2VDPA

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 107
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdpA00
2VDKA 3NIFA 5FFGA 3NIGA 5E6SA 5HDBA 1M1XA 1JV2A 3V4PA 2VDQA 2VC2A 3ZDZA 4G1EA 4UM8A 3NIDA 4WK2A 3T3MA 3ZDXA 3K72A 3K6SA 4WK4A 5FFOA 2VDNA 5E6RA 4MMZA 4WK0A 2VDLA 3T3PA 4MMXA 3ZE2A 4G1MA 4Z7OA 2VDPA 5E6UA 1L5GA 4WJKA 3ZE1A 3K71A 3IJEA 2VDRA 3VI4A 3VI3A 2VDMA 4MMYA 3ZDYA 3FCSA 4Z7NA 1U8CA 4O02A 1TYEA 3ZE0A 2VDOA 3FCUA 4IRZA 4NENA 4UM9A 4Z7QA 3V4VA
chains in the Genus database with same CATH superfamily
2PM9B 3SBRA 4NC4A 3VA6A 4CZVA 3RLMD 1M1XA 3V9FA 1GOTB 3L4MD 4K3ID 4RE6A 3I7LA 5CXBB 4E5ZB 2H9MA 4NAAA 2I3SA 5EMMB 4CI8A 3J81g 1PEVA 4FAND 3EI4A 4YVDA 3EI1A 5C9ZB 4E54B 5E6UA 1SQ9A 3SMRA 1H2YA 3SXTD 4BP9A 4GQ1A 5EALA 4LG9A 3DSMA 5M61A 2P9NC 3O4GA 3EQ7A 3I7HA 4JT6C 2PM7B 3SFZA 2H13A 5C92A 5FKQA 1MDAH 2OVRB 3OW8A 2OK6A 4N14A 5GSAA 1JV2A 5SXMA 2HU7A 3IJ0A 2I0RA 5IT9g 4JSPC 2HXCA 3RN1D 3IJ1A 1O6GA 4DNVA 4QT8A 2VDLA 3U4YA 2J57G 3RSEC 1JJUB 3AH8B 2I3TA 4J8GA 2UZXB 3EU7A 2CNXA 3FM0A 2VDMA 3IIYA 2H47A 4TZ4A 5GXHA 3ULEC 3EI4B 3EQ8A 5TDHB 3O4IA 1TYEA 2I0TA 4J86A 1A12A 2IUPA 5EMLB 2Z2PA 3NIGA 2AGLA 3C99A 1B9YA 4GQ2P 3OTTA 5AMSA 4D6VA 3JZGA 4FA9D 4FA1D 2AH0A 1H2ZA 4GGDA 4FB1D 4PXWA 3O4HA 1MG2A 4JSNC 3BG0A 2JKXA 3PVWB 4HDJA 5K19A 1UOQA 4MMYA 3RFHA 4AEZA 5M5UA 3RN0D 5EARA 2QR5A 1MG3A 4L9OA 3NIFA 1K32A 5TEEA 3NVXA 2IAAA 5EMJB 1TBGA 5JWZA 2HJBA 4J81A 3DDUA 3QI0A 1GOFA 2CO0C 2G9AA 4J84A 5FFOA 3K26A 5E6RA 3UVMA 3I7PA 1JTDB 2WQ8A 4J77A 4Y7RA 4U1EI 1C9LA 2H6NA 4BH6A 1GOGA 3GFCA 3NVNA 4GQBB 3SJLD 4AOWA 1OMWB 3OKYA 4A09A 2IUVA 5EM2A 2H68A 4CC9A 4AN1A 2CE8A 4JHPC 5CXBA 3PXSD 4E5ZA 2XDWA 4CI1A 3C5MA 4Z8LA 2GC4A 4PBZA 2J56H 3I8EA 5HE3B 3N0DA 4QAMA 5M5VA 1U2VC 5FKTA 4ZOZA 5I5IA 2PM6B 1B9XA 2XZGA 4JD2C 4XEIC 3MUOA 2VDNA 4WK0A 5IC7A 3MZKA 1BPOA 5CXCA 4PNKB 4Z7OA 3NVQA 1NEXB 3JROA 3K71A 2IUQA 4GMBA 3E0CA 5GXIA 3B7FA 4A7JA 1ERJA 3OL2A 3ZE0A 4UM9A 4Z7QA 3KCIA 4A2MA 3EMHA 4PBYA 2P9LC 4A09B 5EM2B 3AL8A 3CIKB 5HDBA 2VDQA 4G1EA 4BCBA 3K72A 3MVDK 2EIBA 5M5SA 2OIZA 4WK4A 2YBAA 3ORVD 2B5LA 1VE7A 4FAVD 4Y5RD 1C9IA 4WJKA 3SBPA 2H3XA 1JMZB 4UI9R 4QQEA 1T2XA 2TRCB 4NBMA 1SQJA 2AGYA 3CFVA 5IGOA 4Z7NA 1UOPA 1YR2A 5CXCB 1FWXA 3KRWB 1GXRA 5FKSA 3IUQA 5THAA 1N6EA 3IJCA 3I7KA 3PSLA 3OL2B 4L3HD 4ZOYA 5H17A 2BKLA 4O1QD 2CN3A 3AL8B 4ERQA 4AMYA 4L1QD 2EIEA 2H6KA 1N6FA 3RRMC 4O3UB 1VE6A 4GM8A 4U7AA 2I0SA 1VYHC 3RMZD 3JAMg 3IUMA 4GGCA 3F3GA 2AGXA 2YNNA 4KFMB 4EWRA 4X60B 3FGBA 2QZPA 2AGWA 5H14A 3L4OD 3MKQA 3ZDXA 2MTAH 4JSXC 2XE4A 5GMKn 2VZ1A 2OVPB 2BCJB 2XL2A 3AFCA 3PXTD 2YMUA 5C2VB 5CYKA 2BBKH 2H9PA 1R5MA 4L3GD 3MKSB 1JMXB 3FCUA 3A0FA 4L1MA 4ERYA 4O3TB 4BCCA 4I79A 4J0WA 3HFQA 4D9SA 3O4JA 4QL1A 1E8MA 2O9KA 3K6SA 4A08B 1PBYB 4IA9A 4MMXA 3EG6A 4G1MA 2VDPA 5FLXg 4ZN4A 3IJEA 1O6FA 4J73A 1QNIA 3UKUC 3ZDYA 3K27A 3PE7A 5I5JA 4IRZA 4MK0B 1GG2B 5FKRA 4J79A 4ERZA 5CYKB 3PXWD 3V4PA 1XIPA 2OK4A 3I2NA 3UVOA 3EQ9A 4PSXB 3P4FA 3SWSD 4WK2A 5FA5B 1GP2B 4LGNA 2HESX 3BWSA 4H5JA 4PC0A 1XKSA 2YNPA 2VZ3A 4NSXA 3DM0A 4J0XA 1PGUA 1S4UX 3JB9L 3C9CA 1QFMA 1H2XA 4CZYA 1NR0A 2IWFA 2PBIB 3EI3B 4DNWA 2H14A 4DNUA 4QRJA 2HKRA 3MXXA 2P9IC 5AJAA 1I2MB 3RFGA 2P9PC 4A0BA 5E6SA 1A0RB 2B5NA 2P9KC 3F3FA 3SHFA 3ODTA 5IJ7E 2AH1A 5HYNB 2HJ4A 1PI6A 4GGAA 4MMZA 2QXVA 4K3JB 5TEFA 1K8KC 3IKOA 3GD1I 2CE9A 2XL3A 3UKRC 3FCSA 3FRXA 4ZOVA 2HYEA 2H9NA 4PSWB 4AX4A 4CY3A 5FFGA 5AFU3 5I5MA 4GM3A 2Q7QA 2OJYA 1RI6A 3C75H 4A11A 3IUJA 4J82A 5HE0B 4A0BB 3T3PA 3I7OA 4ZOXA 3UVNA 5C86A 3DXMC 2HU5A 3ZE1A 2H9LA 3UR4A 3IULA 4CY5A 3J80g 4O02A 4GM9A 3EI2A 3IVMA 2AGZA 4BP8A 2H6QA 1VZ3A 3V4VA 5IGQA 1QFSA 2UZYB 2G99A 2CN2A 4A08A 5HQGA 4CY2A 4CZXA 3EWEA 3VGZA 5EAPA 4O45A 2VC2A 2HU8A 4J78A 3JZNA 3SLED 2EIDA 5M5RA 2XU7A 3T3MA 5FXYA 4GZ8A 4AMZA 2CO0A 1K3IA 2QC5A 3AL9A 2YB8B 4FWWA 5K1CC 3JZHA 4A11B 3MMYA 4CI3A 3W15A 3EI1B 3OKTA 3BG1A 4JHNA 5FQDA 5C2WB 2OVQB 1H2WA 3JPXA 3MZLA 3N0EA 4JT5C 1E5TA 4A0AA 5EAMA 5M5TA 4G55A 3DWLC 3I8CA 4A2LA 3EI2B 3PSCB 3F3PA 4JSVC 4FA4D 1YFQA 3JRPA 2B4EA 4J87A 3UVLA 3SN6B 2EBSA 3EI3A 4XYIA 2P9SC 3I89A 1TYQC 1GOHA 2HKMA 4BUJC 3KRXB 2GC7A 1XHMA 3CFSB 5H1MA 1U8CA 2B5MA 5EMKB 2P9UC 3UVKA 3VH0A 2VDKA 4X61B 1P22A 1N6DA 4BL0A 4ESGA 4OZUA 2J55H 4UM8A 5A2Qg 2Z2NA 3NIDA 4R7AB 1U4CA 5TF2A 3SCYA 4BCDA 3OKWA 4AN0A 2YNOA 5KDOB 4H5IA 4IMMA 4A0AB 3ZE2A 4G56B 3GREA 4O2WA 4LG8A 2PM9A 3IIWA 3SBQA 5B4WA 3VI3A 4XYHA 4O9DA 1L0QA 2EICA 1VZ2A 1OLZA 1Q47A 3IURA 1SHYB 3OF7A 4OWRA 4D0KA 5HE2B 1E8NA 3GC3B 3MUNA 4X63B 1JOFA 3PVUB 4ES0A 4E54A 2IURA 4J8BA 3IUNA 3ZDZA 2IWKA 2AQ5A 1UTCA 5IJ8E 3DXKC 4RE5A 4CI2A 2Z2OA 4FA5D 3SVWD 5HE1B 3V7DB 3I7NA 4FHLA 3V5WB 1L5GA 1UOOA 2VDRA 3VI4A 3QHYB 4CY1A 4X3EA 4JXMA 2W18A 3ZWLB 2VDOA 4NENA 3OKYB 2GNQA 2XYIA
chains in the Genus database with same CATH topology
2VDKA 3NIFA 5FFGA 3NIGA 5E6SA 5HDBA 1M1XA 1JV2A 3V4PA 2VDQA 2VC2A 3ZDZA 4G1EA 4UM8A 3NIDA 4WK2A 3T3MA 3ZDXA 3K72A 3K6SA 4WK4A 5FFOA 2VDNA 5E6RA 4MMZA 4WK0A 2VDLA 3T3PA 4MMXA 3ZE2A 4G1MA 4Z7OA 2VDPA 5E6UA 1L5GA 4WJKA 3ZE1A 3K71A 3IJEA 2VDRA 3VI4A 3VI3A 2VDMA 4MMYA 3ZDYA 3FCSA 4Z7NA 1U8CA 4O02A 1TYEA 3ZE0A 2VDOA 3FCUA 4IRZA 4NENA 4UM9A 4Z7QA 3V4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDK A;  3NIF A;  5FFG A;  3NIG A;  5E6S A;  5HDB A;  1M1X A;  1JV2 A;  3V4P A;  2VDQ A;  2VC2 A;  3ZDZ A;  4G1E A;  4UM8 A;  3NID A;  4WK2 A;  3T3M A;  3ZDX A;  3K72 A;  3K6S A;  4WK4 A;  5FFO A;  2VDN A;  5E6R A;  4MMZ A;  4WK0 A;  2VDL A;  3T3P A;  4MMX A;  3ZE2 A;  4G1M A;  4Z7O A;  2VDP A;  5E6U A;  1L5G A;  4WJK A;  3ZE1 A;  3K71 A;  3IJE A;  2VDR A;  3VI4 A;  3VI3 A;  2VDM A;  4MMY A;  3ZDY A;  3FCS A;  4Z7N A;  1U8C A;  4O02 A;  1TYE A;  3ZE0 A;  2VDO A;  3FCU A;  4IRZ A;  4NEN A;  4UM9 A;  4Z7Q A;  3V4V A; 
#chains in the Genus database with same CATH topology
 2PM9 B;  3SBR A;  4NC4 A;  3VA6 A;  4CZV A;  3RLM D;  1M1X A;  3V9F A;  1GOT B;  3L4M D;  4K3I D;  4RE6 A;  3I7L A;  5CXB B;  4E5Z B;  2H9M A;  4NAA A;  2I3S A;  5EMM B;  4CI8 A;  3J81 g;  1PEV A;  4FAN D;  3EI4 A;  4YVD A;  3EI1 A;  5C9Z B;  4E54 B;  5E6U A;  1SQ9 A;  3SMR A;  1H2Y A;  3SXT D;  4BP9 A;  4GQ1 A;  5EAL A;  4LG9 A;  3DSM A;  5M61 A;  2P9N C;  3O4G A;  3EQ7 A;  3I7H A;  4JT6 C;  2PM7 B;  3SFZ A;  2H13 A;  5C92 A;  5FKQ A;  1MDA H;  2OVR B;  3OW8 A;  2OK6 A;  4N14 A;  5GSA A;  1JV2 A;  5SXM A;  2HU7 A;  3IJ0 A;  2I0R A;  5IT9 g;  4JSP C;  2HXC A;  3RN1 D;  3IJ1 A;  1O6G A;  4DNV A;  4QT8 A;  2VDL A;  3U4Y A;  2J57 G;  3RSE C;  1JJU B;  3AH8 B;  2I3T A;  4J8G A;  2UZX B;  3EU7 A;  2CNX A;  3FM0 A;  2VDM A;  3IIY A;  2H47 A;  4TZ4 A;  5GXH A;  3ULE C;  3EI4 B;  3EQ8 A;  5TDH B;  3O4I A;  1TYE A;  2I0T A;  4J86 A;  1A12 A;  2IUP A;  5EML B;  2Z2P A;  3NIG A;  2AGL A;  3C99 A;  1B9Y A;  4GQ2 P;  3OTT A;  5AMS A;  4D6V A;  3JZG A;  4FA9 D;  4FA1 D;  2AH0 A;  1H2Z A;  4GGD A;  4FB1 D;  4PXW A;  3O4H A;  1MG2 A;  4JSN C;  3BG0 A;  2JKX A;  3PVW B;  4HDJ A;  5K19 A;  1UOQ A;  4MMY A;  3RFH A;  4AEZ A;  5M5U A;  3RN0 D;  5EAR A;  2QR5 A;  1MG3 A;  4L9O A;  3NIF A;  1K32 A;  5TEE A;  3NVX A;  2IAA A;  5EMJ B;  1TBG A;  5JWZ A;  2HJB A;  4J81 A;  3DDU A;  3QI0 A;  1GOF A;  2CO0 C;  2G9A A;  4J84 A;  5FFO A;  3K26 A;  5E6R A;  3UVM A;  3I7P A;  1JTD B;  2WQ8 A;  4J77 A;  4Y7R A;  4U1E I;  1C9L A;  2H6N A;  4BH6 A;  1GOG A;  3GFC A;  3NVN A;  4GQB B;  3SJL D;  4AOW A;  1OMW B;  3OKY A;  4A09 A;  2IUV A;  5EM2 A;  2H68 A;  4CC9 A;  4AN1 A;  2CE8 A;  4JHP C;  5CXB A;  3PXS D;  4E5Z A;  2XDW A;  4CI1 A;  3C5M A;  4Z8L A;  2GC4 A;  4PBZ A;  2J56 H;  3I8E A;  5HE3 B;  3N0D A;  4QAM A;  5M5V A;  1U2V C;  5FKT A;  4ZOZ A;  5I5I A;  2PM6 B;  1B9X A;  2XZG A;  4JD2 C;  4XEI C;  3MUO A;  2VDN A;  4WK0 A;  5IC7 A;  3MZK A;  1BPO A;  5CXC A;  4PNK B;  4Z7O A;  3NVQ A;  1NEX B;  3JRO A;  3K71 A;  2IUQ A;  4GMB A;  3E0C A;  5GXI A;  3B7F A;  4A7J A;  1ERJ A;  3OL2 A;  3ZE0 A;  4UM9 A;  4Z7Q A;  3KCI A;  4A2M A;  3EMH A;  4PBY A;  2P9L C;  4A09 B;  5EM2 B;  3AL8 A;  3CIK B;  5HDB A;  2VDQ A;  4G1E A;  4BCB A;  3K72 A;  3MVD K;  2EIB A;  5M5S A;  2OIZ A;  4WK4 A;  2YBA A;  3ORV D;  2B5L A;  1VE7 A;  4FAV D;  4Y5R D;  1C9I A;  4WJK A;  3SBP A;  2H3X A;  1JMZ B;  4UI9 R;  4QQE A;  1T2X A;  2TRC B;  4NBM A;  1SQJ A;  2AGY A;  3CFV A;  5IGO A;  4Z7N A;  1UOP A;  1YR2 A;  5CXC B;  1FWX A;  3KRW B;  1GXR A;  5FKS A;  3IUQ A;  5THA A;  1N6E A;  3IJC A;  3I7K A;  3PSL A;  3OL2 B;  4L3H D;  4ZOY A;  5H17 A;  2BKL A;  4O1Q D;  2CN3 A;  3AL8 B;  4ERQ A;  4AMY A;  4L1Q D;  2EIE A;  2H6K A;  1N6F A;  3RRM C;  4O3U B;  1VE6 A;  4GM8 A;  4U7A A;  2I0S A;  1VYH C;  3RMZ D;  3JAM g;  3IUM A;  4GGC A;  3F3G A;  2AGX A;  2YNN A;  4KFM B;  4EWR A;  4X60 B;  3FGB A;  2QZP A;  2AGW A;  5H14 A;  3L4O D;  3MKQ A;  3ZDX A;  2MTA H;  4JSX C;  2XE4 A;  5GMK n;  2VZ1 A;  2OVP B;  2BCJ B;  2XL2 A;  3AFC A;  3PXT D;  2YMU A;  5C2V B;  5CYK A;  2BBK H;  2H9P A;  1R5M A;  4L3G D;  3MKS B;  1JMX B;  3FCU A;  3A0F A;  4L1M A;  4ERY A;  4O3T B;  4BCC A;  4I79 A;  4J0W A;  3HFQ A;  4D9S A;  3O4J A;  4QL1 A;  1E8M A;  2O9K A;  3K6S A;  4A08 B;  1PBY B;  4IA9 A;  4MMX A;  3EG6 A;  4G1M A;  2VDP A;  5FLX g;  4ZN4 A;  3IJE A;  1O6F A;  4J73 A;  1QNI A;  3UKU C;  3ZDY A;  3K27 A;  3PE7 A;  5I5J A;  4IRZ A;  4MK0 B;  1GG2 B;  5FKR A;  4J79 A;  4ERZ A;  5CYK B;  3PXW D;  3V4P A;  1XIP A;  2OK4 A;  3I2N A;  3UVO A;  3EQ9 A;  4PSX B;  3P4F A;  3SWS D;  4WK2 A;  5FA5 B;  1GP2 B;  4LGN A;  2HES X;  3BWS A;  4H5J A;  4PC0 A;  1XKS A;  2YNP A;  2VZ3 A;  4NSX A;  3DM0 A;  4J0X A;  1PGU A;  1S4U X;  3JB9 L;  3C9C A;  1QFM A;  1H2X A;  4CZY A;  1NR0 A;  2IWF A;  2PBI B;  3EI3 B;  4DNW A;  2H14 A;  4DNU A;  4QRJ A;  2HKR A;  3MXX A;  2P9I C;  5AJA A;  1I2M B;  3RFG A;  2P9P C;  4A0B A;  5E6S A;  1A0R B;  2B5N A;  2P9K C;  3F3F A;  3SHF A;  3ODT A;  5IJ7 E;  2AH1 A;  5HYN B;  2HJ4 A;  1PI6 A;  4GGA A;  4MMZ A;  2QXV A;  4K3J B;  5TEF A;  1K8K C;  3IKO A;  3GD1 I;  2CE9 A;  2XL3 A;  3UKR C;  3FCS A;  3FRX A;  4ZOV A;  2HYE A;  2H9N A;  4PSW B;  4AX4 A;  4CY3 A;  5FFG A;  5AFU 3;  5I5M A;  4GM3 A;  2Q7Q A;  2OJY A;  1RI6 A;  3C75 H;  4A11 A;  3IUJ A;  4J82 A;  5HE0 B;  4A0B B;  3T3P A;  3I7O A;  4ZOX A;  3UVN A;  5C86 A;  3DXM C;  2HU5 A;  3ZE1 A;  2H9L A;  3UR4 A;  3IUL A;  4CY5 A;  3J80 g;  4O02 A;  4GM9 A;  3EI2 A;  3IVM A;  2AGZ A;  4BP8 A;  2H6Q A;  1VZ3 A;  3V4V A;  5IGQ A;  1QFS A;  2UZY B;  2G99 A;  2CN2 A;  4A08 A;  5HQG A;  4CY2 A;  4CZX A;  3EWE A;  3VGZ A;  5EAP A;  4O45 A;  2VC2 A;  2HU8 A;  4J78 A;  3JZN A;  3SLE D;  2EID A;  5M5R A;  2XU7 A;  3T3M A;  5FXY A;  4GZ8 A;  4AMZ A;  2CO0 A;  1K3I A;  2QC5 A;  3AL9 A;  2YB8 B;  4FWW A;  5K1C C;  3JZH A;  4A11 B;  3MMY A;  4CI3 A;  3W15 A;  3EI1 B;  3OKT A;  3BG1 A;  4JHN A;  5FQD A;  5C2W B;  2OVQ B;  1H2W A;  3JPX A;  3MZL A;  3N0E A;  4JT5 C;  1E5T A;  4A0A A;  5EAM A;  5M5T A;  4G55 A;  3DWL C;  3I8C A;  4A2L A;  3EI2 B;  3PSC B;  3F3P A;  4JSV C;  4FA4 D;  1YFQ A;  3JRP A;  2B4E A;  4J87 A;  3UVL A;  3SN6 B;  2EBS A;  3EI3 A;  4XYI A;  2P9S C;  3I89 A;  1TYQ C;  1GOH A;  2HKM A;  4BUJ C;  3KRX B;  2GC7 A;  1XHM A;  3CFS B;  5H1M A;  1U8C A;  2B5M A;  5EMK B;  2P9U C;  3UVK A;  3VH0 A;  2VDK A;  4X61 B;  1P22 A;  1N6D A;  4BL0 A;  4ESG A;  4OZU A;  2J55 H;  4UM8 A;  5A2Q g;  2Z2N A;  3NID A;  4R7A B;  1U4C A;  5TF2 A;  3SCY A;  4BCD A;  3OKW A;  4AN0 A;  2YNO A;  5KDO B;  4H5I A;  4IMM A;  4A0A B;  3ZE2 A;  4G56 B;  3GRE A;  4O2W A;  4LG8 A;  2PM9 A;  3IIW A;  3SBQ A;  5B4W A;  3VI3 A;  4XYH A;  4O9D A;  1L0Q A;  2EIC A;  1VZ2 A;  1OLZ A;  1Q47 A;  3IUR A;  1SHY B;  3OF7 A;  4OWR A;  4D0K A;  5HE2 B;  1E8N A;  3GC3 B;  3MUN A;  4X63 B;  1JOF A;  3PVU B;  4ES0 A;  4E54 A;  2IUR A;  4J8B A;  3IUN A;  3ZDZ A;  2IWK A;  2AQ5 A;  1UTC A;  5IJ8 E;  3DXK C;  4RE5 A;  4CI2 A;  2Z2O A;  4FA5 D;  3SVW D;  5HE1 B;  3V7D B;  3I7N A;  4FHL A;  3V5W B;  1L5G A;  1UOO A;  2VDR A;  3VI4 A;  3QHY B;  4CY1 A;  4X3E A;  4JXM A;  2W18 A;  3ZWL B;  2VDO A;  4NEN A;  3OKY B;  2GNQ A;  2XYI A; 
#chains in the Genus database with same CATH homology
 2VDK A;  3NIF A;  5FFG A;  3NIG A;  5E6S A;  5HDB A;  1M1X A;  1JV2 A;  3V4P A;  2VDQ A;  2VC2 A;  3ZDZ A;  4G1E A;  4UM8 A;  3NID A;  4WK2 A;  3T3M A;  3ZDX A;  3K72 A;  3K6S A;  4WK4 A;  5FFO A;  2VDN A;  5E6R A;  4MMZ A;  4WK0 A;  2VDL A;  3T3P A;  4MMX A;  3ZE2 A;  4G1M A;  4Z7O A;  2VDP A;  5E6U A;  1L5G A;  4WJK A;  3ZE1 A;  3K71 A;  3IJE A;  2VDR A;  3VI4 A;  3VI3 A;  2VDM A;  4MMY A;  3ZDY A;  3FCS A;  4Z7N A;  1U8C A;  4O02 A;  1TYE A;  3ZE0 A;  2VDO A;  3FCU A;  4IRZ A;  4NEN A;  4UM9 A;  4Z7Q A;  3V4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...