2VDPA

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
452
structure length
452
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 107
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdpA00
4O02A 4WK0A 3NIGA 3ZE1A 4Z7OA 2VDNA 1L5GA 5FFOA 3IJEA 3FCUA 3T3PA 3ZDYA 2VC2A 4WK4A 1TYEA 4MMYA 3ZDXA 3VI3A 5E6SA 3ZE0A 4G1EA 3V4VA 2VDMA 4UM9A 5FFGA 2VDPA 3K72A 4IRZA 2VDQA 4Z7NA 3V4PA 2VDKA 4WK2A 1JV2A 4UM8A 3NIDA 3ZE2A 4G1MA 4MMZA 3K71A 3NIFA 1M1XA 4MMXA 5E6UA 3ZDZA 2VDOA 4WJKA 2VDLA 5E6RA 5HDBA 3K6SA 3FCSA 3T3MA 4NENA 1U8CA 2VDRA 3VI4A 4Z7QA
chains in the Genus database with same CATH superfamily
5CXBA 5M61A 2QC5A 5HE2B 4O3TB 3O4GA 5EMJB 4BCDA 1GOHA 4JSXC 2I3TA 3MVDK 1C9LA 5SXMA 3MKQA 2IAAA 4K3JB 4BP8A 3DXKC 4KFMB 3AFCA 4HDJA 3CFVA 4FA5D 1A0RB 3FCSA 3C9CA 4O9DA 2HJ4A 3SJLD 3IUJA 4J87A 4YVDA 2VDNA 3EG6A 3N0DA 4E5ZA 4D0KA 3OKYB 1O6FA 1UOPA 3EQ7A 3EI3A 3V9FA 2AGLA 4CC9A 2P9LC 1TYQC 3VGZA 2JKXA 3PXTD 2VDPA 2I0RA 3K72A 5KDOB 4U1EI 4A11B 2QZPA 3GC3B 2H9PA 3OTTA 3EI1B 4O1QD 3ODTA 3EMHA 3PXSD 2PM7B 5FQDA 5E6UA 2YNPA 3NVQA 1ERJA 4PNKB 5HDBA 1UOQA 2CN3A 3T3MA 1B9XA 3UKRC 2CO0A 4WK0A 3P4FA 3PSCB 3FGBA 3IJEA 1QFSA 4H5IA 1GOTB 5FKTA 5EMMB 3MZKA 5I5JA 4A0BB 3IURA 5FXYA 5IT9g 4CI3A 3C75H 5H14A 5M5UA 4JXMA 1R5MA 3AL8B 2IUQA 3NIDA 4L1MA 3FM0A 4LG9A 3IJCA 2PBIB 3J80g 2P9UC 4O45A 3AH8B 4XEIC 3EU7A 2J57G 4X61B 4O2WA 3EWEA 1JTDB 4Z7OA 4BUJC 1Q47A 3GD1I 2P9KC 1E5TA 4E54B 1PEVA 3VI3A 1TBGA 5C86A 2YMUA 4J8GA 1UOOA 2IWKA 5CYKA 4BL0A 3IULA 1B9YA 1GOFA 5TEEA 4QT8A 4L3HD 2H9LA 4GGCA 1M1XA 3ZDZA 1SQJA 4D6VA 2VZ1A 3ZE1A 3U4YA 2YNNA 3T3PA 4FB1D 3IUMA 3OL2A 4CY1A 5C2VB 3SVWD 2IWFA 3DXMC 1E8MA 1T2XA 4ESGA 5IC7A 2QXVA 5M5SA 2H6QA 3V4VA 2AGYA 4LG8A 4D9SA 1PI6A 3DDUA 5IJ7E 4Y5RD 1H2XA 1VZ2A 3SN6B 5AFU3 4AOWA 1VZ3A 3NIFA 4FWWA 4AN0A 3OKWA 2VDOA 4EWRA 3QHYB 4A09A 3IVMA 4RE6A 1OLZA 2EICA 2H9MA 5GSAA 2GC7A 3C99A 1JMZB 3JB9L 3ZDXA 2EIEA 2YB8B 4CI2A 3MKSB 5FKQA 3OKTA 3SMRA 1O6GA 3QI0A 1VE7A 4J77A 5IJ8E 4Z7NA 4J0XA 1GP2B 3KRXB 1XIPA 4MMZA 1RI6A 5M5RA 3V7DB 4O3UB 3F3FA 2PM9A 4J73A 5CXCB 5B4WA 1UTCA 3ZWLB 1XKSA 3NIGA 2H68A 4ZN4A 5HQGA 2VC2A 4ERQA 4A08B 4QAMA 5TDHB 1H2ZA 3ZE0A 5E6SA 3MUNA 2HYEA 5EM2B 4JSVC 2B5LA 4UI9R 4N14A 3JAMg 3PXWD 1FWXA 3K26A 5CXBB 5EAMA 3MXXA 1JV2A 3EI2A 2XU7A 3UVMA 1P22A 4G1MA 4J84A 2O9KA 1VYHC 2OJYA 4ERZA 1GG2B 3V5WB 4DNWA 5GXIA 3JZHA 3BG0A 4CI1A 3EI4A 2W18A 1MDAH 3I2NA 3N0EA 4I79A 2I0SA 2P9NC 2PM6B 3MMYA 5HE0B 4GGDA 4IRZA 4FA1D 2OK6A 3EQ9A 4XYHA 1K3IA 4E5ZB 4CY2A 2BKLA 2G9AA 4AEZA 3K71A 4MMXA 3EI3B 4ERYA 4ZOVA 3K6SA 4J78A 2AQ5A 2VDRA 2Q7QA 3VI4A 3KCIA 3ULEC 3NVXA 4GMBA 1JOFA 3J81g 3I7NA 3F3PA 3VH0A 4GQ1A 5I5MA 5C9ZB 4G1EA 2EIBA 5JWZA 1QNIA 3IUQA 2H6NA 4UM9A 4CY5A 3UVOA 1K32A 3UR4A 3I8CA 1S4UX 4FHLA 4U7AA 4A0AA 3B7FA 3JRPA 4CI8A 5HE1B 2XDWA 4AMZA 3A0FA 4X3EA 5A2Qg 3RLMD 4ES0A 3RN1D 3BWSA 3GFCA 3OW8A 4FAVD 2G99A 3JZNA 1SHYB 4IA9A 4PSXB 5FFOA 4PBYA 3SLED 4R7AB 4CY3A 2P9PC 3W15A 2WQ8A 3SCYA 2HXCA 4OZUA 4Z8LA 1I2MB 5HE3B 2B4EA 4RE5A 3RN0D 5K19A 4GM8A 2OIZA 5GXHA 1YR2A 4CZVA 4J82A 4CZXA 2AGZA 5EARA 3JPXA 5E6RA 3DWLC 5AMSA 3PE7A 5CYKB 2XL3A 4BCBA 1U8CA 4JT5C 4DNUA 2BBKH 5AJAA 5FKSA 4QQEA 3FCUA 3FRXA 3SXTD 3I7PA 3SBQA 5EAPA 3UVLA 3I8EA 2YNOA 3V4PA 2H13A 3OL2B 2EIDA 5H1MA 4GGAA 3IIWA 3JROA 3OKYA 2VZ3A 4QRJA 1GXRA 3C5MA 3CIKB 3AL9A 4Y7RA 3UVNA 1K8KC 1PGUA 2H14A 3O4IA 4J8BA 4O02A 3DM0A 4A11A 1VE6A 4CZYA 1TYEA 3L4MD 3EI1A 3SBPA 3HFQA 4G56B 4MMYA 4AMYA 4JHNA 5FLXg 4A09B 2HKMA 4QL1A 5IGOA 2P9IC 2CN2A 2VDQA 3DSMA 4JT6C 2XYIA 2B5MA 3GREA 4UM8A 2OVQB 5H17A 2GNQA 2UZYB 4JHPC 4PC0A 4A2MA 1BPOA 3PSLA 3I7OA 4OWRA 3UVKA 3K27A 3PVUB 4A0BA 4GM3A 3RFGA 4GQBB 5C2WB 3ZDYA 5EMLB 3AL8A 4WK4A 4G55A 1N6FA 2H47A 2PM9B 1MG3A 3RRMC 5FFGA 3SWSD 3O4JA 2MTAH 2OK4A 1L0QA 1H2YA 2VDKA 4NC4A 1U2VC 4FAND 3ZE2A 5IGQA 3MUOA 4E54A 2CE8A 1JMXB 4ZOZA 3IJ0A 4ZOYA 3BG1A 4AX4A 3RFHA 1N6DA 2CNXA 2H9NA 4NENA 5M5TA 2OVRB 3JZGA 1A12A 3EI2B 3SBRA 2HU8A 3IJ1A 4PBZA 3E0CA 1XHMA 3I7KA 1PBYB 1QFMA 4L1QD 3I7LA 3PVWB 4MK0B 4BCCA 4J79A 5HYNB 2IURA 2CE9A 2Z2NA 2Z2PA 3MZLA 4BH6A 4WK2A 4IMMA 5FKRA 5TF2A 3EI4B 2HKRA 3ORVD 4J86A 2XE4A 5C92A 2AH0A 4BP9A 1NEXB 3RMZD 2YBAA 1H2WA 4FA9D 4DNVA 4GZ8A 4J0WA 1SQ9A 5GMKn 2IUPA 3IUNA 1GOGA 4ZOXA 5K1CC 4TZ4A 2XZGA 5EMKB 1NR0A 4A2LA 1YFQA 4LGNA 4X63B 2GC4A 2HESX 4XYIA 4A7JA 3O4HA 4NAAA 2P9SC 3I7HA 2XL2A 4FA4D 2B5NA 4JSPC 1C9IA 2I0TA 3I89A 3L4OD 2BCJB 4NSXA 2HU7A 2AGXA 3UKUC 5I5IA 4WJKA 1U4CA 2VDLA 3RSEC 3NVNA 4J81A 2QR5A 2AGWA 5EALA 2Z2OA 2CO0C 4Z7QA 4A0AB 5TEFA 2TRCB 1L5GA 2H6KA 5M5VA 5THAA 3CFSB 1MG2A 2HJBA 2VDMA 1JJUB 2IUVA 3KRWB 4JSNC 4JD2C 4L9OA 1OMWB 5CXCA 5FA5B 2EBSA 2OVPB 2UZXB 4L3GD 3SHFA 3SFZA 4GM9A 1E8NA 2I3SA 3F3GA 3IIYA 2J55H 4H5JA 4PSWB 2H3XA 3IKOA 2HU5A 4NBMA 4A08A 2AH1A 3VA6A 4K3ID 2J56H 4AN1A 4GQ2P 5EM2A 3EQ8A 1N6EA 3OF7A 4PXWA 4X60B
chains in the Genus database with same CATH topology
4O02A 4WK0A 3NIGA 3ZE1A 4Z7OA 2VDNA 1L5GA 5FFOA 3IJEA 3FCUA 3T3PA 3ZDYA 2VC2A 4WK4A 1TYEA 4MMYA 3ZDXA 3VI3A 5E6SA 3ZE0A 4G1EA 3V4VA 2VDMA 4UM9A 5FFGA 2VDPA 3K72A 4IRZA 2VDQA 4Z7NA 3V4PA 2VDKA 4WK2A 1JV2A 4UM8A 3NIDA 3ZE2A 4G1MA 4MMZA 3K71A 3NIFA 1M1XA 4MMXA 5E6UA 3ZDZA 2VDOA 4WJKA 2VDLA 5E6RA 5HDBA 3K6SA 3FCSA 3T3MA 4NENA 1U8CA 2VDRA 3VI4A 4Z7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O02 A;  4WK0 A;  3NIG A;  3ZE1 A;  4Z7O A;  2VDN A;  1L5G A;  5FFO A;  3IJE A;  3FCU A;  3T3P A;  3ZDY A;  2VC2 A;  4WK4 A;  1TYE A;  4MMY A;  3ZDX A;  3VI3 A;  5E6S A;  3ZE0 A;  4G1E A;  3V4V A;  2VDM A;  4UM9 A;  5FFG A;  2VDP A;  3K72 A;  4IRZ A;  2VDQ A;  4Z7N A;  3V4P A;  2VDK A;  4WK2 A;  1JV2 A;  4UM8 A;  3NID A;  3ZE2 A;  4G1M A;  4MMZ A;  3K71 A;  3NIF A;  1M1X A;  4MMX A;  5E6U A;  3ZDZ A;  2VDO A;  4WJK A;  2VDL A;  5E6R A;  5HDB A;  3K6S A;  3FCS A;  3T3M A;  4NEN A;  1U8C A;  2VDR A;  3VI4 A;  4Z7Q A; 
#chains in the Genus database with same CATH topology
 5CXB A;  5M61 A;  2QC5 A;  5HE2 B;  4O3T B;  3O4G A;  5EMJ B;  4BCD A;  1GOH A;  4JSX C;  2I3T A;  3MVD K;  1C9L A;  5SXM A;  3MKQ A;  2IAA A;  4K3J B;  4BP8 A;  3DXK C;  4KFM B;  3AFC A;  4HDJ A;  3CFV A;  4FA5 D;  1A0R B;  3FCS A;  3C9C A;  4O9D A;  2HJ4 A;  3SJL D;  3IUJ A;  4J87 A;  4YVD A;  2VDN A;  3EG6 A;  3N0D A;  4E5Z A;  4D0K A;  3OKY B;  1O6F A;  1UOP A;  3EQ7 A;  3EI3 A;  3V9F A;  2AGL A;  4CC9 A;  2P9L C;  1TYQ C;  3VGZ A;  2JKX A;  3PXT D;  2VDP A;  2I0R A;  3K72 A;  5KDO B;  4U1E I;  4A11 B;  2QZP A;  3GC3 B;  2H9P A;  3OTT A;  3EI1 B;  4O1Q D;  3ODT A;  3EMH A;  3PXS D;  2PM7 B;  5FQD A;  5E6U A;  2YNP A;  3NVQ A;  1ERJ A;  4PNK B;  5HDB A;  1UOQ A;  2CN3 A;  3T3M A;  1B9X A;  3UKR C;  2CO0 A;  4WK0 A;  3P4F A;  3PSC B;  3FGB A;  3IJE A;  1QFS A;  4H5I A;  1GOT B;  5FKT A;  5EMM B;  3MZK A;  5I5J A;  4A0B B;  3IUR A;  5FXY A;  5IT9 g;  4CI3 A;  3C75 H;  5H14 A;  5M5U A;  4JXM A;  1R5M A;  3AL8 B;  2IUQ A;  3NID A;  4L1M A;  3FM0 A;  4LG9 A;  3IJC A;  2PBI B;  3J80 g;  2P9U C;  4O45 A;  3AH8 B;  4XEI C;  3EU7 A;  2J57 G;  4X61 B;  4O2W A;  3EWE A;  1JTD B;  4Z7O A;  4BUJ C;  1Q47 A;  3GD1 I;  2P9K C;  1E5T A;  4E54 B;  1PEV A;  3VI3 A;  1TBG A;  5C86 A;  2YMU A;  4J8G A;  1UOO A;  2IWK A;  5CYK A;  4BL0 A;  3IUL A;  1B9Y A;  1GOF A;  5TEE A;  4QT8 A;  4L3H D;  2H9L A;  4GGC A;  1M1X A;  3ZDZ A;  1SQJ A;  4D6V A;  2VZ1 A;  3ZE1 A;  3U4Y A;  2YNN A;  3T3P A;  4FB1 D;  3IUM A;  3OL2 A;  4CY1 A;  5C2V B;  3SVW D;  2IWF A;  3DXM C;  1E8M A;  1T2X A;  4ESG A;  5IC7 A;  2QXV A;  5M5S A;  2H6Q A;  3V4V A;  2AGY A;  4LG8 A;  4D9S A;  1PI6 A;  3DDU A;  5IJ7 E;  4Y5R D;  1H2X A;  1VZ2 A;  3SN6 B;  5AFU 3;  4AOW A;  1VZ3 A;  3NIF A;  4FWW A;  4AN0 A;  3OKW A;  2VDO A;  4EWR A;  3QHY B;  4A09 A;  3IVM A;  4RE6 A;  1OLZ A;  2EIC A;  2H9M A;  5GSA A;  2GC7 A;  3C99 A;  1JMZ B;  3JB9 L;  3ZDX A;  2EIE A;  2YB8 B;  4CI2 A;  3MKS B;  5FKQ A;  3OKT A;  3SMR A;  1O6G A;  3QI0 A;  1VE7 A;  4J77 A;  5IJ8 E;  4Z7N A;  4J0X A;  1GP2 B;  3KRX B;  1XIP A;  4MMZ A;  1RI6 A;  5M5R A;  3V7D B;  4O3U B;  3F3F A;  2PM9 A;  4J73 A;  5CXC B;  5B4W A;  1UTC A;  3ZWL B;  1XKS A;  3NIG A;  2H68 A;  4ZN4 A;  5HQG A;  2VC2 A;  4ERQ A;  4A08 B;  4QAM A;  5TDH B;  1H2Z A;  3ZE0 A;  5E6S A;  3MUN A;  2HYE A;  5EM2 B;  4JSV C;  2B5L A;  4UI9 R;  4N14 A;  3JAM g;  3PXW D;  1FWX A;  3K26 A;  5CXB B;  5EAM A;  3MXX A;  1JV2 A;  3EI2 A;  2XU7 A;  3UVM A;  1P22 A;  4G1M A;  4J84 A;  2O9K A;  1VYH C;  2OJY A;  4ERZ A;  1GG2 B;  3V5W B;  4DNW A;  5GXI A;  3JZH A;  3BG0 A;  4CI1 A;  3EI4 A;  2W18 A;  1MDA H;  3I2N A;  3N0E A;  4I79 A;  2I0S A;  2P9N C;  2PM6 B;  3MMY A;  5HE0 B;  4GGD A;  4IRZ A;  4FA1 D;  2OK6 A;  3EQ9 A;  4XYH A;  1K3I A;  4E5Z B;  4CY2 A;  2BKL A;  2G9A A;  4AEZ A;  3K71 A;  4MMX A;  3EI3 B;  4ERY A;  4ZOV A;  3K6S A;  4J78 A;  2AQ5 A;  2VDR A;  2Q7Q A;  3VI4 A;  3KCI A;  3ULE C;  3NVX A;  4GMB A;  1JOF A;  3J81 g;  3I7N A;  3F3P A;  3VH0 A;  4GQ1 A;  5I5M A;  5C9Z B;  4G1E A;  2EIB A;  5JWZ A;  1QNI A;  3IUQ A;  2H6N A;  4UM9 A;  4CY5 A;  3UVO A;  1K32 A;  3UR4 A;  3I8C A;  1S4U X;  4FHL A;  4U7A A;  4A0A A;  3B7F A;  3JRP A;  4CI8 A;  5HE1 B;  2XDW A;  4AMZ A;  3A0F A;  4X3E A;  5A2Q g;  3RLM D;  4ES0 A;  3RN1 D;  3BWS A;  3GFC A;  3OW8 A;  4FAV D;  2G99 A;  3JZN A;  1SHY B;  4IA9 A;  4PSX B;  5FFO A;  4PBY A;  3SLE D;  4R7A B;  4CY3 A;  2P9P C;  3W15 A;  2WQ8 A;  3SCY A;  2HXC A;  4OZU A;  4Z8L A;  1I2M B;  5HE3 B;  2B4E A;  4RE5 A;  3RN0 D;  5K19 A;  4GM8 A;  2OIZ A;  5GXH A;  1YR2 A;  4CZV A;  4J82 A;  4CZX A;  2AGZ A;  5EAR A;  3JPX A;  5E6R A;  3DWL C;  5AMS A;  3PE7 A;  5CYK B;  2XL3 A;  4BCB A;  1U8C A;  4JT5 C;  4DNU A;  2BBK H;  5AJA A;  5FKS A;  4QQE A;  3FCU A;  3FRX A;  3SXT D;  3I7P A;  3SBQ A;  5EAP A;  3UVL A;  3I8E A;  2YNO A;  3V4P A;  2H13 A;  3OL2 B;  2EID A;  5H1M A;  4GGA A;  3IIW A;  3JRO A;  3OKY A;  2VZ3 A;  4QRJ A;  1GXR A;  3C5M A;  3CIK B;  3AL9 A;  4Y7R A;  3UVN A;  1K8K C;  1PGU A;  2H14 A;  3O4I A;  4J8B A;  4O02 A;  3DM0 A;  4A11 A;  1VE6 A;  4CZY A;  1TYE A;  3L4M D;  3EI1 A;  3SBP A;  3HFQ A;  4G56 B;  4MMY A;  4AMY A;  4JHN A;  5FLX g;  4A09 B;  2HKM A;  4QL1 A;  5IGO A;  2P9I C;  2CN2 A;  2VDQ A;  3DSM A;  4JT6 C;  2XYI A;  2B5M A;  3GRE A;  4UM8 A;  2OVQ B;  5H17 A;  2GNQ A;  2UZY B;  4JHP C;  4PC0 A;  4A2M A;  1BPO A;  3PSL A;  3I7O A;  4OWR A;  3UVK A;  3K27 A;  3PVU B;  4A0B A;  4GM3 A;  3RFG A;  4GQB B;  5C2W B;  3ZDY A;  5EML B;  3AL8 A;  4WK4 A;  4G55 A;  1N6F A;  2H47 A;  2PM9 B;  1MG3 A;  3RRM C;  5FFG A;  3SWS D;  3O4J A;  2MTA H;  2OK4 A;  1L0Q A;  1H2Y A;  2VDK A;  4NC4 A;  1U2V C;  4FAN D;  3ZE2 A;  5IGQ A;  3MUO A;  4E54 A;  2CE8 A;  1JMX B;  4ZOZ A;  3IJ0 A;  4ZOY A;  3BG1 A;  4AX4 A;  3RFH A;  1N6D A;  2CNX A;  2H9N A;  4NEN A;  5M5T A;  2OVR B;  3JZG A;  1A12 A;  3EI2 B;  3SBR A;  2HU8 A;  3IJ1 A;  4PBZ A;  3E0C A;  1XHM A;  3I7K A;  1PBY B;  1QFM A;  4L1Q D;  3I7L A;  3PVW B;  4MK0 B;  4BCC A;  4J79 A;  5HYN B;  2IUR A;  2CE9 A;  2Z2N A;  2Z2P A;  3MZL A;  4BH6 A;  4WK2 A;  4IMM A;  5FKR A;  5TF2 A;  3EI4 B;  2HKR A;  3ORV D;  4J86 A;  2XE4 A;  5C92 A;  2AH0 A;  4BP9 A;  1NEX B;  3RMZ D;  2YBA A;  1H2W A;  4FA9 D;  4DNV A;  4GZ8 A;  4J0W A;  1SQ9 A;  5GMK n;  2IUP A;  3IUN A;  1GOG A;  4ZOX A;  5K1C C;  4TZ4 A;  2XZG A;  5EMK B;  1NR0 A;  4A2L A;  1YFQ A;  4LGN A;  4X63 B;  2GC4 A;  2HES X;  4XYI A;  4A7J A;  3O4H A;  4NAA A;  2P9S C;  3I7H A;  2XL2 A;  4FA4 D;  2B5N A;  4JSP C;  1C9I A;  2I0T A;  3I89 A;  3L4O D;  2BCJ B;  4NSX A;  2HU7 A;  2AGX A;  3UKU C;  5I5I A;  4WJK A;  1U4C A;  2VDL A;  3RSE C;  3NVN A;  4J81 A;  2QR5 A;  2AGW A;  5EAL A;  2Z2O A;  2CO0 C;  4Z7Q A;  4A0A B;  5TEF A;  2TRC B;  1L5G A;  2H6K A;  5M5V A;  5THA A;  3CFS B;  1MG2 A;  2HJB A;  2VDM A;  1JJU B;  2IUV A;  3KRW B;  4JSN C;  4JD2 C;  4L9O A;  1OMW B;  5CXC A;  5FA5 B;  2EBS A;  2OVP B;  2UZX B;  4L3G D;  3SHF A;  3SFZ A;  4GM9 A;  1E8N A;  2I3S A;  3F3G A;  3IIY A;  2J55 H;  4H5J A;  4PSW B;  2H3X A;  3IKO A;  2HU5 A;  4NBM A;  4A08 A;  2AH1 A;  3VA6 A;  4K3I D;  2J56 H;  4AN1 A;  4GQ2 P;  5EM2 A;  3EQ8 A;  1N6E A;  3OF7 A;  4PXW A;  4X60 B; 
#chains in the Genus database with same CATH homology
 4O02 A;  4WK0 A;  3NIG A;  3ZE1 A;  4Z7O A;  2VDN A;  1L5G A;  5FFO A;  3IJE A;  3FCU A;  3T3P A;  3ZDY A;  2VC2 A;  4WK4 A;  1TYE A;  4MMY A;  3ZDX A;  3VI3 A;  5E6S A;  3ZE0 A;  4G1E A;  3V4V A;  2VDM A;  4UM9 A;  5FFG A;  2VDP A;  3K72 A;  4IRZ A;  2VDQ A;  4Z7N A;  3V4P A;  2VDK A;  4WK2 A;  1JV2 A;  4UM8 A;  3NID A;  3ZE2 A;  4G1M A;  4MMZ A;  3K71 A;  3NIF A;  1M1X A;  4MMX A;  5E6U A;  3ZDZ A;  2VDO A;  4WJK A;  2VDL A;  5E6R A;  5HDB A;  3K6S A;  3FCS A;  3T3M A;  4NEN A;  1U8C A;  2VDR A;  3VI4 A;  4Z7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...