3RN0 D;  3UVN A;  4N14 A;  5FKT A;  4KFM B;  4FB1 D;  2I3T A;  4O1Q D;  2P9L C;  4ZOZ A;  4CZV A;  2J56 H;  3OL2 A;  2OJY A;  3EWE A;  2CN2 A;  3GRE A;  3AFC A;  3F3P A;  4E54 B;  4QT8 A;  2AGX A;  3RFG A;  4CY2 A;  5AFU 3;  3AH8 B;  3KRW B;  1NEX B;  2HXC A;  3IIW A;  5IT9 g;  4BL0 A;  5EAP A;  2CE8 A;  3PXT D;  2QC5 A;  2G9A A;  2H9N A;  2I0R A;  3F3F A;  3JZG A;  1XHM A;  4A11 B;  3SBP A;  5EAL A;  3OKW A;  5CXC B;  3C75 H;  1JOF A;  3ULE C;  4CZX A;  2CNX A;  3OKY B;  4E5Z B;  1GOT B;  2XU7 A;  3I7N A;  4MK0 B;  2XL3 A;  2B5M A;  2P9S C;  4K3J B;  3BWS A;  4XEI C;  3VGZ A;  4A11 A;  3P4F A;  4J8G A;  3EI1 B;  1L0Q A;  4TZ4 A;  4CC9 A;  5CXC A;  3PVW B;  1MDA H;  4X3E A;  3DM0 A;  2Q7Q A;  5TF2 A;  4GGD A;  3OKY A;  1ERJ A;  3MZL A;  4E5Z A;  5IC7 A;  3FM0 A;  3RSE C;  5TDH B;  4FA4 D;  2AGY A;  3ZWL B;  2H9M A;  3UVM A;  3BG0 A;  3EI1 A;  1JMX B;  1GG2 B;  3W15 A;  2IWF A;  3F3G A;  3SN6 B;  2G99 A;  3EI3 A;  4BH6 A;  4FA1 D;  1OMW B;  4FA5 D;  4O9D A;  2PM7 B;  3DXK C;  5IGO A;  5TEE A;  4ZOX A;  5EAM A;  1TBG A;  3JZH A;  3NVX A;  2BBK H;  5I5J A;  2B4E A;  3FGB A;  3SLE D;  4AEZ A;  4GM8 A;  2OIZ A;  3MMY A;  2AGZ A;  4XYI A;  4CI3 A;  2H68 A;  4J86 A;  4ZOY A;  3I7K A;  4JSX C;  3N0E A;  2GC7 A;  3K27 A;  2QXV A;  3MKS B;  2J55 H;  4Y7R A;  3KRX B;  2YB8 B;  5EAR A;  3DSM A;  2CE9 A;  2XL2 A;  4J77 A;  2AH0 A;  1S4U X;  5SXM A;  5EMK B;  5CXB B;  1RI6 A;  1B9X A;  4IMM A;  1B9Y A;  3DXM C;  4O3T B;  2H13 A;  3B7F A;  2CN3 A;  2Z2P A;  5A2Q g;  3OW8 A;  5FLX g;  4G56 B;  3MXX A;  4PBY A;  5HE2 B;  4X63 B;  3L4O D;  3EI4 B;  4L3G D;  3ODT A;  3I89 A;  4A08 B;  3MZK A;  5CXB A;  5TEF A;  3AL8 B;  5GMK n;  2IUV A;  4QRJ A;  1MG2 A;  5JWZ A;  4J87 A;  1SQJ A;  4L9O A;  4A2M A;  2YNO A;  5AMS A;  3EI4 A;  2BCJ B;  1R5M A;  3SMR A;  4J82 A;  4A0B B;  4A08 A;  4CY1 A;  3J81 g;  4BUJ C;  3AL8 A;  3IJ0 A;  3SCY A;  2OVR B;  2UZX B;  4QQE A;  4JD2 C;  2J57 G;  3I7O A;  4GQB B;  3UVK A;  1K8K C;  3NVQ A;  3L4M D;  3U4Y A;  4O45 A;  2IWK A;  5AJA A;  2HKR A;  4J0X A;  3J80 g;  4L1Q D;  4A0B A;  2B5N A;  3IJ1 A;  3I8C A;  4GGC A;  5EM2 B;  5HE0 B;  3ORV D;  5EMJ B;  3RMZ D;  5GXI A;  3BG1 A;  1JMZ B;  2OVQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...