5AFU3

Cryo-em structure of dynein tail-dynactin-bicd2n complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
350
structure length
350
Chain Sequence
b'HYLVPYNQRANHSKPIPPFLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLATGCNKTTQVYRVSDGSLVARLSDSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSSLGPEYNVFATGSGDCKARIWKYKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNEIN TAIL
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Motor protein
total genus 34
structure length 350
sequence length 350
chains with identical sequence 4
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5afu300
4J8GA 3CIKB 2B5LA 1XHMA 4FA5D 4O3UB 2YNOA 4CY2A 3J80g 4CZXA 4A11A 3SMRA 2PM6B 3I7HA 4G56B 3UR4A 2CNXA 3EI3A 2J56H 2B5MA 4L3GD 2AGLA 4A2MA 4K3ID 5IJ8E 5GMKn 5CXBA 4JSPC 4ZOZA 2QXVA 5EMMB 4FAVD 3OKTA 1PI6A 3CFVA 4OWRA 4H5IA 3VH0A 4PNKB 4ZN4A 3BWSA 2XU7A 3SXTD 3W15A 5K1CC 5FXYA 4CC9A 1ERJA 4FA9D 1JMXB 3JZNA 2Z2OA 1TYQC 4CY1A 3PVUB 4KFMB 4FB1D 2YNNA 3AL8B 4TZ4A 4GM3A 4E5ZB 4FHLA 4IA9A 3AFCA 5IJ7E 5I5MA 3JROA 2H47A 3AH8B 4GGCA 2CO0C 5FKTA 3I7PA 5FLXg 2PBIB 3JZHA 3MKQA 1K32A 2CO0A 1Q47A 3NVQA 3V5WB 4BH6A 4EWRA 4LG8A 3OKYA 5H14A 3N0EA 2BCJB 5A2Qg 1SQ9A 1OMWB 4LG9A 4JXMA 2OK4A 3IIWA 4FAND 4J82A 3UKUC 3EWEA 1NEXB 3PXSD 4LGNA 3JPXA 5H1MA 4GGAA 1SHYB 3MMYA 1B9XA 2CE8A 2I0SA 3MZLA 4PC0A 5JWZA 2AGYA 1PBYB 2UZYB 4ERZA 3I89A 4A0AA 4X61B 2P9PC 4E54B 3CFSB 4A0BB 5AFU3 2UZXB 4J79A 5GXIA 3MZKA 4J77A 2AGWA 3EMHA 3EI4B 4O9DA 3UVMA 1N6EA 1XKSA 2XL2A 2OIZA 2YBAA 3B7FA 3I7KA 4J73A 5EMJB 2YMUA 2H6QA 4J0XA 1R5MA 5CYKA 3I8EA 3I7OA 4CY3A 4CI2A 2I3SA 4A08B 5CXCB 4I79A 3KRXB 2HXCA 1XIPA 2HJ4A 3K26A 1JOFA 3EG6A 4ZOVA 2GC7A 2OK6A 3IJ0A 3PVWB 3UVOA 4J87A 4J0WA 1N6FA 5IGQA 5FKRA 4AOWA 4L3HD 3FM0A 1PEVA 3RLMD 2P9KC 2TRCB 4A09B 3C75H 4IMMA 4MK0B 5HE0B 4QL1A 5HE2B 1TBGA 3J81g 4X63B 3UVLA 1PGUA 3I7NA 2BBKH 4X3EA 2GC4A 3OL2A 5HE1B 5SXMA 3SBQA 3DXMC 3SFZA 3ODTA 5GXHA 5AJAA 2CN3A 3SBPA 3PSLA 1U4CA 3ULEC 4AEZA 4BUJC 4Y5RD 3P4FA 4JT6C 4J86A 4BL0A 1GG2B 2AGZA 4OZUA 3SWSD 3EI2A 1RI6A 2P9IC 2H3XA 4ERQA 4UI9R 4JD2C 5KDOB 2H68A 2YB8B 4A11B 3PE7A 3FRXA 5HYNB 3EI4A 3EI3B 3V7DB 5EM2A 3IIYA 2O9KA 2I0RA 2H9PA 4U1EI 4CI1A 2HKMA 2Z2PA 5CXBB 2IUVA 5EALA 3IKOA 5EMLB 5EMKB 2J57G 2B5NA 3RSEC 3I7LA 4J8BA 2W18A 2PM9A 4J81A 4CI8A 3SHFA 4CI3A 5IC7A 5C2WB 1L0QA 3OKWA 5K19A 2IUQA 3EU7A 5FKQA 3ZWLB 3FGBA 2H6NA 3RMZD 3K27A 2AGXA 4ESGA 3AL9A 4D6VA 5HE3B 3U4YA 2HKRA 5B4WA 2Z2NA 4GQ1A 4U7AA 1GOTB 2IUPA 4QQEA 3RFHA 3RN1D 2CE9A 1QNIA 1N6DA 4PBZA 3EI1B 5IGOA 5IT9g 3C5MA 2H9MA 2QC5A 1MG3A 4FA4D 4ERYA 5TEFA 1A0RB 4L9OA 1S4UX 3OKYB 1U2VC 5I5IA 2YNPA 3PXWD 2OVPB 3DXKC 4Z8LA 5C9ZB 3C9CA 1VYHC 3BG0A 4N14A 3AL8A 2IURA 4GZ8A 4E5ZA 2H9LA 4HDJA 3JRPA 2IAAA 3C99A 3OTTA 2AH1A 4J78A 4NSXA 3JZGA 3NVNA 5C2VB 1K8KC 4A0AB 5TDHB 3JB9L 5EARA 4ZOYA 4JT5C 2HJBA 4XEIC 2G99A 2HYEA 3N0DA 3V9FA 5TF2A 3L4MD 2H13A 3F3PA 3RN0D 3BG1A 1B9YA 3OW8A 5CYKB 2H6KA 2G9AA 3L4OD 4GM8A 3DSMA 5FA5B 4ES0A 4Y7RA 5GSAA 3UVNA 2P9LC 1SQJA 4K3JB 4E54A 4A0BA 5I5JA 5HQGA 3JAMg 3PSCB 1NR0A 3SLED 3F3FA 2I3TA 1JMZB 2CN2A 2J55H 4FA1D 2MTAH 5H17A 4H5JA 4GQBB 2HESX 3HFQA 3RRMC 3SVWD 4XYIA 3UVKA 2B4EA 3EI1A 3PXTD 5FQDA 5THAA 3UKRC 1OLZA 4R7AB 4JSXC 4A08A 1JJUB 3SJLD 5CXCA 5EAMA 3E0CA 3OL2B 3A0FA 4ZOXA 2PM7B 2AH0A 1P22A 4JSVC 2P9UC 3IJ1A 3VA6A 4O45A 1MDAH 3SCYA 2IWFA 1MG2A 3SN6B 1GXRA 3MKSB 4CZVA 4QT8A 3MXXA 3ORVD 2GNQA 2I0TA 4PXWA 4A09A 4O3TB 3I2NA 1YFQA 4YVDA 3GREA 3EI2B 3F3GA 1FWXA 4GM9A 4J84A 5FKSA 5TEEA 4PBYA 4GMBA 2IWKA 4D0KA 2H14A 2XL3A 4JSNC 2H9NA 4GGDA 4O1QD 5EAPA 2XYIA 3SBRA 3DWLC 3IJCA 3GFCA 5EM2B 3RFGA 2OVQB 4XYHA 4QRJA 2OVRB 4PSWB 2EBSA 2Q7QA 4L1QD 3VGZA 1GP2B 4PSXB 4A7JA 3DM0A 4A2LA 2P9NC 2OJYA 2P9SC 4FWWA 5AMSA 3NVXA 4GQ2P 4CZYA 4CY5A 2PM9B 4X60B 3I8CA 3KRWB 2AQ5A
chains in the Genus database with same CATH superfamily
4J8GA 3CIKB 2B5LA 1XHMA 4FA5D 4Z7QA 4O3UB 2YNOA 4CY2A 3J80g 1VZ2A 4CZXA 1GOGA 5M5RA 4A11A 3SMRA 2PM6B 3I7HA 3EQ9A 4RE5A 4G56B 3UR4A 2CNXA 3EI3A 3O4HA 1H2ZA 4BCBA 2J56H 2VDRA 2B5MA 4L3GD 2AGLA 3ZE2A 4A2MA 4K3ID 5IJ8E 5GMKn 5CXBA 2VDQA 4L1MA 4NENA 4JSPC 4ZOZA 2EIBA 2QXVA 3K6SA 5EMMB 4FAVD 3GC3B 3ZDXA 3OKTA 1PI6A 3CFVA 4OWRA 4H5IA 3VH0A 4PNKB 4ZN4A 3BWSA 2XU7A 3SXTD 3W15A 5K1CC 5FXYA 4CC9A 3FCUA 1ERJA 4FA9D 1JMXB 3JZNA 4AN1A 2HU7A 2Z2OA 1TYQC 4CY1A 3PVUB 4KFMB 2JKXA 4NAAA 4FB1D 2YNNA 3AL8B 4TZ4A 4GM3A 4E5ZB 4FHLA 2VC2A 4IA9A 3AFCA 5IJ7E 5I5MA 3JROA 4JHPC 2H47A 3AH8B 4GGCA 2CO0C 3QI0A 5FKTA 3I7PA 4WK2A 1E5TA 5FLXg 2PBIB 3JZHA 3MKQA 3MUNA 5M61A 1K32A 2CO0A 4BP8A 1Q47A 3NVQA 4G1MA 3V5WB 4BH6A 4EWRA 4LG8A 3OKYA 5H14A 3N0EA 2BCJB 5A2Qg 1SQ9A 1OMWB 4LG9A 1T2XA 4JXMA 4Z7OA 2OK4A 3IIWA 4FAND 4J82A 3UKUC 3EWEA 1A12A 1NEXB 3PXSD 4LGNA 4BCDA 3JPXA 5H1MA 1JTDB 4GGAA 4WJKA 1SHYB 3MMYA 1B9XA 2CE8A 2I0SA 3MZLA 4PC0A 1E8NA 5JWZA 2AGYA 1PBYB 2UZYB 4ERZA 3I89A 4JHNA 4A0AA 4X61B 2P9PC 1JV2A 3VI4A 4E54B 3CFSB 4A0BB 5AFU3 4O2WA 2UZXB 4J79A 4Z7NA 5GXIA 3MZKA 4J77A 2AGWA 2EICA 3EMHA 3K71A 3ZE0A 3EI4B 4O9DA 3UVMA 1N6EA 1XKSA 2VDLA 2XL2A 3IUNA 5M5VA 2OIZA 2YBAA 3B7FA 5M5UA 3I7KA 4J73A 3V4PA 5EMJB 2YMUA 2H6QA 2XZGA 4J0XA 1R5MA 3IUJA 5CYKA 3I8EA 3I7OA 4CY3A 1QFSA 4CI2A 2I3SA 1UOQA 1O6GA 1K3IA 4A08B 4AN0A 1VZ3A 5E6UA 5M5TA 3GD1I 5CXCB 4I79A 3KRXB 2HXCA 5E6RA 1XIPA 3IUQA 2HJ4A 3K26A 1JOFA 3EG6A 4ZOVA 2GC7A 2OK6A 3IJ0A 3PVWB 3UVOA 4J87A 4J0WA 1N6FA 5IGQA 5M5SA 5FKRA 3T3MA 4AOWA 4DNWA 4L3HD 1I2MB 3FM0A 1PEVA 3RLMD 2P9KC 2TRCB 4A09B 3C75H 4IMMA 4MK0B 5HE0B 2HU5A 4QL1A 5HE2B 1TBGA 3J81g 4X63B 3UVLA 1PGUA 3I7NA 2BBKH 4X3EA 1GOHA 2GC4A 3NIFA 3OL2A 5HE1B 5SXMA 1VE7A 3SBQA 3DXMC 3SFZA 4BCCA 3ODTA 1L5GA 5GXHA 5AJAA 2CN3A 3SBPA 4UM8A 3PSLA 1U4CA 3ULEC 4AEZA 4BUJC 3DDUA 4Y5RD 3P4FA 4JT6C 4J86A 4BL0A 1GG2B 2AGZA 4OZUA 3SWSD 3EI2A 1RI6A 2P9IC 2H3XA 4ERQA 4UI9R 4JD2C 3EQ7A 2H68A 5KDOB 2YB8B 3IVMA 4BP9A 4A11B 3PE7A 3MUOA 3FRXA 5HYNB 3EI4A 3EI3B 3V7DB 5EM2A 3IIYA 2O9KA 3K72A 2I0RA 2H9PA 3OF7A 4U1EI 1H2WA 4CI1A 5C86A 2HKMA 2Z2PA 5CXBB 4QAMA 2IUVA 5EALA 3IKOA 5EMLB 3VI3A 1BPOA 5EMKB 2VDOA 2J57G 2B5NA 3RSEC 2VDKA 3I7LA 4J8BA 2W18A 2PM9A 4J81A 4CI8A 3SHFA 4CI3A 5IC7A 4G55A 5C2WB 1L0QA 3OKWA 5K19A 2IUQA 4DNUA 3EU7A 5FKQA 3ZWLB 3FGBA 2H6NA 3QHYB 3RMZD 3K27A 2AGXA 1UOPA 4ESGA 3IURA 3AL9A 4AX4A 4D6VA 5HE3B 3U4YA 2HKRA 2EIEA 5B4WA 2Z2NA 4GQ1A 3EQ8A 1GOTB 4U7AA 2IUPA 4QQEA 3RFHA 3RN1D 2CE9A 1QNIA 1N6DA 1U8CA 4PBZA 3EI1B 5IGOA 5IT9g 3C5MA 2H9MA 2QC5A 2VZ1A 1MG3A 4FA4D 4ERYA 1H2YA 5TEFA 1A0RB 4L9OA 1S4UX 3OKYB 1UOOA 3FCSA 1U2VC 5I5IA 1QFMA 3T3PA 2YNPA 3PXWD 2OVPB 3DXKC 1VE6A 3KCIA 4Z8LA 5FFOA 5C9ZB 3C9CA 1VYHC 3BG0A 4N14A 3AL8A 4NC4A 2IURA 4O02A 4GZ8A 4E5ZA 3NIGA 2H9LA 4HDJA 3O4IA 4NBMA 3ZDYA 3JRPA 2IAAA 3C99A 2VZ3A 3OTTA 2AH1A 4J78A 4NSXA 3JZGA 3NVNA 5C2VB 1K8KC 4A0AB 5TDHB 3JB9L 2EIDA 5EARA 4ZOYA 4JT5C 2HJBA 1O6FA 4XEIC 2VDPA 2G99A 2HYEA 3N0DA 4DNVA 3MVDK 2XDWA 3V9FA 5C92A 1UTCA 1M1XA 5TF2A 4D9SA 3L4MD 2H13A 3F3PA 4RE6A 3RN0D 3BG1A 4MMZA 1B9YA 3O4GA 3OW8A 5CYKB 2H6KA 2G9AA 3L4OD 4GM8A 1C9IA 5E6SA 3DSMA 5FA5B 4ES0A 4Y7RA 5GSAA 3UVNA 2P9LC 1SQJA 5FFGA 4IRZA 2XE4A 4K3JB 4E54A 4A0BA 5I5JA 1E8MA 5HQGA 3JAMg 3PSCB 1NR0A 3SLED 4UM9A 3F3FA 2I3TA 1JMZB 2CN2A 2J55H 4FA1D 2MTAH 5H17A 3NIDA 4H5JA 4GQBB 2HESX 3HFQA 3RRMC 3SVWD 4XYIA 3UVKA 2B4EA 4G1EA 3PXTD 5FQDA 3EI1A 5THAA 4AMZA 2WQ8A 3UKRC 1OLZA 2QR5A 2HU8A 5HDBA 4R7AB 4JSXC 4A08A 3IUMA 1JJUB 3SJLD 5CXCA 5EAMA 3E0CA 3OL2B 3A0FA 4ZOXA 2PM7B 4AMYA 2AH0A 4WK4A 3V4VA 1P22A 4JSVC 1TYEA 2P9UC 3IJ1A 3VA6A 4O45A 1MDAH 3SCYA 2IWFA 2VDMA 1MG2A 3SN6B 1GXRA 3MKSB 4CZVA 4QT8A 2VDNA 3MXXA 1H2XA 3ORVD 2GNQA 2I0TA 4PXWA 4MMXA 4A09A 4O3TB 3I2NA 1YFQA 4YVDA 3GREA 3EI2B 3F3GA 1FWXA 3IJEA 4GM9A 4J84A 5FKSA 5TEEA 4PBYA 4GMBA 2IWKA 4D0KA 3ZDZA 2H14A 2XL3A 4JSNC 2BKLA 2H9NA 4GGDA 4O1QD 5EAPA 2XYIA 1C9LA 3SBRA 4MMYA 3DWLC 3IJCA 3IULA 3GFCA 5EM2B 3RFGA 2OVQB 4XYHA 4WK0A 4QRJA 2OVRB 3ZE1A 4PSWB 2EBSA 2Q7QA 4L1QD 3VGZA 1GP2B 3O4JA 4PSXB 4A7JA 3DM0A 4A2LA 2P9NC 1YR2A 2QZPA 2OJYA 2P9SC 4FWWA 5AMSA 3NVXA 4GQ2P 4CZYA 4CY5A 2PM9B 1GOFA 4X60B 3I8CA 3KRWB 2AQ5A
chains in the Genus database with same CATH topology
4J8GA 3CIKB 2B5LA 1XHMA 4FA5D 4O3UB 2YNOA 4CY2A 3J80g 4CZXA 4A11A 3SMRA 2PM6B 3I7HA 4G56B 3UR4A 2CNXA 3EI3A 2J56H 2B5MA 4L3GD 2AGLA 4A2MA 4K3ID 5IJ8E 5GMKn 5CXBA 4JSPC 4ZOZA 2QXVA 5EMMB 4FAVD 3OKTA 1PI6A 3CFVA 4OWRA 4H5IA 3VH0A 4PNKB 4ZN4A 3BWSA 2XU7A 3SXTD 3W15A 5K1CC 5FXYA 4CC9A 1ERJA 4FA9D 1JMXB 3JZNA 2Z2OA 1TYQC 4CY1A 3PVUB 4KFMB 4FB1D 2YNNA 3AL8B 4TZ4A 4GM3A 4E5ZB 4FHLA 4IA9A 3AFCA 5IJ7E 5I5MA 3JROA 2H47A 3AH8B 4GGCA 2CO0C 5FKTA 3I7PA 5FLXg 2PBIB 3JZHA 3MKQA 1K32A 2CO0A 1Q47A 3NVQA 3V5WB 4BH6A 4EWRA 4LG8A 3OKYA 5H14A 3N0EA 2BCJB 5A2Qg 1SQ9A 1OMWB 4LG9A 4JXMA 2OK4A 3IIWA 4FAND 4J82A 3UKUC 3EWEA 1NEXB 3PXSD 4LGNA 3JPXA 5H1MA 4GGAA 1SHYB 3MMYA 1B9XA 2CE8A 2I0SA 3MZLA 4PC0A 5JWZA 2AGYA 1PBYB 2UZYB 4ERZA 3I89A 4A0AA 4X61B 2P9PC 4E54B 3CFSB 4A0BB 5AFU3 2UZXB 4J79A 5GXIA 3MZKA 4J77A 2AGWA 3EMHA 3EI4B 4O9DA 3UVMA 1N6EA 1XKSA 2XL2A 2OIZA 2YBAA 3B7FA 3I7KA 4J73A 5EMJB 2YMUA 2H6QA 4J0XA 1R5MA 5CYKA 3I8EA 3I7OA 4CY3A 4CI2A 2I3SA 4A08B 5CXCB 4I79A 3KRXB 2HXCA 1XIPA 2HJ4A 3K26A 1JOFA 3EG6A 4ZOVA 2GC7A 2OK6A 3IJ0A 3PVWB 3UVOA 4J87A 4J0WA 1N6FA 5IGQA 5FKRA 4AOWA 4L3HD 3FM0A 1PEVA 3RLMD 2P9KC 2TRCB 4A09B 3C75H 4IMMA 4MK0B 5HE0B 4QL1A 5HE2B 1TBGA 3J81g 4X63B 3UVLA 1PGUA 3I7NA 2BBKH 4X3EA 2GC4A 3OL2A 5HE1B 5SXMA 3SBQA 3DXMC 3SFZA 3ODTA 5GXHA 5AJAA 2CN3A 3SBPA 3PSLA 1U4CA 3ULEC 4AEZA 4BUJC 4Y5RD 3P4FA 4JT6C 4J86A 4BL0A 1GG2B 2AGZA 4OZUA 3SWSD 3EI2A 1RI6A 2P9IC 2H3XA 4ERQA 4UI9R 4JD2C 5KDOB 2H68A 2YB8B 4A11B 3PE7A 3FRXA 5HYNB 3EI4A 3EI3B 3V7DB 5EM2A 3IIYA 2O9KA 2I0RA 2H9PA 4U1EI 4CI1A 2HKMA 2Z2PA 5CXBB 2IUVA 5EALA 3IKOA 5EMLB 5EMKB 2J57G 2B5NA 3RSEC 3I7LA 4J8BA 2W18A 2PM9A 4J81A 4CI8A 3SHFA 4CI3A 5IC7A 5C2WB 1L0QA 3OKWA 5K19A 2IUQA 3EU7A 5FKQA 3ZWLB 3FGBA 2H6NA 3RMZD 3K27A 2AGXA 4ESGA 3AL9A 4D6VA 5HE3B 3U4YA 2HKRA 5B4WA 2Z2NA 4GQ1A 4U7AA 1GOTB 2IUPA 4QQEA 3RFHA 3RN1D 2CE9A 1QNIA 1N6DA 4PBZA 3EI1B 5IGOA 5IT9g 3C5MA 2H9MA 2QC5A 1MG3A 4FA4D 4ERYA 5TEFA 1A0RB 4L9OA 1S4UX 3OKYB 1U2VC 5I5IA 2YNPA 3PXWD 2OVPB 3DXKC 4Z8LA 5C9ZB 3C9CA 1VYHC 3BG0A 4N14A 3AL8A 2IURA 4GZ8A 4E5ZA 2H9LA 4HDJA 3JRPA 2IAAA 3C99A 3OTTA 2AH1A 4J78A 4NSXA 3JZGA 3NVNA 5C2VB 1K8KC 4A0AB 5TDHB 3JB9L 5EARA 4ZOYA 4JT5C 2HJBA 4XEIC 2G99A 2HYEA 3N0DA 3V9FA 5TF2A 3L4MD 2H13A 3F3PA 3RN0D 3BG1A 1B9YA 3OW8A 5CYKB 2H6KA 2G9AA 3L4OD 4GM8A 3DSMA 5FA5B 4ES0A 4Y7RA 5GSAA 3UVNA 2P9LC 1SQJA 4K3JB 4E54A 4A0BA 5I5JA 5HQGA 3JAMg 3PSCB 1NR0A 3SLED 3F3FA 2I3TA 1JMZB 2CN2A 2J55H 4FA1D 2MTAH 5H17A 4H5JA 4GQBB 2HESX 3HFQA 3RRMC 3SVWD 4XYIA 3UVKA 2B4EA 3EI1A 3PXTD 5FQDA 5THAA 3UKRC 1OLZA 4R7AB 4JSXC 4A08A 1JJUB 3SJLD 5CXCA 5EAMA 3E0CA 3OL2B 3A0FA 4ZOXA 2PM7B 2AH0A 1P22A 4JSVC 2P9UC 3IJ1A 3VA6A 4O45A 1MDAH 3SCYA 2IWFA 1MG2A 3SN6B 1GXRA 3MKSB 4CZVA 4QT8A 3MXXA 3ORVD 2GNQA 2I0TA 4PXWA 4A09A 4O3TB 3I2NA 1YFQA 4YVDA 3GREA 3EI2B 3F3GA 1FWXA 4GM9A 4J84A 5FKSA 5TEEA 4PBYA 4GMBA 2IWKA 4D0KA 2H14A 2XL3A 4JSNC 2H9NA 4GGDA 4O1QD 5EAPA 2XYIA 3SBRA 3DWLC 3IJCA 3GFCA 5EM2B 3RFGA 2OVQB 4XYHA 4QRJA 2OVRB 4PSWB 2EBSA 2Q7QA 4L1QD 3VGZA 1GP2B 4PSXB 4A7JA 3DM0A 4A2LA 2P9NC 2OJYA 2P9SC 4FWWA 5AMSA 3NVXA 4GQ2P 4CZYA 4CY5A 2PM9B 4X60B 3I8CA 3KRWB 2AQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8G A;  3CIK B;  2B5L A;  1XHM A;  4FA5 D;  4O3U B;  2YNO A;  4CY2 A;  3J80 g;  4CZX A;  4A11 A;  3SMR A;  2PM6 B;  3I7H A;  4G56 B;  3UR4 A;  2CNX A;  3EI3 A;  2J56 H;  2B5M A;  4L3G D;  2AGL A;  4A2M A;  4K3I D;  5IJ8 E;  5GMK n;  5CXB A;  4JSP C;  4ZOZ A;  2QXV A;  5EMM B;  4FAV D;  3OKT A;  1PI6 A;  3CFV A;  4OWR A;  4H5I A;  3VH0 A;  4PNK B;  4ZN4 A;  3BWS A;  2XU7 A;  3SXT D;  3W15 A;  5K1C C;  5FXY A;  4CC9 A;  1ERJ A;  4FA9 D;  1JMX B;  3JZN A;  2Z2O A;  1TYQ C;  4CY1 A;  3PVU B;  4KFM B;  4FB1 D;  2YNN A;  3AL8 B;  4TZ4 A;  4GM3 A;  4E5Z B;  4FHL A;  4IA9 A;  3AFC A;  5IJ7 E;  5I5M A;  3JRO A;  2H47 A;  3AH8 B;  4GGC A;  2CO0 C;  5FKT A;  3I7P A;  5FLX g;  2PBI B;  3JZH A;  3MKQ A;  1K32 A;  2CO0 A;  1Q47 A;  3NVQ A;  3V5W B;  4BH6 A;  4EWR A;  4LG8 A;  3OKY A;  5H14 A;  3N0E A;  2BCJ B;  5A2Q g;  1SQ9 A;  1OMW B;  4LG9 A;  4JXM A;  2OK4 A;  3IIW A;  4FAN D;  4J82 A;  3UKU C;  3EWE A;  1NEX B;  3PXS D;  4LGN A;  3JPX A;  5H1M A;  4GGA A;  1SHY B;  3MMY A;  1B9X A;  2CE8 A;  2I0S A;  3MZL A;  4PC0 A;  5JWZ A;  2AGY A;  1PBY B;  2UZY B;  4ERZ A;  3I89 A;  4A0A A;  4X61 B;  2P9P C;  4E54 B;  3CFS B;  4A0B B;  5AFU 3;  2UZX B;  4J79 A;  5GXI A;  3MZK A;  4J77 A;  2AGW A;  3EMH A;  3EI4 B;  4O9D A;  3UVM A;  1N6E A;  1XKS A;  2XL2 A;  2OIZ A;  2YBA A;  3B7F A;  3I7K A;  4J73 A;  5EMJ B;  2YMU A;  2H6Q A;  4J0X A;  1R5M A;  5CYK A;  3I8E A;  3I7O A;  4CY3 A;  4CI2 A;  2I3S A;  4A08 B;  5CXC B;  4I79 A;  3KRX B;  2HXC A;  1XIP A;  2HJ4 A;  3K26 A;  1JOF A;  3EG6 A;  4ZOV A;  2GC7 A;  2OK6 A;  3IJ0 A;  3PVW B;  3UVO A;  4J87 A;  4J0W A;  1N6F A;  5IGQ A;  5FKR A;  4AOW A;  4L3H D;  3FM0 A;  1PEV A;  3RLM D;  2P9K C;  2TRC B;  4A09 B;  3C75 H;  4IMM A;  4MK0 B;  5HE0 B;  4QL1 A;  5HE2 B;  1TBG A;  3J81 g;  4X63 B;  3UVL A;  1PGU A;  3I7N A;  2BBK H;  4X3E A;  2GC4 A;  3OL2 A;  5HE1 B;  5SXM A;  3SBQ A;  3DXM C;  3SFZ A;  3ODT A;  5GXH A;  5AJA A;  2CN3 A;  3SBP A;  3PSL A;  1U4C A;  3ULE C;  4AEZ A;  4BUJ C;  4Y5R D;  3P4F A;  4JT6 C;  4J86 A;  4BL0 A;  1GG2 B;  2AGZ A;  4OZU A;  3SWS D;  3EI2 A;  1RI6 A;  2P9I C;  2H3X A;  4ERQ A;  4UI9 R;  4JD2 C;  5KDO B;  2H68 A;  2YB8 B;  4A11 B;  3PE7 A;  3FRX A;  5HYN B;  3EI4 A;  3EI3 B;  3V7D B;  5EM2 A;  3IIY A;  2O9K A;  2I0R A;  2H9P A;  4U1E I;  4CI1 A;  2HKM A;  2Z2P A;  5CXB B;  2IUV A;  5EAL A;  3IKO A;  5EML B;  5EMK B;  2J57 G;  2B5N A;  3RSE C;  3I7L A;  4J8B A;  2W18 A;  2PM9 A;  4J81 A;  4CI8 A;  3SHF A;  4CI3 A;  5IC7 A;  5C2W B;  1L0Q A;  3OKW A;  5K19 A;  2IUQ A;  3EU7 A;  5FKQ A;  3ZWL B;  3FGB A;  2H6N A;  3RMZ D;  3K27 A;  2AGX A;  4ESG A;  3AL9 A;  4D6V A;  5HE3 B;  3U4Y A;  2HKR A;  5B4W A;  2Z2N A;  4GQ1 A;  4U7A A;  1GOT B;  2IUP A;  4QQE A;  3RFH A;  3RN1 D;  2CE9 A;  1QNI A;  1N6D A;  4PBZ A;  3EI1 B;  5IGO A;  5IT9 g;  3C5M A;  2H9M A;  2QC5 A;  1MG3 A;  4FA4 D;  4ERY A;  5TEF A;  1A0R B;  4L9O A;  1S4U X;  3OKY B;  1U2V C;  5I5I A;  2YNP A;  3PXW D;  2OVP B;  3DXK C;  4Z8L A;  5C9Z B;  3C9C A;  1VYH C;  3BG0 A;  4N14 A;  3AL8 A;  2IUR A;  4GZ8 A;  4E5Z A;  2H9L A;  4HDJ A;  3JRP A;  2IAA A;  3C99 A;  3OTT A;  2AH1 A;  4J78 A;  4NSX A;  3JZG A;  3NVN A;  5C2V B;  1K8K C;  4A0A B;  5TDH B;  3JB9 L;  5EAR A;  4ZOY A;  4JT5 C;  2HJB A;  4XEI C;  2G99 A;  2HYE A;  3N0D A;  3V9F A;  5TF2 A;  3L4M D;  2H13 A;  3F3P A;  3RN0 D;  3BG1 A;  1B9Y A;  3OW8 A;  5CYK B;  2H6K A;  2G9A A;  3L4O D;  4GM8 A;  3DSM A;  5FA5 B;  4ES0 A;  4Y7R A;  5GSA A;  3UVN A;  2P9L C;  1SQJ A;  4K3J B;  4E54 A;  4A0B A;  5I5J A;  5HQG A;  3JAM g;  3PSC B;  1NR0 A;  3SLE D;  3F3F A;  2I3T A;  1JMZ B;  2CN2 A;  2J55 H;  4FA1 D;  2MTA H;  5H17 A;  4H5J A;  4GQB B;  2HES X;  3HFQ A;  3RRM C;  3SVW D;  4XYI A;  3UVK A;  2B4E A;  3EI1 A;  3PXT D;  5FQD A;  5THA A;  3UKR C;  1OLZ A;  4R7A B;  4JSX C;  4A08 A;  1JJU B;  3SJL D;  5CXC A;  5EAM A;  3E0C A;  3OL2 B;  3A0F A;  4ZOX A;  2PM7 B;  2AH0 A;  1P22 A;  4JSV C;  2P9U C;  3IJ1 A;  3VA6 A;  4O45 A;  1MDA H;  3SCY A;  2IWF A;  1MG2 A;  3SN6 B;  1GXR A;  3MKS B;  4CZV A;  4QT8 A;  3MXX A;  3ORV D;  2GNQ A;  2I0T A;  4PXW A;  4A09 A;  4O3T B;  3I2N A;  1YFQ A;  4YVD A;  3GRE A;  3EI2 B;  3F3G A;  1FWX A;  4GM9 A;  4J84 A;  5FKS A;  5TEE A;  4PBY A;  4GMB A;  2IWK A;  4D0K A;  2H14 A;  2XL3 A;  4JSN C;  2H9N A;  4GGD A;  4O1Q D;  5EAP A;  2XYI A;  3SBR A;  3DWL C;  3IJC A;  3GFC A;  5EM2 B;  3RFG A;  2OVQ B;  4XYH A;  4QRJ A;  2OVR B;  4PSW B;  2EBS A;  2Q7Q A;  4L1Q D;  3VGZ A;  1GP2 B;  4PSX B;  4A7J A;  3DM0 A;  4A2L A;  2P9N C;  2OJY A;  2P9S C;  4FWW A;  5AMS A;  3NVX A;  4GQ2 P;  4CZY A;  4CY5 A;  2PM9 B;  4X60 B;  3I8C A;  3KRW B;  2AQ5 A; 
#chains in the Genus database with same CATH topology
 4J8G A;  3CIK B;  2B5L A;  1XHM A;  4FA5 D;  4Z7Q A;  4O3U B;  2YNO A;  4CY2 A;  3J80 g;  1VZ2 A;  4CZX A;  1GOG A;  5M5R A;  4A11 A;  3SMR A;  2PM6 B;  3I7H A;  3EQ9 A;  4RE5 A;  4G56 B;  3UR4 A;  2CNX A;  3EI3 A;  3O4H A;  1H2Z A;  4BCB A;  2J56 H;  2VDR A;  2B5M A;  4L3G D;  2AGL A;  3ZE2 A;  4A2M A;  4K3I D;  5IJ8 E;  5GMK n;  5CXB A;  2VDQ A;  4L1M A;  4NEN A;  4JSP C;  4ZOZ A;  2EIB A;  2QXV A;  3K6S A;  5EMM B;  4FAV D;  3GC3 B;  3ZDX A;  3OKT A;  1PI6 A;  3CFV A;  4OWR A;  4H5I A;  3VH0 A;  4PNK B;  4ZN4 A;  3BWS A;  2XU7 A;  3SXT D;  3W15 A;  5K1C C;  5FXY A;  4CC9 A;  3FCU A;  1ERJ A;  4FA9 D;  1JMX B;  3JZN A;  4AN1 A;  2HU7 A;  2Z2O A;  1TYQ C;  4CY1 A;  3PVU B;  4KFM B;  2JKX A;  4NAA A;  4FB1 D;  2YNN A;  3AL8 B;  4TZ4 A;  4GM3 A;  4E5Z B;  4FHL A;  2VC2 A;  4IA9 A;  3AFC A;  5IJ7 E;  5I5M A;  3JRO A;  4JHP C;  2H47 A;  3AH8 B;  4GGC A;  2CO0 C;  3QI0 A;  5FKT A;  3I7P A;  4WK2 A;  1E5T A;  5FLX g;  2PBI B;  3JZH A;  3MKQ A;  3MUN A;  5M61 A;  1K32 A;  2CO0 A;  4BP8 A;  1Q47 A;  3NVQ A;  4G1M A;  3V5W B;  4BH6 A;  4EWR A;  4LG8 A;  3OKY A;  5H14 A;  3N0E A;  2BCJ B;  5A2Q g;  1SQ9 A;  1OMW B;  4LG9 A;  1T2X A;  4JXM A;  4Z7O A;  2OK4 A;  3IIW A;  4FAN D;  4J82 A;  3UKU C;  3EWE A;  1A12 A;  1NEX B;  3PXS D;  4LGN A;  4BCD A;  3JPX A;  5H1M A;  1JTD B;  4GGA A;  4WJK A;  1SHY B;  3MMY A;  1B9X A;  2CE8 A;  2I0S A;  3MZL A;  4PC0 A;  1E8N A;  5JWZ A;  2AGY A;  1PBY B;  2UZY B;  4ERZ A;  3I89 A;  4JHN A;  4A0A A;  4X61 B;  2P9P C;  1JV2 A;  3VI4 A;  4E54 B;  3CFS B;  4A0B B;  5AFU 3;  4O2W A;  2UZX B;  4J79 A;  4Z7N A;  5GXI A;  3MZK A;  4J77 A;  2AGW A;  2EIC A;  3EMH A;  3K71 A;  3ZE0 A;  3EI4 B;  4O9D A;  3UVM A;  1N6E A;  1XKS A;  2VDL A;  2XL2 A;  3IUN A;  5M5V A;  2OIZ A;  2YBA A;  3B7F A;  5M5U A;  3I7K A;  4J73 A;  3V4P A;  5EMJ B;  2YMU A;  2H6Q A;  2XZG A;  4J0X A;  1R5M A;  3IUJ A;  5CYK A;  3I8E A;  3I7O A;  4CY3 A;  1QFS A;  4CI2 A;  2I3S A;  1UOQ A;  1O6G A;  1K3I A;  4A08 B;  4AN0 A;  1VZ3 A;  5E6U A;  5M5T A;  3GD1 I;  5CXC B;  4I79 A;  3KRX B;  2HXC A;  5E6R A;  1XIP A;  3IUQ A;  2HJ4 A;  3K26 A;  1JOF A;  3EG6 A;  4ZOV A;  2GC7 A;  2OK6 A;  3IJ0 A;  3PVW B;  3UVO A;  4J87 A;  4J0W A;  1N6F A;  5IGQ A;  5M5S A;  5FKR A;  3T3M A;  4AOW A;  4DNW A;  4L3H D;  1I2M B;  3FM0 A;  1PEV A;  3RLM D;  2P9K C;  2TRC B;  4A09 B;  3C75 H;  4IMM A;  4MK0 B;  5HE0 B;  2HU5 A;  4QL1 A;  5HE2 B;  1TBG A;  3J81 g;  4X63 B;  3UVL A;  1PGU A;  3I7N A;  2BBK H;  4X3E A;  1GOH A;  2GC4 A;  3NIF A;  3OL2 A;  5HE1 B;  5SXM A;  1VE7 A;  3SBQ A;  3DXM C;  3SFZ A;  4BCC A;  3ODT A;  1L5G A;  5GXH A;  5AJA A;  2CN3 A;  3SBP A;  4UM8 A;  3PSL A;  1U4C A;  3ULE C;  4AEZ A;  4BUJ C;  3DDU A;  4Y5R D;  3P4F A;  4JT6 C;  4J86 A;  4BL0 A;  1GG2 B;  2AGZ A;  4OZU A;  3SWS D;  3EI2 A;  1RI6 A;  2P9I C;  2H3X A;  4ERQ A;  4UI9 R;  4JD2 C;  3EQ7 A;  2H68 A;  5KDO B;  2YB8 B;  3IVM A;  4BP9 A;  4A11 B;  3PE7 A;  3MUO A;  3FRX A;  5HYN B;  3EI4 A;  3EI3 B;  3V7D B;  5EM2 A;  3IIY A;  2O9K A;  3K72 A;  2I0R A;  2H9P A;  3OF7 A;  4U1E I;  1H2W A;  4CI1 A;  5C86 A;  2HKM A;  2Z2P A;  5CXB B;  4QAM A;  2IUV A;  5EAL A;  3IKO A;  5EML B;  3VI3 A;  1BPO A;  5EMK B;  2VDO A;  2J57 G;  2B5N A;  3RSE C;  2VDK A;  3I7L A;  4J8B A;  2W18 A;  2PM9 A;  4J81 A;  4CI8 A;  3SHF A;  4CI3 A;  5IC7 A;  4G55 A;  5C2W B;  1L0Q A;  3OKW A;  5K19 A;  2IUQ A;  4DNU A;  3EU7 A;  5FKQ A;  3ZWL B;  3FGB A;  2H6N A;  3QHY B;  3RMZ D;  3K27 A;  2AGX A;  1UOP A;  4ESG A;  3IUR A;  3AL9 A;  4AX4 A;  4D6V A;  5HE3 B;  3U4Y A;  2HKR A;  2EIE A;  5B4W A;  2Z2N A;  4GQ1 A;  3EQ8 A;  1GOT B;  4U7A A;  2IUP A;  4QQE A;  3RFH A;  3RN1 D;  2CE9 A;  1QNI A;  1N6D A;  1U8C A;  4PBZ A;  3EI1 B;  5IGO A;  5IT9 g;  3C5M A;  2H9M A;  2QC5 A;  2VZ1 A;  1MG3 A;  4FA4 D;  4ERY A;  1H2Y A;  5TEF A;  1A0R B;  4L9O A;  1S4U X;  3OKY B;  1UOO A;  3FCS A;  1U2V C;  5I5I A;  1QFM A;  3T3P A;  2YNP A;  3PXW D;  2OVP B;  3DXK C;  1VE6 A;  3KCI A;  4Z8L A;  5FFO A;  5C9Z B;  3C9C A;  1VYH C;  3BG0 A;  4N14 A;  3AL8 A;  4NC4 A;  2IUR A;  4O02 A;  4GZ8 A;  4E5Z A;  3NIG A;  2H9L A;  4HDJ A;  3O4I A;  4NBM A;  3ZDY A;  3JRP A;  2IAA A;  3C99 A;  2VZ3 A;  3OTT A;  2AH1 A;  4J78 A;  4NSX A;  3JZG A;  3NVN A;  5C2V B;  1K8K C;  4A0A B;  5TDH B;  3JB9 L;  2EID A;  5EAR A;  4ZOY A;  4JT5 C;  2HJB A;  1O6F A;  4XEI C;  2VDP A;  2G99 A;  2HYE A;  3N0D A;  4DNV A;  3MVD K;  2XDW A;  3V9F A;  5C92 A;  1UTC A;  1M1X A;  5TF2 A;  4D9S A;  3L4M D;  2H13 A;  3F3P A;  4RE6 A;  3RN0 D;  3BG1 A;  4MMZ A;  1B9Y A;  3O4G A;  3OW8 A;  5CYK B;  2H6K A;  2G9A A;  3L4O D;  4GM8 A;  1C9I A;  5E6S A;  3DSM A;  5FA5 B;  4ES0 A;  4Y7R A;  5GSA A;  3UVN A;  2P9L C;  1SQJ A;  5FFG A;  4IRZ A;  2XE4 A;  4K3J B;  4E54 A;  4A0B A;  5I5J A;  1E8M A;  5HQG A;  3JAM g;  3PSC B;  1NR0 A;  3SLE D;  4UM9 A;  3F3F A;  2I3T A;  1JMZ B;  2CN2 A;  2J55 H;  4FA1 D;  2MTA H;  5H17 A;  3NID A;  4H5J A;  4GQB B;  2HES X;  3HFQ A;  3RRM C;  3SVW D;  4XYI A;  3UVK A;  2B4E A;  4G1E A;  3PXT D;  5FQD A;  3EI1 A;  5THA A;  4AMZ A;  2WQ8 A;  3UKR C;  1OLZ A;  2QR5 A;  2HU8 A;  5HDB A;  4R7A B;  4JSX C;  4A08 A;  3IUM A;  1JJU B;  3SJL D;  5CXC A;  5EAM A;  3E0C A;  3OL2 B;  3A0F A;  4ZOX A;  2PM7 B;  4AMY A;  2AH0 A;  4WK4 A;  3V4V A;  1P22 A;  4JSV C;  1TYE A;  2P9U C;  3IJ1 A;  3VA6 A;  4O45 A;  1MDA H;  3SCY A;  2IWF A;  2VDM A;  1MG2 A;  3SN6 B;  1GXR A;  3MKS B;  4CZV A;  4QT8 A;  2VDN A;  3MXX A;  1H2X A;  3ORV D;  2GNQ A;  2I0T A;  4PXW A;  4MMX A;  4A09 A;  4O3T B;  3I2N A;  1YFQ A;  4YVD A;  3GRE A;  3EI2 B;  3F3G A;  1FWX A;  3IJE A;  4GM9 A;  4J84 A;  5FKS A;  5TEE A;  4PBY A;  4GMB A;  2IWK A;  4D0K A;  3ZDZ A;  2H14 A;  2XL3 A;  4JSN C;  2BKL A;  2H9N A;  4GGD A;  4O1Q D;  5EAP A;  2XYI A;  1C9L A;  3SBR A;  4MMY A;  3DWL C;  3IJC A;  3IUL A;  3GFC A;  5EM2 B;  3RFG A;  2OVQ B;  4XYH A;  4WK0 A;  4QRJ A;  2OVR B;  3ZE1 A;  4PSW B;  2EBS A;  2Q7Q A;  4L1Q D;  3VGZ A;  1GP2 B;  3O4J A;  4PSX B;  4A7J A;  3DM0 A;  4A2L A;  2P9N C;  1YR2 A;  2QZP A;  2OJY A;  2P9S C;  4FWW A;  5AMS A;  3NVX A;  4GQ2 P;  4CZY A;  4CY5 A;  2PM9 B;  1GOF A;  4X60 B;  3I8C A;  3KRW B;  2AQ5 A; 
#chains in the Genus database with same CATH homology
 4J8G A;  3CIK B;  2B5L A;  1XHM A;  4FA5 D;  4O3U B;  2YNO A;  4CY2 A;  3J80 g;  4CZX A;  4A11 A;  3SMR A;  2PM6 B;  3I7H A;  4G56 B;  3UR4 A;  2CNX A;  3EI3 A;  2J56 H;  2B5M A;  4L3G D;  2AGL A;  4A2M A;  4K3I D;  5IJ8 E;  5GMK n;  5CXB A;  4JSP C;  4ZOZ A;  2QXV A;  5EMM B;  4FAV D;  3OKT A;  1PI6 A;  3CFV A;  4OWR A;  4H5I A;  3VH0 A;  4PNK B;  4ZN4 A;  3BWS A;  2XU7 A;  3SXT D;  3W15 A;  5K1C C;  5FXY A;  4CC9 A;  1ERJ A;  4FA9 D;  1JMX B;  3JZN A;  2Z2O A;  1TYQ C;  4CY1 A;  3PVU B;  4KFM B;  4FB1 D;  2YNN A;  3AL8 B;  4TZ4 A;  4GM3 A;  4E5Z B;  4FHL A;  4IA9 A;  3AFC A;  5IJ7 E;  5I5M A;  3JRO A;  2H47 A;  3AH8 B;  4GGC A;  2CO0 C;  5FKT A;  3I7P A;  5FLX g;  2PBI B;  3JZH A;  3MKQ A;  1K32 A;  2CO0 A;  1Q47 A;  3NVQ A;  3V5W B;  4BH6 A;  4EWR A;  4LG8 A;  3OKY A;  5H14 A;  3N0E A;  2BCJ B;  5A2Q g;  1SQ9 A;  1OMW B;  4LG9 A;  4JXM A;  2OK4 A;  3IIW A;  4FAN D;  4J82 A;  3UKU C;  3EWE A;  1NEX B;  3PXS D;  4LGN A;  3JPX A;  5H1M A;  4GGA A;  1SHY B;  3MMY A;  1B9X A;  2CE8 A;  2I0S A;  3MZL A;  4PC0 A;  5JWZ A;  2AGY A;  1PBY B;  2UZY B;  4ERZ A;  3I89 A;  4A0A A;  4X61 B;  2P9P C;  4E54 B;  3CFS B;  4A0B B;  5AFU 3;  2UZX B;  4J79 A;  5GXI A;  3MZK A;  4J77 A;  2AGW A;  3EMH A;  3EI4 B;  4O9D A;  3UVM A;  1N6E A;  1XKS A;  2XL2 A;  2OIZ A;  2YBA A;  3B7F A;  3I7K A;  4J73 A;  5EMJ B;  2YMU A;  2H6Q A;  4J0X A;  1R5M A;  5CYK A;  3I8E A;  3I7O A;  4CY3 A;  4CI2 A;  2I3S A;  4A08 B;  5CXC B;  4I79 A;  3KRX B;  2HXC A;  1XIP A;  2HJ4 A;  3K26 A;  1JOF A;  3EG6 A;  4ZOV A;  2GC7 A;  2OK6 A;  3IJ0 A;  3PVW B;  3UVO A;  4J87 A;  4J0W A;  1N6F A;  5IGQ A;  5FKR A;  4AOW A;  4L3H D;  3FM0 A;  1PEV A;  3RLM D;  2P9K C;  2TRC B;  4A09 B;  3C75 H;  4IMM A;  4MK0 B;  5HE0 B;  4QL1 A;  5HE2 B;  1TBG A;  3J81 g;  4X63 B;  3UVL A;  1PGU A;  3I7N A;  2BBK H;  4X3E A;  2GC4 A;  3OL2 A;  5HE1 B;  5SXM A;  3SBQ A;  3DXM C;  3SFZ A;  3ODT A;  5GXH A;  5AJA A;  2CN3 A;  3SBP A;  3PSL A;  1U4C A;  3ULE C;  4AEZ A;  4BUJ C;  4Y5R D;  3P4F A;  4JT6 C;  4J86 A;  4BL0 A;  1GG2 B;  2AGZ A;  4OZU A;  3SWS D;  3EI2 A;  1RI6 A;  2P9I C;  2H3X A;  4ERQ A;  4UI9 R;  4JD2 C;  5KDO B;  2H68 A;  2YB8 B;  4A11 B;  3PE7 A;  3FRX A;  5HYN B;  3EI4 A;  3EI3 B;  3V7D B;  5EM2 A;  3IIY A;  2O9K A;  2I0R A;  2H9P A;  4U1E I;  4CI1 A;  2HKM A;  2Z2P A;  5CXB B;  2IUV A;  5EAL A;  3IKO A;  5EML B;  5EMK B;  2J57 G;  2B5N A;  3RSE C;  3I7L A;  4J8B A;  2W18 A;  2PM9 A;  4J81 A;  4CI8 A;  3SHF A;  4CI3 A;  5IC7 A;  5C2W B;  1L0Q A;  3OKW A;  5K19 A;  2IUQ A;  3EU7 A;  5FKQ A;  3ZWL B;  3FGB A;  2H6N A;  3RMZ D;  3K27 A;  2AGX A;  4ESG A;  3AL9 A;  4D6V A;  5HE3 B;  3U4Y A;  2HKR A;  5B4W A;  2Z2N A;  4GQ1 A;  4U7A A;  1GOT B;  2IUP A;  4QQE A;  3RFH A;  3RN1 D;  2CE9 A;  1QNI A;  1N6D A;  4PBZ A;  3EI1 B;  5IGO A;  5IT9 g;  3C5M A;  2H9M A;  2QC5 A;  1MG3 A;  4FA4 D;  4ERY A;  5TEF A;  1A0R B;  4L9O A;  1S4U X;  3OKY B;  1U2V C;  5I5I A;  2YNP A;  3PXW D;  2OVP B;  3DXK C;  4Z8L A;  5C9Z B;  3C9C A;  1VYH C;  3BG0 A;  4N14 A;  3AL8 A;  2IUR A;  4GZ8 A;  4E5Z A;  2H9L A;  4HDJ A;  3JRP A;  2IAA A;  3C99 A;  3OTT A;  2AH1 A;  4J78 A;  4NSX A;  3JZG A;  3NVN A;  5C2V B;  1K8K C;  4A0A B;  5TDH B;  3JB9 L;  5EAR A;  4ZOY A;  4JT5 C;  2HJB A;  4XEI C;  2G99 A;  2HYE A;  3N0D A;  3V9F A;  5TF2 A;  3L4M D;  2H13 A;  3F3P A;  3RN0 D;  3BG1 A;  1B9Y A;  3OW8 A;  5CYK B;  2H6K A;  2G9A A;  3L4O D;  4GM8 A;  3DSM A;  5FA5 B;  4ES0 A;  4Y7R A;  5GSA A;  3UVN A;  2P9L C;  1SQJ A;  4K3J B;  4E54 A;  4A0B A;  5I5J A;  5HQG A;  3JAM g;  3PSC B;  1NR0 A;  3SLE D;  3F3F A;  2I3T A;  1JMZ B;  2CN2 A;  2J55 H;  4FA1 D;  2MTA H;  5H17 A;  4H5J A;  4GQB B;  2HES X;  3HFQ A;  3RRM C;  3SVW D;  4XYI A;  3UVK A;  2B4E A;  3EI1 A;  3PXT D;  5FQD A;  5THA A;  3UKR C;  1OLZ A;  4R7A B;  4JSX C;  4A08 A;  1JJU B;  3SJL D;  5CXC A;  5EAM A;  3E0C A;  3OL2 B;  3A0F A;  4ZOX A;  2PM7 B;  2AH0 A;  1P22 A;  4JSV C;  2P9U C;  3IJ1 A;  3VA6 A;  4O45 A;  1MDA H;  3SCY A;  2IWF A;  1MG2 A;  3SN6 B;  1GXR A;  3MKS B;  4CZV A;  4QT8 A;  3MXX A;  3ORV D;  2GNQ A;  2I0T A;  4PXW A;  4A09 A;  4O3T B;  3I2N A;  1YFQ A;  4YVD A;  3GRE A;  3EI2 B;  3F3G A;  1FWX A;  4GM9 A;  4J84 A;  5FKS A;  5TEE A;  4PBY A;  4GMB A;  2IWK A;  4D0K A;  2H14 A;  2XL3 A;  4JSN C;  2H9N A;  4GGD A;  4O1Q D;  5EAP A;  2XYI A;  3SBR A;  3DWL C;  3IJC A;  3GFC A;  5EM2 B;  3RFG A;  2OVQ B;  4XYH A;  4QRJ A;  2OVR B;  4PSW B;  2EBS A;  2Q7Q A;  4L1Q D;  3VGZ A;  1GP2 B;  4PSX B;  4A7J A;  3DM0 A;  4A2L A;  2P9N C;  2OJY A;  2P9S C;  4FWW A;  5AMS A;  3NVX A;  4GQ2 P;  4CZY A;  4CY5 A;  2PM9 B;  4X60 B;  3I8C A;  3KRW B;  2AQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...