4JSVC

Mtor kinase structure, mechanism and regulation.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jsvC01
3SVWD 4A08B 3K26A 4A09B 2Z2NA 4FAVD 3FGBA 5SXMA 1K8KC 2IURA 3EI4B 5H14A 3RFHA 5H1MA 2BCJB 3UVMA 2H6NA 3EWEA 4JSXC 4JT5C 3RMZD 2GC7A 4UI9R 3KRWB 1S4UX 5FLXg 3AH8B 4J78A 5I5IA 3VH0A 4JSNC 4A0BB 2B5NA 4ZOYA 2XL2A 2GC4A 5HQGA 4GGCA 2CN3A 3SJLD 3C9CA 2H47A 1TBGA 4ERYA 3FM0A 4JD2C 1QNIA 3RSEC 3JAMg 3SN6B 2I0TA 5IGOA 3FRXA 3EG6A 1XHMA 1B9XA 3SWSD 1PI6A 5K1CC 1GXRA 1SQJA 4FA5D 2AGLA 4K3ID 2AGYA 4GM8A 4ZOVA 3MKQA 3UKUC 4A11B 4FHLA 4FWWA 2YB8B 5CYKA 4R7AB 2P9PC 1A0RB 2Z2OA 2CO0C 5TEFA 2PM9A 5H17A 2IAAA 3RLMD 3DSMA 4I79A 3EMHA 5AJAA 1YFQA 4ERZA 4PSXB 3SLED 2G9AA 2CN2A 3BWSA 4CI8A 3JPXA 4QQEA 5HE2B 5HYNB 2H6KA 2QC5A 4FAND 1JMXB 4CZXA 2OVRB 3RN1D 4J87A 4BUJC 3U4YA 4L1QD 2H9MA 4L3HD 5EMJB 3K27A 2PM6B 4AOWA 3SCYA 2H6QA 5I5MA 4JSPC 3GFCA 5GXHA 3CFSB 4X60B 3F3GA 5FKQA 2CO0A 4XYHA 5AFU3 3OW8A 4A0AB 2CE9A 5K19A 3AFCA 3EI1A 2IUPA 1OLZA 5CXBB 2H9NA 4PNKB 3IJ0A 1PBYB 3I8EA 3MMYA 4JXMA 2IUQA 4QT8A 4X61B 3ULEC 2HKRA 3EI2A 4GM3A 2GNQA 4J8GA 5IJ7E 3OKYB 3PXWD 3VA6A 5CXCB 2OK6A 4Z8LA 4NSXA 2AGXA 5C2WB 4E54B 5EARA 5EM2A 4CZVA 3JROA 5A2Qg 4FA9D 5TEEA 4OZUA 5C9ZB 3IIYA 2J56H 4G56B 4FA4D 1Q47A 3DXKC 4O3TB 1B9YA 3JZNA 4KFMB 3OL2A 5CYKB 4LG8A 1L0QA 3J80g 1MDAH 1GOTB 1NR0A 1JOFA 3JZHA 5FKSA 3I8CA 3RN0D 5EAPA 3EU7A 4J0XA 4ZOZA 3OTTA 3J81g 4FB1D 1U2VC 2AQ5A 3EI3B 5EMLB 4JT6C 3SHFA 3I7PA 3IJCA 3E0CA 3BG1A 1JJUB 3V5WB 4CZYA 4CY3A 4LG9A 1PGUA 4N14A 3I7OA 3UVLA 3AL8A 3N0DA 4GMBA 2BBKH 5HE3B 3DXMC 2OVPB 1N6FA 4TZ4A 4A08A 4A09A 3MZKA 3L4MD 4Y5RD 2HJ4A 3SFZA 2I0RA 3EI4A 1NEXB 3F3FA 3I7KA 2HKMA 4GQ2P 2H9PA 4ZN4A 4E5ZB 2TRCB 4PXWA 4GQBB 4J73A 3C99A 4CI2A 2HJBA 2P9SC 4GZ8A 3PVWB 3IKOA 4LGNA 2H14A 3GREA 4EWRA 1SHYB 2P9LC 4Y7RA 4A0BA 4QL1A 1TYQC 4J82A 2HESX 5IJ8E 3MZLA 1MG2A 3ODTA 3UVKA 3C5MA 4PBYA 4A2MA 2AH1A 4ESGA 4J8BA 3ORVD 5I5JA 1SQ9A 3MXXA 4U1EI 3CIKB 2IWKA 4D6VA 3IJ1A 4O1QD 4HDJA 3SBPA 3N0EA 4H5JA 2QXVA 3RFGA 4GGDA 3I7HA 3UR4A 4GQ1A 4ERQA 4IMMA 3B7FA 4FA1D 1N6DA 3SBRA 3UVNA 3W15A 1U4CA 4X63B 4QRJA 2IUVA 2W18A 3I7LA 3F3PA 4O45A 3AL9A 2H3XA 2XYIA 4A11A 4A2LA 2J57G 3P4FA 2B5LA 4L3GD 4GGAA 2Q7QA 2O9KA 3I7NA 4A7JA 2XL3A 2YMUA 3NVXA 4ZOXA 3V7DB 3PE7A 5EAMA 1RI6A 4CI3A 3SXTD 5AMSA 2G99A 2I3SA 2HYEA 5TDHB 2EBSA 2PM7B 4YVDA 2AGWA 5FQDA 3DWLC 3VGZA 2PBIB 2P9KC 3JRPA 3CFVA 2UZXB 3V9FA 3RRMC 1GG2B 1VYHC 5TF2A 5FA5B 2PM9B 4O3UB 4PC0A 4CY5A 4CY1A 4GM9A 2H13A 4BL0A 4J86A 2OIZA 3I2NA 1R5MA 3OKTA 4K3JB 4MK0B 2P9IC 3DM0A 4CY2A 5GSAA 5B4WA 1PEVA 5IGQA 3A0FA 4L9OA 4O9DA 3PXSD 2HXCA 3JZGA 2I3TA 4A0AA 2OJYA 3JB9L 5HE0B 4IA9A 4PBZA 5CXBA 3NVQA 2YNNA 5C2VB 4AEZA 2CNXA 2UZYB 2IWFA 3OKYA 5EMKB 2YBAA 5CXCA 2CE8A 3KRXB 3L4OD 1XIPA 4E54A 4JSVC 4J0WA 3EI1B 1FWXA 3BG0A 3C75H 3OKWA 5KDOB 4J84A 5FKTA 1N6EA 3EI2B 4H5IA 4PSWB 2OVQB 3PVUB 2MTAH 5THAA 2AGZA 4ES0A 2YNOA 2YNPA 2J55H 5EM2B 3SBQA 2H9LA 4D0KA 5IT9g 3IIWA 5FXYA 5GMKn 3SMRA 3EI3A 4CC9A 3PSLA 5EALA 1P22A 5GXIA 5HE1B 4X3EA 3OL2B 5EMMB 5FKRA 2P9NC 3I89A 2AH0A 2OK4A 1GP2B 2Z2PA 4OWRA 4BH6A 2B5MA 3NVNA 2B4EA 3PSCB 3PXTD 3UVOA 2H68A 1JMZB 4J77A 4XYIA 2XU7A 4U7AA 4CI1A 1ERJA 4XEIC 5JWZA 1XKSA 3HFQA 3ZWLB 1MG3A 3MKSB 2P9UC 4J81A 3UKRC 5IC7A 4E5ZA 3AL8B 4J79A 1OMWB 2I0SA 1K32A
chains in the Genus database with same CATH superfamily
3SVWD 4A08B 3K26A 4A09B 2Z2NA 4FAVD 3FGBA 5SXMA 1K8KC 5M5RA 1U8CA 2IURA 3EI4B 5H14A 2HU5A 3O4IA 3RFHA 5H1MA 2BCJB 3UVMA 2H6NA 5M5TA 3EWEA 4JSXC 4JT5C 3RMZD 2GC7A 4UI9R 3KRWB 1S4UX 5FLXg 1TYEA 3AH8B 4J78A 1UTCA 5I5IA 3VH0A 4JSNC 1H2ZA 4A0BB 2B5NA 1H2XA 4ZOYA 3V4PA 1QFSA 2XL2A 2GC4A 5HQGA 4GGCA 2CN3A 3SJLD 3C9CA 2H47A 3OF7A 1TBGA 2VZ1A 4ERYA 3FM0A 4D9SA 4JD2C 1QNIA 3KCIA 3RSEC 3JAMg 3SN6B 2I0TA 2VDPA 3ZE0A 5IGOA 3FRXA 1QFMA 4MMXA 2QR5A 3EG6A 3IVMA 1XHMA 1B9XA 3K6SA 3SWSD 3NIDA 1PI6A 1C9IA 5K1CC 4G1MA 1GXRA 1SQJA 4FA5D 4Z7NA 2AGLA 4K3ID 2AGYA 4GM8A 3IUNA 4ZOVA 3MKQA 3UKUC 1C9LA 4FHLA 4A11B 1UOOA 4FWWA 2YB8B 5CYKA 4UM8A 4R7AB 1VE7A 4BP8A 2P9PC 3NIFA 1A0RB 2Z2OA 2CO0C 5TEFA 2PM9A 5H17A 2IAAA 3RLMD 3T3PA 4Z7QA 3DSMA 3EMHA 4I79A 1UOQA 5AJAA 3DDUA 1YFQA 4ERZA 4PSXB 3SLED 2G9AA 2CN2A 3BWSA 4CI8A 2WQ8A 3JPXA 4QQEA 5HE2B 5HYNB 2H6KA 5C92A 2QC5A 4MMZA 4FAND 1JMXB 4CZXA 2OVRB 4L1MA 5M61A 2XDWA 3RN1D 4J87A 4BUJC 5C86A 4L1QD 3U4YA 2H9MA 2VC2A 4L3HD 5EMJB 3K27A 2PM6B 4AOWA 3SCYA 2H6QA 5I5MA 4JSPC 3GFCA 5GXHA 3CFSB 4X60B 3F3GA 5FKQA 2XZGA 2EIDA 2CO0A 4XYHA 3O4HA 5AFU3 3OW8A 1E8MA 4A0AB 2VZ3A 2CE9A 5K19A 3AFCA 3EI1A 3ZDXA 2IUPA 1OLZA 5CXBB 2H9NA 4PNKB 3EQ8A 3IJ0A 1PBYB 3I8EA 3MMYA 4JXMA 2IUQA 4QT8A 4X61B 3ULEC 2HKRA 3EI2A 4GM3A 2GNQA 4J8GA 5IJ7E 3OKYB 3PXWD 2VDRA 3VA6A 5CXCB 3IULA 2OK6A 4Z8LA 1UOPA 4NSXA 1YR2A 2EIBA 2AGXA 5C2WB 4E54B 5E6SA 5EARA 5EM2A 4CZVA 3JROA 1GOHA 4BCDA 4UM9A 3QI0A 5A2Qg 4FA9D 5TEEA 4OZUA 5C9ZB 3IIYA 2J56H 3FCSA 2VDOA 4G56B 4FA4D 1Q47A 3DXKC 4O3TB 3JZNA 1B9YA 1O6FA 4WK4A 4KFMB 1T2XA 3OL2A 5CYKB 1JTDB 1I2MB 4LG8A 1L0QA 3O4JA 3J80g 1MDAH 1GOFA 1GOTB 1NR0A 1JOFA 3JZHA 5FKSA 3I8CA 2JKXA 3RN0D 5EAPA 3NIGA 3EU7A 4J0XA 4IRZA 3OTTA 4ZOZA 3J81g 4JHNA 4FB1D 1U2VC 2AQ5A 3EI3B 5EMLB 4JT6C 3SHFA 1VZ2A 3I7PA 4G55A 3IJCA 3E0CA 4AN1A 3BG1A 1JJUB 3EQ9A 3V5WB 4CZYA 4CY3A 4LG9A 1PGUA 4N14A 3I7OA 3UVLA 3AL8A 3N0DA 4GMBA 1L5GA 2BBKH 4O2WA 5HE3B 1E8NA 1K3IA 3DXMC 3T3MA 2OVPB 1N6FA 4TZ4A 2HU7A 4A08A 4A09A 3MZKA 4JHPC 3L4MD 4Y5RD 2HJ4A 3SFZA 4BCBA 1GOGA 2I0RA 3EI4A 1NEXB 3F3FA 3I7KA 2HKMA 4GQ2P 3K71A 2H9PA 5FFOA 4ZN4A 4E5ZB 2TRCB 4PXWA 4GQBB 4J73A 3C99A 4CI2A 2HJBA 2P9SC 4GZ8A 3PVWB 5M5VA 3IKOA 4LGNA 2H14A 3GREA 4EWRA 1SHYB 4DNUA 1BPOA 3VI3A 2P9LC 4Y7RA 4A0BA 4QAMA 4QL1A 3K72A 1TYQC 4J82A 4BP9A 2HESX 2VDMA 3MZLA 1MG2A 5IJ8E 3ODTA 3UVKA 3C5MA 3ZE2A 4PBYA 4A2MA 2AH1A 4ESGA 4J8BA 3ORVD 5I5JA 3FCUA 1SQ9A 3MXXA 4U1EI 3CIKB 2IWKA 1VE6A 4NBMA 4D6VA 4NC4A 4O02A 3IJ1A 4O1QD 4DNVA 4WJKA 4HDJA 3SBPA 3GC3B 3N0EA 4H5JA 2QXVA 3RFGA 4GGDA 3I7HA 4AX4A 3UR4A 4GQ1A 4ERQA 4IMMA 3B7FA 4FA1D 3IUQA 4WK0A 1N6DA 3SBRA 3UVNA 3W15A 1U4CA 4X63B 4QRJA 2IUVA 2W18A 3I7LA 3F3PA 4O45A 3AL9A 2VDQA 2H3XA 4RE5A 2XYIA 4A11A 4A2LA 2J57G 4AN0A 3P4FA 2B5LA 4L3GD 4GGAA 5FFGA 2HU8A 2Q7QA 1H2WA 2O9KA 1E5TA 3I7NA 2XE4A 4A7JA 3IURA 2XL3A 2YMUA 3NVXA 4ZOXA 3V7DB 3PE7A 5EAMA 1RI6A 4CI3A 3SXTD 5AMSA 2G99A 2I3SA 2HYEA 5TDHB 2EBSA 3MUNA 4AMYA 2PM7B 4YVDA 2AGWA 5FQDA 3DWLC 3VGZA 2PBIB 3JRPA 2P9KC 3CFVA 2UZXB 3V9FA 4DNWA 3RRMC 1GG2B 1VYHC 5TF2A 3ZDYA 5FA5B 2PM9B 4O3UB 4PC0A 4CY5A 4CY1A 4GM9A 2H13A 4BL0A 4J86A 3QHYB 4WK2A 2OIZA 3I2NA 1R5MA 3OKTA 4K3JB 4MK0B 2P9IC 3DM0A 4CY2A 5M5SA 5GSAA 5B4WA 1PEVA 5IGQA 3A0FA 4L9OA 4O9DA 1H2YA 3PXSD 2HXCA 3JZGA 4BCCA 2EIEA 2I3TA 4A0AA 2OJYA 3JB9L 5HE0B 4IA9A 4PBZA 5CXBA 5M5UA 4RE6A 3NVQA 3ZE1A 2YNNA 5C2VB 1M1XA 3EQ7A 4AEZA 2CNXA 5HDBA 2UZYB 2IWFA 4NENA 3OKYA 5EMKB 2YBAA 5CXCA 2CE8A 3KRXB 3L4OD 1XIPA 4E54A 4JSVC 4MMYA 4J0WA 3EI1B 3IUJA 1FWXA 1VZ3A 3BG0A 3C75H 5E6UA 3OKWA 2BKLA 5KDOB 4J84A 5FKTA 3MVDK 1N6EA 3EI2B 4H5IA 4PSWB 2OVQB 4G1EA 3PVUB 2MTAH 5THAA 2AGZA 4ES0A 2YNOA 2EICA 2YNPA 2J55H 5EM2B 1JV2A 1O6GA 3SBQA 2H9LA 4D0KA 5IT9g 3IIWA 5FXYA 5GMKn 3SMRA 4AMZA 3IUMA 3EI3A 4CC9A 3PSLA 3GD1I 1P22A 5EALA 4Z7OA 5HE1B 5GXIA 4X3EA 3OL2B 5EMMB 2VDNA 5FKRA 2P9NC 3I89A 2AH0A 2OK4A 1GP2B 2Z2PA 4OWRA 1A12A 4BH6A 2B5MA 3NVNA 2VDKA 2B4EA 3O4GA 3PSCB 3PXTD 2H68A 3UVOA 1JMZB 4J77A 4XYIA 2XU7A 4U7AA 2QZPA 3V4VA 4CI1A 2VDLA 1ERJA 4XEIC 5E6RA 5JWZA 3IJEA 3VI4A 1XKSA 3ZDZA 3MUOA 4NAAA 3HFQA 3ZWLB 1MG3A 3MKSB 2P9UC 4J81A 3UKRC 5IC7A 4E5ZA 3AL8B 4J79A 1OMWB 2I0SA 1K32A
chains in the Genus database with same CATH topology
3SVWD 4A08B 3K26A 4A09B 2Z2NA 4FAVD 3FGBA 5SXMA 1K8KC 2IURA 3EI4B 5H14A 3RFHA 5H1MA 2BCJB 3UVMA 2H6NA 3EWEA 4JSXC 4JT5C 3RMZD 2GC7A 4UI9R 3KRWB 1S4UX 5FLXg 3AH8B 4J78A 5I5IA 3VH0A 4JSNC 4A0BB 2B5NA 4ZOYA 2XL2A 2GC4A 5HQGA 4GGCA 2CN3A 3SJLD 3C9CA 2H47A 1TBGA 4ERYA 3FM0A 4JD2C 1QNIA 3RSEC 3JAMg 3SN6B 2I0TA 5IGOA 3FRXA 3EG6A 1XHMA 1B9XA 3SWSD 1PI6A 5K1CC 1GXRA 1SQJA 4FA5D 2AGLA 4K3ID 2AGYA 4GM8A 4ZOVA 3MKQA 3UKUC 4A11B 4FHLA 4FWWA 2YB8B 5CYKA 4R7AB 2P9PC 1A0RB 2Z2OA 2CO0C 5TEFA 2PM9A 5H17A 2IAAA 3RLMD 3DSMA 4I79A 3EMHA 5AJAA 1YFQA 4ERZA 4PSXB 3SLED 2G9AA 2CN2A 3BWSA 4CI8A 3JPXA 4QQEA 5HE2B 5HYNB 2H6KA 2QC5A 4FAND 1JMXB 4CZXA 2OVRB 3RN1D 4J87A 4BUJC 3U4YA 4L1QD 2H9MA 4L3HD 5EMJB 3K27A 2PM6B 4AOWA 3SCYA 2H6QA 5I5MA 4JSPC 3GFCA 5GXHA 3CFSB 4X60B 3F3GA 5FKQA 2CO0A 4XYHA 5AFU3 3OW8A 4A0AB 2CE9A 5K19A 3AFCA 3EI1A 2IUPA 1OLZA 5CXBB 2H9NA 4PNKB 3IJ0A 1PBYB 3I8EA 3MMYA 4JXMA 2IUQA 4QT8A 4X61B 3ULEC 2HKRA 3EI2A 4GM3A 2GNQA 4J8GA 5IJ7E 3OKYB 3PXWD 3VA6A 5CXCB 2OK6A 4Z8LA 4NSXA 2AGXA 5C2WB 4E54B 5EARA 5EM2A 4CZVA 3JROA 5A2Qg 4FA9D 5TEEA 4OZUA 5C9ZB 3IIYA 2J56H 4G56B 4FA4D 1Q47A 3DXKC 4O3TB 1B9YA 3JZNA 4KFMB 3OL2A 5CYKB 4LG8A 1L0QA 3J80g 1MDAH 1GOTB 1NR0A 1JOFA 3JZHA 5FKSA 3I8CA 3RN0D 5EAPA 3EU7A 4J0XA 4ZOZA 3OTTA 3J81g 4FB1D 1U2VC 2AQ5A 3EI3B 5EMLB 4JT6C 3SHFA 3I7PA 3IJCA 3E0CA 3BG1A 1JJUB 3V5WB 4CZYA 4CY3A 4LG9A 1PGUA 4N14A 3I7OA 3UVLA 3AL8A 3N0DA 4GMBA 2BBKH 5HE3B 3DXMC 2OVPB 1N6FA 4TZ4A 4A08A 4A09A 3MZKA 3L4MD 4Y5RD 2HJ4A 3SFZA 2I0RA 3EI4A 1NEXB 3F3FA 3I7KA 2HKMA 4GQ2P 2H9PA 4ZN4A 4E5ZB 2TRCB 4PXWA 4GQBB 4J73A 3C99A 4CI2A 2HJBA 2P9SC 4GZ8A 3PVWB 3IKOA 4LGNA 2H14A 3GREA 4EWRA 1SHYB 2P9LC 4Y7RA 4A0BA 4QL1A 1TYQC 4J82A 2HESX 5IJ8E 3MZLA 1MG2A 3ODTA 3UVKA 3C5MA 4PBYA 4A2MA 2AH1A 4ESGA 4J8BA 3ORVD 5I5JA 1SQ9A 3MXXA 4U1EI 3CIKB 2IWKA 4D6VA 3IJ1A 4O1QD 4HDJA 3SBPA 3N0EA 4H5JA 2QXVA 3RFGA 4GGDA 3I7HA 3UR4A 4GQ1A 4ERQA 4IMMA 3B7FA 4FA1D 1N6DA 3SBRA 3UVNA 3W15A 1U4CA 4X63B 4QRJA 2IUVA 2W18A 3I7LA 3F3PA 4O45A 3AL9A 2H3XA 2XYIA 4A11A 4A2LA 2J57G 3P4FA 2B5LA 4L3GD 4GGAA 2Q7QA 2O9KA 3I7NA 4A7JA 2XL3A 2YMUA 3NVXA 4ZOXA 3V7DB 3PE7A 5EAMA 1RI6A 4CI3A 3SXTD 5AMSA 2G99A 2I3SA 2HYEA 5TDHB 2EBSA 2PM7B 4YVDA 2AGWA 5FQDA 3DWLC 3VGZA 2PBIB 2P9KC 3JRPA 3CFVA 2UZXB 3V9FA 3RRMC 1GG2B 1VYHC 5TF2A 5FA5B 2PM9B 4O3UB 4PC0A 4CY5A 4CY1A 4GM9A 2H13A 4BL0A 4J86A 2OIZA 3I2NA 1R5MA 3OKTA 4K3JB 4MK0B 2P9IC 3DM0A 4CY2A 5GSAA 5B4WA 1PEVA 5IGQA 3A0FA 4L9OA 4O9DA 3PXSD 2HXCA 3JZGA 2I3TA 4A0AA 2OJYA 3JB9L 5HE0B 4IA9A 4PBZA 5CXBA 3NVQA 2YNNA 5C2VB 4AEZA 2CNXA 2UZYB 2IWFA 3OKYA 5EMKB 2YBAA 5CXCA 2CE8A 3KRXB 3L4OD 1XIPA 4E54A 4JSVC 4J0WA 3EI1B 1FWXA 3BG0A 3C75H 3OKWA 5KDOB 4J84A 5FKTA 1N6EA 3EI2B 4H5IA 4PSWB 2OVQB 3PVUB 2MTAH 5THAA 2AGZA 4ES0A 2YNOA 2YNPA 2J55H 5EM2B 3SBQA 2H9LA 4D0KA 5IT9g 3IIWA 5FXYA 5GMKn 3SMRA 3EI3A 4CC9A 3PSLA 5EALA 1P22A 5GXIA 5HE1B 4X3EA 3OL2B 5EMMB 5FKRA 2P9NC 3I89A 2AH0A 2OK4A 1GP2B 2Z2PA 4OWRA 4BH6A 2B5MA 3NVNA 2B4EA 3PSCB 3PXTD 3UVOA 2H68A 1JMZB 4J77A 4XYIA 2XU7A 4U7AA 4CI1A 1ERJA 4XEIC 5JWZA 1XKSA 3HFQA 3ZWLB 1MG3A 3MKSB 2P9UC 4J81A 3UKRC 5IC7A 4E5ZA 3AL8B 4J79A 1OMWB 2I0SA 1K32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVW D;  4A08 B;  3K26 A;  4A09 B;  2Z2N A;  4FAV D;  3FGB A;  5SXM A;  1K8K C;  2IUR A;  3EI4 B;  5H14 A;  3RFH A;  5H1M A;  2BCJ B;  3UVM A;  2H6N A;  3EWE A;  4JSX C;  4JT5 C;  3RMZ D;  2GC7 A;  4UI9 R;  3KRW B;  1S4U X;  5FLX g;  3AH8 B;  4J78 A;  5I5I A;  3VH0 A;  4JSN C;  4A0B B;  2B5N A;  4ZOY A;  2XL2 A;  2GC4 A;  5HQG A;  4GGC A;  2CN3 A;  3SJL D;  3C9C A;  2H47 A;  1TBG A;  4ERY A;  3FM0 A;  4JD2 C;  1QNI A;  3RSE C;  3JAM g;  3SN6 B;  2I0T A;  5IGO A;  3FRX A;  3EG6 A;  1XHM A;  1B9X A;  3SWS D;  1PI6 A;  5K1C C;  1GXR A;  1SQJ A;  4FA5 D;  2AGL A;  4K3I D;  2AGY A;  4GM8 A;  4ZOV A;  3MKQ A;  3UKU C;  4A11 B;  4FHL A;  4FWW A;  2YB8 B;  5CYK A;  4R7A B;  2P9P C;  1A0R B;  2Z2O A;  2CO0 C;  5TEF A;  2PM9 A;  5H17 A;  2IAA A;  3RLM D;  3DSM A;  4I79 A;  3EMH A;  5AJA A;  1YFQ A;  4ERZ A;  4PSX B;  3SLE D;  2G9A A;  2CN2 A;  3BWS A;  4CI8 A;  3JPX A;  4QQE A;  5HE2 B;  5HYN B;  2H6K A;  2QC5 A;  4FAN D;  1JMX B;  4CZX A;  2OVR B;  3RN1 D;  4J87 A;  4BUJ C;  3U4Y A;  4L1Q D;  2H9M A;  4L3H D;  5EMJ B;  3K27 A;  2PM6 B;  4AOW A;  3SCY A;  2H6Q A;  5I5M A;  4JSP C;  3GFC A;  5GXH A;  3CFS B;  4X60 B;  3F3G A;  5FKQ A;  2CO0 A;  4XYH A;  5AFU 3;  3OW8 A;  4A0A B;  2CE9 A;  5K19 A;  3AFC A;  3EI1 A;  2IUP A;  1OLZ A;  5CXB B;  2H9N A;  4PNK B;  3IJ0 A;  1PBY B;  3I8E A;  3MMY A;  4JXM A;  2IUQ A;  4QT8 A;  4X61 B;  3ULE C;  2HKR A;  3EI2 A;  4GM3 A;  2GNQ A;  4J8G A;  5IJ7 E;  3OKY B;  3PXW D;  3VA6 A;  5CXC B;  2OK6 A;  4Z8L A;  4NSX A;  2AGX A;  5C2W B;  4E54 B;  5EAR A;  5EM2 A;  4CZV A;  3JRO A;  5A2Q g;  4FA9 D;  5TEE A;  4OZU A;  5C9Z B;  3IIY A;  2J56 H;  4G56 B;  4FA4 D;  1Q47 A;  3DXK C;  4O3T B;  1B9Y A;  3JZN A;  4KFM B;  3OL2 A;  5CYK B;  4LG8 A;  1L0Q A;  3J80 g;  1MDA H;  1GOT B;  1NR0 A;  1JOF A;  3JZH A;  5FKS A;  3I8C A;  3RN0 D;  5EAP A;  3EU7 A;  4J0X A;  4ZOZ A;  3OTT A;  3J81 g;  4FB1 D;  1U2V C;  2AQ5 A;  3EI3 B;  5EML B;  4JT6 C;  3SHF A;  3I7P A;  3IJC A;  3E0C A;  3BG1 A;  1JJU B;  3V5W B;  4CZY A;  4CY3 A;  4LG9 A;  1PGU A;  4N14 A;  3I7O A;  3UVL A;  3AL8 A;  3N0D A;  4GMB A;  2BBK H;  5HE3 B;  3DXM C;  2OVP B;  1N6F A;  4TZ4 A;  4A08 A;  4A09 A;  3MZK A;  3L4M D;  4Y5R D;  2HJ4 A;  3SFZ A;  2I0R A;  3EI4 A;  1NEX B;  3F3F A;  3I7K A;  2HKM A;  4GQ2 P;  2H9P A;  4ZN4 A;  4E5Z B;  2TRC B;  4PXW A;  4GQB B;  4J73 A;  3C99 A;  4CI2 A;  2HJB A;  2P9S C;  4GZ8 A;  3PVW B;  3IKO A;  4LGN A;  2H14 A;  3GRE A;  4EWR A;  1SHY B;  2P9L C;  4Y7R A;  4A0B A;  4QL1 A;  1TYQ C;  4J82 A;  2HES X;  5IJ8 E;  3MZL A;  1MG2 A;  3ODT A;  3UVK A;  3C5M A;  4PBY A;  4A2M A;  2AH1 A;  4ESG A;  4J8B A;  3ORV D;  5I5J A;  1SQ9 A;  3MXX A;  4U1E I;  3CIK B;  2IWK A;  4D6V A;  3IJ1 A;  4O1Q D;  4HDJ A;  3SBP A;  3N0E A;  4H5J A;  2QXV A;  3RFG A;  4GGD A;  3I7H A;  3UR4 A;  4GQ1 A;  4ERQ A;  4IMM A;  3B7F A;  4FA1 D;  1N6D A;  3SBR A;  3UVN A;  3W15 A;  1U4C A;  4X63 B;  4QRJ A;  2IUV A;  2W18 A;  3I7L A;  3F3P A;  4O45 A;  3AL9 A;  2H3X A;  2XYI A;  4A11 A;  4A2L A;  2J57 G;  3P4F A;  2B5L A;  4L3G D;  4GGA A;  2Q7Q A;  2O9K A;  3I7N A;  4A7J A;  2XL3 A;  2YMU A;  3NVX A;  4ZOX A;  3V7D B;  3PE7 A;  5EAM A;  1RI6 A;  4CI3 A;  3SXT D;  5AMS A;  2G99 A;  2I3S A;  2HYE A;  5TDH B;  2EBS A;  2PM7 B;  4YVD A;  2AGW A;  5FQD A;  3DWL C;  3VGZ A;  2PBI B;  2P9K C;  3JRP A;  3CFV A;  2UZX B;  3V9F A;  3RRM C;  1GG2 B;  1VYH C;  5TF2 A;  5FA5 B;  2PM9 B;  4O3U B;  4PC0 A;  4CY5 A;  4CY1 A;  4GM9 A;  2H13 A;  4BL0 A;  4J86 A;  2OIZ A;  3I2N A;  1R5M A;  3OKT A;  4K3J B;  4MK0 B;  2P9I C;  3DM0 A;  4CY2 A;  5GSA A;  5B4W A;  1PEV A;  5IGQ A;  3A0F A;  4L9O A;  4O9D A;  3PXS D;  2HXC A;  3JZG A;  2I3T A;  4A0A A;  2OJY A;  3JB9 L;  5HE0 B;  4IA9 A;  4PBZ A;  5CXB A;  3NVQ A;  2YNN A;  5C2V B;  4AEZ A;  2CNX A;  2UZY B;  2IWF A;  3OKY A;  5EMK B;  2YBA A;  5CXC A;  2CE8 A;  3KRX B;  3L4O D;  1XIP A;  4E54 A;  4JSV C;  4J0W A;  3EI1 B;  1FWX A;  3BG0 A;  3C75 H;  3OKW A;  5KDO B;  4J84 A;  5FKT A;  1N6E A;  3EI2 B;  4H5I A;  4PSW B;  2OVQ B;  3PVU B;  2MTA H;  5THA A;  2AGZ A;  4ES0 A;  2YNO A;  2YNP A;  2J55 H;  5EM2 B;  3SBQ A;  2H9L A;  4D0K A;  5IT9 g;  3IIW A;  5FXY A;  5GMK n;  3SMR A;  3EI3 A;  4CC9 A;  3PSL A;  5EAL A;  1P22 A;  5GXI A;  5HE1 B;  4X3E A;  3OL2 B;  5EMM B;  5FKR A;  2P9N C;  3I89 A;  2AH0 A;  2OK4 A;  1GP2 B;  2Z2P A;  4OWR A;  4BH6 A;  2B5M A;  3NVN A;  2B4E A;  3PSC B;  3PXT D;  3UVO A;  2H68 A;  1JMZ B;  4J77 A;  4XYI A;  2XU7 A;  4U7A A;  4CI1 A;  1ERJ A;  4XEI C;  5JWZ A;  1XKS A;  3HFQ A;  3ZWL B;  1MG3 A;  3MKS B;  2P9U C;  4J81 A;  3UKR C;  5IC7 A;  4E5Z A;  3AL8 B;  4J79 A;  1OMW B;  2I0S A;  1K32 A; 
#chains in the Genus database with same CATH topology
 3SVW D;  4A08 B;  3K26 A;  4A09 B;  2Z2N A;  4FAV D;  3FGB A;  5SXM A;  1K8K C;  5M5R A;  1U8C A;  2IUR A;  3EI4 B;  5H14 A;  2HU5 A;  3O4I A;  3RFH A;  5H1M A;  2BCJ B;  3UVM A;  2H6N A;  5M5T A;  3EWE A;  4JSX C;  4JT5 C;  3RMZ D;  2GC7 A;  4UI9 R;  3KRW B;  1S4U X;  5FLX g;  1TYE A;  3AH8 B;  4J78 A;  1UTC A;  5I5I A;  3VH0 A;  4JSN C;  1H2Z A;  4A0B B;  2B5N A;  1H2X A;  4ZOY A;  3V4P A;  1QFS A;  2XL2 A;  2GC4 A;  5HQG A;  4GGC A;  2CN3 A;  3SJL D;  3C9C A;  2H47 A;  3OF7 A;  1TBG A;  2VZ1 A;  4ERY A;  3FM0 A;  4D9S A;  4JD2 C;  1QNI A;  3KCI A;  3RSE C;  3JAM g;  3SN6 B;  2I0T A;  2VDP A;  3ZE0 A;  5IGO A;  3FRX A;  1QFM A;  4MMX A;  2QR5 A;  3EG6 A;  3IVM A;  1XHM A;  1B9X A;  3K6S A;  3SWS D;  3NID A;  1PI6 A;  1C9I A;  5K1C C;  4G1M A;  1GXR A;  1SQJ A;  4FA5 D;  4Z7N A;  2AGL A;  4K3I D;  2AGY A;  4GM8 A;  3IUN A;  4ZOV A;  3MKQ A;  3UKU C;  1C9L A;  4FHL A;  4A11 B;  1UOO A;  4FWW A;  2YB8 B;  5CYK A;  4UM8 A;  4R7A B;  1VE7 A;  4BP8 A;  2P9P C;  3NIF A;  1A0R B;  2Z2O A;  2CO0 C;  5TEF A;  2PM9 A;  5H17 A;  2IAA A;  3RLM D;  3T3P A;  4Z7Q A;  3DSM A;  3EMH A;  4I79 A;  1UOQ A;  5AJA A;  3DDU A;  1YFQ A;  4ERZ A;  4PSX B;  3SLE D;  2G9A A;  2CN2 A;  3BWS A;  4CI8 A;  2WQ8 A;  3JPX A;  4QQE A;  5HE2 B;  5HYN B;  2H6K A;  5C92 A;  2QC5 A;  4MMZ A;  4FAN D;  1JMX B;  4CZX A;  2OVR B;  4L1M A;  5M61 A;  2XDW A;  3RN1 D;  4J87 A;  4BUJ C;  5C86 A;  4L1Q D;  3U4Y A;  2H9M A;  2VC2 A;  4L3H D;  5EMJ B;  3K27 A;  2PM6 B;  4AOW A;  3SCY A;  2H6Q A;  5I5M A;  4JSP C;  3GFC A;  5GXH A;  3CFS B;  4X60 B;  3F3G A;  5FKQ A;  2XZG A;  2EID A;  2CO0 A;  4XYH A;  3O4H A;  5AFU 3;  3OW8 A;  1E8M A;  4A0A B;  2VZ3 A;  2CE9 A;  5K19 A;  3AFC A;  3EI1 A;  3ZDX A;  2IUP A;  1OLZ A;  5CXB B;  2H9N A;  4PNK B;  3EQ8 A;  3IJ0 A;  1PBY B;  3I8E A;  3MMY A;  4JXM A;  2IUQ A;  4QT8 A;  4X61 B;  3ULE C;  2HKR A;  3EI2 A;  4GM3 A;  2GNQ A;  4J8G A;  5IJ7 E;  3OKY B;  3PXW D;  2VDR A;  3VA6 A;  5CXC B;  3IUL A;  2OK6 A;  4Z8L A;  1UOP A;  4NSX A;  1YR2 A;  2EIB A;  2AGX A;  5C2W B;  4E54 B;  5E6S A;  5EAR A;  5EM2 A;  4CZV A;  3JRO A;  1GOH A;  4BCD A;  4UM9 A;  3QI0 A;  5A2Q g;  4FA9 D;  5TEE A;  4OZU A;  5C9Z B;  3IIY A;  2J56 H;  3FCS A;  2VDO A;  4G56 B;  4FA4 D;  1Q47 A;  3DXK C;  4O3T B;  3JZN A;  1B9Y A;  1O6F A;  4WK4 A;  4KFM B;  1T2X A;  3OL2 A;  5CYK B;  1JTD B;  1I2M B;  4LG8 A;  1L0Q A;  3O4J A;  3J80 g;  1MDA H;  1GOF A;  1GOT B;  1NR0 A;  1JOF A;  3JZH A;  5FKS A;  3I8C A;  2JKX A;  3RN0 D;  5EAP A;  3NIG A;  3EU7 A;  4J0X A;  4IRZ A;  3OTT A;  4ZOZ A;  3J81 g;  4JHN A;  4FB1 D;  1U2V C;  2AQ5 A;  3EI3 B;  5EML B;  4JT6 C;  3SHF A;  1VZ2 A;  3I7P A;  4G55 A;  3IJC A;  3E0C A;  4AN1 A;  3BG1 A;  1JJU B;  3EQ9 A;  3V5W B;  4CZY A;  4CY3 A;  4LG9 A;  1PGU A;  4N14 A;  3I7O A;  3UVL A;  3AL8 A;  3N0D A;  4GMB A;  1L5G A;  2BBK H;  4O2W A;  5HE3 B;  1E8N A;  1K3I A;  3DXM C;  3T3M A;  2OVP B;  1N6F A;  4TZ4 A;  2HU7 A;  4A08 A;  4A09 A;  3MZK A;  4JHP C;  3L4M D;  4Y5R D;  2HJ4 A;  3SFZ A;  4BCB A;  1GOG A;  2I0R A;  3EI4 A;  1NEX B;  3F3F A;  3I7K A;  2HKM A;  4GQ2 P;  3K71 A;  2H9P A;  5FFO A;  4ZN4 A;  4E5Z B;  2TRC B;  4PXW A;  4GQB B;  4J73 A;  3C99 A;  4CI2 A;  2HJB A;  2P9S C;  4GZ8 A;  3PVW B;  5M5V A;  3IKO A;  4LGN A;  2H14 A;  3GRE A;  4EWR A;  1SHY B;  4DNU A;  1BPO A;  3VI3 A;  2P9L C;  4Y7R A;  4A0B A;  4QAM A;  4QL1 A;  3K72 A;  1TYQ C;  4J82 A;  4BP9 A;  2HES X;  2VDM A;  3MZL A;  1MG2 A;  5IJ8 E;  3ODT A;  3UVK A;  3C5M A;  3ZE2 A;  4PBY A;  4A2M A;  2AH1 A;  4ESG A;  4J8B A;  3ORV D;  5I5J A;  3FCU A;  1SQ9 A;  3MXX A;  4U1E I;  3CIK B;  2IWK A;  1VE6 A;  4NBM A;  4D6V A;  4NC4 A;  4O02 A;  3IJ1 A;  4O1Q D;  4DNV A;  4WJK A;  4HDJ A;  3SBP A;  3GC3 B;  3N0E A;  4H5J A;  2QXV A;  3RFG A;  4GGD A;  3I7H A;  4AX4 A;  3UR4 A;  4GQ1 A;  4ERQ A;  4IMM A;  3B7F A;  4FA1 D;  3IUQ A;  4WK0 A;  1N6D A;  3SBR A;  3UVN A;  3W15 A;  1U4C A;  4X63 B;  4QRJ A;  2IUV A;  2W18 A;  3I7L A;  3F3P A;  4O45 A;  3AL9 A;  2VDQ A;  2H3X A;  4RE5 A;  2XYI A;  4A11 A;  4A2L A;  2J57 G;  4AN0 A;  3P4F A;  2B5L A;  4L3G D;  4GGA A;  5FFG A;  2HU8 A;  2Q7Q A;  1H2W A;  2O9K A;  1E5T A;  3I7N A;  2XE4 A;  4A7J A;  3IUR A;  2XL3 A;  2YMU A;  3NVX A;  4ZOX A;  3V7D B;  3PE7 A;  5EAM A;  1RI6 A;  4CI3 A;  3SXT D;  5AMS A;  2G99 A;  2I3S A;  2HYE A;  5TDH B;  2EBS A;  3MUN A;  4AMY A;  2PM7 B;  4YVD A;  2AGW A;  5FQD A;  3DWL C;  3VGZ A;  2PBI B;  3JRP A;  2P9K C;  3CFV A;  2UZX B;  3V9F A;  4DNW A;  3RRM C;  1GG2 B;  1VYH C;  5TF2 A;  3ZDY A;  5FA5 B;  2PM9 B;  4O3U B;  4PC0 A;  4CY5 A;  4CY1 A;  4GM9 A;  2H13 A;  4BL0 A;  4J86 A;  3QHY B;  4WK2 A;  2OIZ A;  3I2N A;  1R5M A;  3OKT A;  4K3J B;  4MK0 B;  2P9I C;  3DM0 A;  4CY2 A;  5M5S A;  5GSA A;  5B4W A;  1PEV A;  5IGQ A;  3A0F A;  4L9O A;  4O9D A;  1H2Y A;  3PXS D;  2HXC A;  3JZG A;  4BCC A;  2EIE A;  2I3T A;  4A0A A;  2OJY A;  3JB9 L;  5HE0 B;  4IA9 A;  4PBZ A;  5CXB A;  5M5U A;  4RE6 A;  3NVQ A;  3ZE1 A;  2YNN A;  5C2V B;  1M1X A;  3EQ7 A;  4AEZ A;  2CNX A;  5HDB A;  2UZY B;  2IWF A;  4NEN A;  3OKY A;  5EMK B;  2YBA A;  5CXC A;  2CE8 A;  3KRX B;  3L4O D;  1XIP A;  4E54 A;  4JSV C;  4MMY A;  4J0W A;  3EI1 B;  3IUJ A;  1FWX A;  1VZ3 A;  3BG0 A;  3C75 H;  5E6U A;  3OKW A;  2BKL A;  5KDO B;  4J84 A;  5FKT A;  3MVD K;  1N6E A;  3EI2 B;  4H5I A;  4PSW B;  2OVQ B;  4G1E A;  3PVU B;  2MTA H;  5THA A;  2AGZ A;  4ES0 A;  2YNO A;  2EIC A;  2YNP A;  2J55 H;  5EM2 B;  1JV2 A;  1O6G A;  3SBQ A;  2H9L A;  4D0K A;  5IT9 g;  3IIW A;  5FXY A;  5GMK n;  3SMR A;  4AMZ A;  3IUM A;  3EI3 A;  4CC9 A;  3PSL A;  3GD1 I;  1P22 A;  5EAL A;  4Z7O A;  5HE1 B;  5GXI A;  4X3E A;  3OL2 B;  5EMM B;  2VDN A;  5FKR A;  2P9N C;  3I89 A;  2AH0 A;  2OK4 A;  1GP2 B;  2Z2P A;  4OWR A;  1A12 A;  4BH6 A;  2B5M A;  3NVN A;  2VDK A;  2B4E A;  3O4G A;  3PSC B;  3PXT D;  2H68 A;  3UVO A;  1JMZ B;  4J77 A;  4XYI A;  2XU7 A;  4U7A A;  2QZP A;  3V4V A;  4CI1 A;  2VDL A;  1ERJ A;  4XEI C;  5E6R A;  5JWZ A;  3IJE A;  3VI4 A;  1XKS A;  3ZDZ A;  3MUO A;  4NAA A;  3HFQ A;  3ZWL B;  1MG3 A;  3MKS B;  2P9U C;  4J81 A;  3UKR C;  5IC7 A;  4E5Z A;  3AL8 B;  4J79 A;  1OMW B;  2I0S A;  1K32 A; 
#chains in the Genus database with same CATH homology
 3SVW D;  4A08 B;  3K26 A;  4A09 B;  2Z2N A;  4FAV D;  3FGB A;  5SXM A;  1K8K C;  2IUR A;  3EI4 B;  5H14 A;  3RFH A;  5H1M A;  2BCJ B;  3UVM A;  2H6N A;  3EWE A;  4JSX C;  4JT5 C;  3RMZ D;  2GC7 A;  4UI9 R;  3KRW B;  1S4U X;  5FLX g;  3AH8 B;  4J78 A;  5I5I A;  3VH0 A;  4JSN C;  4A0B B;  2B5N A;  4ZOY A;  2XL2 A;  2GC4 A;  5HQG A;  4GGC A;  2CN3 A;  3SJL D;  3C9C A;  2H47 A;  1TBG A;  4ERY A;  3FM0 A;  4JD2 C;  1QNI A;  3RSE C;  3JAM g;  3SN6 B;  2I0T A;  5IGO A;  3FRX A;  3EG6 A;  1XHM A;  1B9X A;  3SWS D;  1PI6 A;  5K1C C;  1GXR A;  1SQJ A;  4FA5 D;  2AGL A;  4K3I D;  2AGY A;  4GM8 A;  4ZOV A;  3MKQ A;  3UKU C;  4A11 B;  4FHL A;  4FWW A;  2YB8 B;  5CYK A;  4R7A B;  2P9P C;  1A0R B;  2Z2O A;  2CO0 C;  5TEF A;  2PM9 A;  5H17 A;  2IAA A;  3RLM D;  3DSM A;  4I79 A;  3EMH A;  5AJA A;  1YFQ A;  4ERZ A;  4PSX B;  3SLE D;  2G9A A;  2CN2 A;  3BWS A;  4CI8 A;  3JPX A;  4QQE A;  5HE2 B;  5HYN B;  2H6K A;  2QC5 A;  4FAN D;  1JMX B;  4CZX A;  2OVR B;  3RN1 D;  4J87 A;  4BUJ C;  3U4Y A;  4L1Q D;  2H9M A;  4L3H D;  5EMJ B;  3K27 A;  2PM6 B;  4AOW A;  3SCY A;  2H6Q A;  5I5M A;  4JSP C;  3GFC A;  5GXH A;  3CFS B;  4X60 B;  3F3G A;  5FKQ A;  2CO0 A;  4XYH A;  5AFU 3;  3OW8 A;  4A0A B;  2CE9 A;  5K19 A;  3AFC A;  3EI1 A;  2IUP A;  1OLZ A;  5CXB B;  2H9N A;  4PNK B;  3IJ0 A;  1PBY B;  3I8E A;  3MMY A;  4JXM A;  2IUQ A;  4QT8 A;  4X61 B;  3ULE C;  2HKR A;  3EI2 A;  4GM3 A;  2GNQ A;  4J8G A;  5IJ7 E;  3OKY B;  3PXW D;  3VA6 A;  5CXC B;  2OK6 A;  4Z8L A;  4NSX A;  2AGX A;  5C2W B;  4E54 B;  5EAR A;  5EM2 A;  4CZV A;  3JRO A;  5A2Q g;  4FA9 D;  5TEE A;  4OZU A;  5C9Z B;  3IIY A;  2J56 H;  4G56 B;  4FA4 D;  1Q47 A;  3DXK C;  4O3T B;  1B9Y A;  3JZN A;  4KFM B;  3OL2 A;  5CYK B;  4LG8 A;  1L0Q A;  3J80 g;  1MDA H;  1GOT B;  1NR0 A;  1JOF A;  3JZH A;  5FKS A;  3I8C A;  3RN0 D;  5EAP A;  3EU7 A;  4J0X A;  4ZOZ A;  3OTT A;  3J81 g;  4FB1 D;  1U2V C;  2AQ5 A;  3EI3 B;  5EML B;  4JT6 C;  3SHF A;  3I7P A;  3IJC A;  3E0C A;  3BG1 A;  1JJU B;  3V5W B;  4CZY A;  4CY3 A;  4LG9 A;  1PGU A;  4N14 A;  3I7O A;  3UVL A;  3AL8 A;  3N0D A;  4GMB A;  2BBK H;  5HE3 B;  3DXM C;  2OVP B;  1N6F A;  4TZ4 A;  4A08 A;  4A09 A;  3MZK A;  3L4M D;  4Y5R D;  2HJ4 A;  3SFZ A;  2I0R A;  3EI4 A;  1NEX B;  3F3F A;  3I7K A;  2HKM A;  4GQ2 P;  2H9P A;  4ZN4 A;  4E5Z B;  2TRC B;  4PXW A;  4GQB B;  4J73 A;  3C99 A;  4CI2 A;  2HJB A;  2P9S C;  4GZ8 A;  3PVW B;  3IKO A;  4LGN A;  2H14 A;  3GRE A;  4EWR A;  1SHY B;  2P9L C;  4Y7R A;  4A0B A;  4QL1 A;  1TYQ C;  4J82 A;  2HES X;  5IJ8 E;  3MZL A;  1MG2 A;  3ODT A;  3UVK A;  3C5M A;  4PBY A;  4A2M A;  2AH1 A;  4ESG A;  4J8B A;  3ORV D;  5I5J A;  1SQ9 A;  3MXX A;  4U1E I;  3CIK B;  2IWK A;  4D6V A;  3IJ1 A;  4O1Q D;  4HDJ A;  3SBP A;  3N0E A;  4H5J A;  2QXV A;  3RFG A;  4GGD A;  3I7H A;  3UR4 A;  4GQ1 A;  4ERQ A;  4IMM A;  3B7F A;  4FA1 D;  1N6D A;  3SBR A;  3UVN A;  3W15 A;  1U4C A;  4X63 B;  4QRJ A;  2IUV A;  2W18 A;  3I7L A;  3F3P A;  4O45 A;  3AL9 A;  2H3X A;  2XYI A;  4A11 A;  4A2L A;  2J57 G;  3P4F A;  2B5L A;  4L3G D;  4GGA A;  2Q7Q A;  2O9K A;  3I7N A;  4A7J A;  2XL3 A;  2YMU A;  3NVX A;  4ZOX A;  3V7D B;  3PE7 A;  5EAM A;  1RI6 A;  4CI3 A;  3SXT D;  5AMS A;  2G99 A;  2I3S A;  2HYE A;  5TDH B;  2EBS A;  2PM7 B;  4YVD A;  2AGW A;  5FQD A;  3DWL C;  3VGZ A;  2PBI B;  2P9K C;  3JRP A;  3CFV A;  2UZX B;  3V9F A;  3RRM C;  1GG2 B;  1VYH C;  5TF2 A;  5FA5 B;  2PM9 B;  4O3U B;  4PC0 A;  4CY5 A;  4CY1 A;  4GM9 A;  2H13 A;  4BL0 A;  4J86 A;  2OIZ A;  3I2N A;  1R5M A;  3OKT A;  4K3J B;  4MK0 B;  2P9I C;  3DM0 A;  4CY2 A;  5GSA A;  5B4W A;  1PEV A;  5IGQ A;  3A0F A;  4L9O A;  4O9D A;  3PXS D;  2HXC A;  3JZG A;  2I3T A;  4A0A A;  2OJY A;  3JB9 L;  5HE0 B;  4IA9 A;  4PBZ A;  5CXB A;  3NVQ A;  2YNN A;  5C2V B;  4AEZ A;  2CNX A;  2UZY B;  2IWF A;  3OKY A;  5EMK B;  2YBA A;  5CXC A;  2CE8 A;  3KRX B;  3L4O D;  1XIP A;  4E54 A;  4JSV C;  4J0W A;  3EI1 B;  1FWX A;  3BG0 A;  3C75 H;  3OKW A;  5KDO B;  4J84 A;  5FKT A;  1N6E A;  3EI2 B;  4H5I A;  4PSW B;  2OVQ B;  3PVU B;  2MTA H;  5THA A;  2AGZ A;  4ES0 A;  2YNO A;  2YNP A;  2J55 H;  5EM2 B;  3SBQ A;  2H9L A;  4D0K A;  5IT9 g;  3IIW A;  5FXY A;  5GMK n;  3SMR A;  3EI3 A;  4CC9 A;  3PSL A;  5EAL A;  1P22 A;  5GXI A;  5HE1 B;  4X3E A;  3OL2 B;  5EMM B;  5FKR A;  2P9N C;  3I89 A;  2AH0 A;  2OK4 A;  1GP2 B;  2Z2P A;  4OWR A;  4BH6 A;  2B5M A;  3NVN A;  2B4E A;  3PSC B;  3PXT D;  3UVO A;  2H68 A;  1JMZ B;  4J77 A;  4XYI A;  2XU7 A;  4U7A A;  4CI1 A;  1ERJ A;  4XEI C;  5JWZ A;  1XKS A;  3HFQ A;  3ZWL B;  1MG3 A;  3MKS B;  2P9U C;  4J81 A;  3UKR C;  5IC7 A;  4E5Z A;  3AL8 B;  4J79 A;  1OMW B;  2I0S A;  1K32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...