2VDPA

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdpA00
4MMXA 3V4PA 3ZDYA 1L5GA 5E6RA 3IJEA 4MMYA 4MMZA 3FCUA 4WK0A 3ZE0A 2VDKA 3K6SA 3VI4A 4G1MA 5E6SA 3T3PA 4Z7OA 3ZDZA 3VI3A 5FFOA 3ZDXA 2VDPA 3FCSA 4WK2A 3V4VA 4UM9A 1U8CA 3NIGA 3NIFA 2VDLA 2VC2A 4IRZA 3K71A 2VDMA 2VDQA 4Z7NA 3NIDA 4Z7QA 5E6UA 3T3MA 4G1EA 1JV2A 2VDRA 3K72A 3ZE1A 3ZE2A 5HDBA 4WJKA 4UM8A 1TYEA 2VDNA 4O02A 2VDOA 5FFGA 4WK4A 4NENA 1M1XA
chains in the Genus database with same CATH superfamily
3JB9L 2Z2PA 5HE2B 4QL1A 2BCJB 1GOFA 4PSXB 4BUJC 1GOGA 4U7AA 2TRCB 4G1MA 2QR5A 4Z7OA 4ERYA 2QZPA 5TDHB 3I7OA 2W18A 4LG9A 5FQDA 3MVDK 3OKYA 4UM9A 1VZ3A 3UVKA 4CC9A 1NR0A 2VDLA 4QAMA 2CE9A 1YFQA 2HKMA 5EMJB 3NIDA 4GZ8A 4G1EA 4D0KA 3ZWLB 4NSXA 3ZE2A 5C92A 2PBIB 1NEXB 5H17A 2AGXA 3SJLD 4J73A 4CZXA 5IT9g 1L5GA 4R7AB 5FA5B 4J0WA 4QRJA 3VI4A 3OTTA 4AOWA 3IKOA 4IA9A 5FLXg 2B5LA 4K3JB 2UZXB 5EMKB 4Z7NA 4AMZA 4Z7QA 2IURA 3SBPA 4NAAA 3T3MA 3RN0D 5C2WB 3EG6A 1U4CA 3IULA 3K27A 2PM7B 4A11B 3SFZA 1I2MB 4JHNA 3RLMD 4XYHA 3OKWA 3V5WB 2AH1A 1L0QA 2P9LC 4KFMB 4G55A 2I0RA 2IWFA 3EWEA 1TYQC 4A0BB 3ZDZA 4L9OA 5FFOA 3O4IA 5HE0B 2HJ4A 2HXCA 3PSCB 5IJ8E 1U2VC 2WQ8A 3OKTA 4FA1D 1SQ9A 5THAA 4IRZA 3K71A 2P9SC 4FAVD 4XYIA 3RSEC 2CE8A 3P4FA 3PXSD 4A2MA 3AL8A 2JKXA 2YNPA 3JAMg 4ZOXA 3OW8A 5B4WA 1A0RB 5EALA 2XE4A 1VYHC 4FA4D 4GGAA 1SQJA 1PEVA 2P9IC 3I7NA 4GQ2P 4E54A 2YNNA 5E6SA 2Q7QA 4GMBA 3EMHA 2IAAA 4J8BA 2BBKH 5HE3B 2J55H 2YBAA 4DNWA 4GGDA 3DWLC 2BKLA 3OL2A 4O9DA 3SXTD 5GXIA 2HESX 3FRXA 4L1MA 1BPOA 1GOTB 2GC4A 1FWXA 1O6FA 3QI0A 2VDOA 1K32A 3GC3B 3C5MA 5K19A 1N6FA 4ERZA 2HU7A 2H6QA 4GM9A 4JXMA 4IMMA 3AH8B 3CFSB 3IIWA 2AH0A 3PE7A 4PXWA 1K3IA 2EIEA 3SWSD 2J56H 1N6EA 2AGZA 2B5NA 5FKQA 5M5UA 5GMKn 2PM9A 3NVNA 2I3SA 2HYEA 2EIBA 5E6UA 2G99A 3UVOA 4AEZA 1VE6A 3EI3B 4BH6A 4FA9D 3PXWD 3DSMA 5FKSA 3O4HA 4FHLA 3RFGA 3UVNA 3GD1I 3IUMA 3EI2B 5EM2B 1QFMA 5CYKA 2CN3A 2I0TA 3VGZA 3EI1A 4E5ZB 3DDUA 3PSLA 2YMUA 5C9ZB 3GFCA 5CXBA 3I7HA 1E8MA 1UTCA 1H2YA 2GNQA 4O45A 4A09A 4MK0B 4UM8A 4WK4A 4H5IA 4MMXA 3KRXB 4D6VA 3BWSA 5EMMB 1R5MA 2EICA 3OKYB 3MMYA 3U4YA 3FCUA 4QQEA 2VDKA 3F3GA 3T3PA 4LG8A 4ZN4A 5I5IA 3VI3A 1GG2B 4QT8A 2H9LA 1JTDB 3FCSA 1E5TA 1B9XA 3V4VA 4BCCA 3NIGA 2OVRB 3MUOA 5H1MA 5K1CC 3I89A 2VDMA 5EARA 2YB8B 4A0AA 1MDAH 2OK6A 2I0SA 4Y5RD 2H13A 2B5MA 4O02A 5AFU3 1M1XA 2HKRA 5JWZA 3AL9A 5SXMA 4AN1A 2IWKA 4J86A 3DXKC 5E6RA 3JZHA 5FKRA 3KCIA 3ZE0A 2P9NC 4FAND 2OIZA 3UVLA 5EAMA 1XIPA 3K26A 2O9KA 5I5JA 1C9LA 2Z2OA 3EI4A 3UKRC 4OWRA 3ULEC 4CI8A 1A12A 2VC2A 4J79A 2XYIA 3IJ0A 3CIKB 3I8CA 4PNKB 4PSWB 4JSXC 2AQ5A 4WK2A 2XL3A 1OLZA 5HE1B 4XEIC 4Y7RA 1PBYB 2H9NA 4YVDA 4AN0A 3JPXA 4ZOVA 4CZYA 1H2ZA 2HU8A 4FA5D 2IUPA 5AJAA 3MZKA 1JMZB 1PI6A 1TBGA 4J78A 4RE5A 4CI2A 5M5SA 4X63B 4AMYA 5A2Qg 2MTAH 3ODTA 2AGYA 2XL2A 3O4JA 3HFQA 3QHYB 4ES0A 5HYNB 4N14A 3AL8B 4CY3A 2XZGA 3NIFA 5IGQA 2OVQB 3EQ9A 4OZUA 5H14A 5IC7A 4FWWA 3B7FA 3IURA 5HQGA 1O6GA 2Z2NA 1JMXB 5HDBA 3SBRA 5GSAA 1S4UX 2EBSA 4JD2C 3L4OD 4JSNC 5IJ7E 4E54B 1GP2B 3UR4A 2UZYB 3JROA 3SBQA 4PBZA 3IJEA 4PC0A 1P22A 3JZGA 2H68A 1VE7A 1GOHA 2CO0A 3VH0A 2QXVA 3VA6A 3OL2B 3C75H 3C99A 4J82A 3JZNA 4A08A 2IUQA 1N6DA 4AX4A 5AMSA 2HJBA 1MG3A 2B4EA 1PGUA 4O3TB 1VZ2A 1XHMA 2VZ3A 3DXMC 3IUJA 4J0XA 5CXCA 1C9IA 3IUQA 4U1EI 4DNUA 2EIDA 3O4GA 4JT6C 3ZDYA 3IJ1A 3V4PA 2P9UC 4GQBB 3JRPA 3I7PA 4MMYA 3DM0A 3EU7A 2PM9B 3AFCA 4L3GD 3MZLA 1B9YA 3MKSB 2G9AA 2OVPB 3KRWB 2H6KA 2VDQA 4JT5C 4O2WA 2QC5A 4L3HD 4BL0A 2H6NA 1UOOA 3ZE1A 5CYKB 4X61B 3EI1B 3F3PA 1YR2A 3J80g 3SLED 3K6SA 3EQ7A 5CXBB 4L1QD 2H14A 4X3EA 5EAPA 3NVQA 4A2LA 2CN2A 4Z8LA 4A09B 1U8CA 1QNIA 4BP9A 5FKTA 5GXHA 2VZ1A 3SMRA 3NVXA 2P9PC 5EMLB 3A0FA 3OF7A 3K72A 1JJUB 5M5VA 1K8KC 3UKUC 4CY1A 3V9FA 4CZVA 2GC7A 5TEEA 3SCYA 4ZOZA 4CI3A 2J57G 4A11A 1H2WA 2H47A 5I5MA 1ERJA 4J8GA 4A0AB 3IJCA 4ESGA 3L4MD 3ORVD 1T2XA 4GM3A 1E8NA 1Q47A 2HU5A 3EQ8A 4A0BA 4BCBA 3RRMC 1JV2A 3I7LA 3F3FA 3SN6B 4EWRA 4H5JA 5M5RA 2VDNA 4J84A 2OJYA 1SHYB 4NENA 5C86A 3MXXA 1RI6A 3EI4B 4JHPC 4JSVC 2P9KC 2XU7A 4O1QD 2H9PA 5TEFA 4BP8A 3PVUB 4RE6A 4GM8A 4G56B 1GXRA 5M61A 3N0DA 5M5TA 3N0EA 3BG0A 1OMWB 3RFHA 3IUNA 1UOQA 3I7KA 2VDRA 5FXYA 3V7DB 3FM0A 3C9CA 4D9SA 3SHFA 4ZOYA 3I8EA 5C2VB 4DNVA 4WJKA 2PM6B 4PBYA 2CNXA 3SVWD 1MG2A 4JSPC 3MKQA 1UOPA 2I3TA 4NBMA 3RMZD 3E0CA 4J87A 5KDOB 4CY5A 4CI1A 4I79A 2H9MA 2VDPA 3PXTD 5TF2A 4K3ID 3J81g 3MUNA 4FB1D 2IUVA 4CY2A 3RN1D 4NC4A 1XKSA 3IVMA 5IGOA 3PVWB 3BG1A 2OK4A 2CO0C 4BCDA 2YNOA 4GGCA 4A08B 1H2XA 1QFSA 4MMZA 4ERQA 3I2NA 3EI3A 3IIYA 3FGBA 4TZ4A 1JOFA 4HDJA 3ZDXA 3W15A 4X60B 2AGLA 3EI2A 3GREA 5EM2A 5CXCB 2AGWA 4J77A 2XDWA 4J81A 4E5ZA 4A7JA 4UI9R 4O3UB 4LGNA 1TYEA 2H3XA 4WK0A 3CFVA 5FFGA 3UVMA 4GQ1A
chains in the Genus database with same CATH topology
4MMXA 3V4PA 3ZDYA 1L5GA 5E6RA 3IJEA 4MMYA 4MMZA 3FCUA 4WK0A 3ZE0A 2VDKA 3K6SA 3VI4A 4G1MA 5E6SA 3T3PA 4Z7OA 3ZDZA 3VI3A 5FFOA 3ZDXA 2VDPA 3FCSA 4WK2A 3V4VA 4UM9A 1U8CA 3NIGA 3NIFA 2VDLA 2VC2A 4IRZA 3K71A 2VDMA 2VDQA 4Z7NA 3NIDA 4Z7QA 5E6UA 3T3MA 4G1EA 1JV2A 2VDRA 3K72A 3ZE1A 3ZE2A 5HDBA 4WJKA 4UM8A 1TYEA 2VDNA 4O02A 2VDOA 5FFGA 4WK4A 4NENA 1M1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMX A;  3V4P A;  3ZDY A;  1L5G A;  5E6R A;  3IJE A;  4MMY A;  4MMZ A;  3FCU A;  4WK0 A;  3ZE0 A;  2VDK A;  3K6S A;  3VI4 A;  4G1M A;  5E6S A;  3T3P A;  4Z7O A;  3ZDZ A;  3VI3 A;  5FFO A;  3ZDX A;  2VDP A;  3FCS A;  4WK2 A;  3V4V A;  4UM9 A;  1U8C A;  3NIG A;  3NIF A;  2VDL A;  2VC2 A;  4IRZ A;  3K71 A;  2VDM A;  2VDQ A;  4Z7N A;  3NID A;  4Z7Q A;  5E6U A;  3T3M A;  4G1E A;  1JV2 A;  2VDR A;  3K72 A;  3ZE1 A;  3ZE2 A;  5HDB A;  4WJK A;  4UM8 A;  1TYE A;  2VDN A;  4O02 A;  2VDO A;  5FFG A;  4WK4 A;  4NEN A;  1M1X A; 
#chains in the Genus database with same CATH topology
 3JB9 L;  2Z2P A;  5HE2 B;  4QL1 A;  2BCJ B;  1GOF A;  4PSX B;  4BUJ C;  1GOG A;  4U7A A;  2TRC B;  4G1M A;  2QR5 A;  4Z7O A;  4ERY A;  2QZP A;  5TDH B;  3I7O A;  2W18 A;  4LG9 A;  5FQD A;  3MVD K;  3OKY A;  4UM9 A;  1VZ3 A;  3UVK A;  4CC9 A;  1NR0 A;  2VDL A;  4QAM A;  2CE9 A;  1YFQ A;  2HKM A;  5EMJ B;  3NID A;  4GZ8 A;  4G1E A;  4D0K A;  3ZWL B;  4NSX A;  3ZE2 A;  5C92 A;  2PBI B;  1NEX B;  5H17 A;  2AGX A;  3SJL D;  4J73 A;  4CZX A;  5IT9 g;  1L5G A;  4R7A B;  5FA5 B;  4J0W A;  4QRJ A;  3VI4 A;  3OTT A;  4AOW A;  3IKO A;  4IA9 A;  5FLX g;  2B5L A;  4K3J B;  2UZX B;  5EMK B;  4Z7N A;  4AMZ A;  4Z7Q A;  2IUR A;  3SBP A;  4NAA A;  3T3M A;  3RN0 D;  5C2W B;  3EG6 A;  1U4C A;  3IUL A;  3K27 A;  2PM7 B;  4A11 B;  3SFZ A;  1I2M B;  4JHN A;  3RLM D;  4XYH A;  3OKW A;  3V5W B;  2AH1 A;  1L0Q A;  2P9L C;  4KFM B;  4G55 A;  2I0R A;  2IWF A;  3EWE A;  1TYQ C;  4A0B B;  3ZDZ A;  4L9O A;  5FFO A;  3O4I A;  5HE0 B;  2HJ4 A;  2HXC A;  3PSC B;  5IJ8 E;  1U2V C;  2WQ8 A;  3OKT A;  4FA1 D;  1SQ9 A;  5THA A;  4IRZ A;  3K71 A;  2P9S C;  4FAV D;  4XYI A;  3RSE C;  2CE8 A;  3P4F A;  3PXS D;  4A2M A;  3AL8 A;  2JKX A;  2YNP A;  3JAM g;  4ZOX A;  3OW8 A;  5B4W A;  1A0R B;  5EAL A;  2XE4 A;  1VYH C;  4FA4 D;  4GGA A;  1SQJ A;  1PEV A;  2P9I C;  3I7N A;  4GQ2 P;  4E54 A;  2YNN A;  5E6S A;  2Q7Q A;  4GMB A;  3EMH A;  2IAA A;  4J8B A;  2BBK H;  5HE3 B;  2J55 H;  2YBA A;  4DNW A;  4GGD A;  3DWL C;  2BKL A;  3OL2 A;  4O9D A;  3SXT D;  5GXI A;  2HES X;  3FRX A;  4L1M A;  1BPO A;  1GOT B;  2GC4 A;  1FWX A;  1O6F A;  3QI0 A;  2VDO A;  1K32 A;  3GC3 B;  3C5M A;  5K19 A;  1N6F A;  4ERZ A;  2HU7 A;  2H6Q A;  4GM9 A;  4JXM A;  4IMM A;  3AH8 B;  3CFS B;  3IIW A;  2AH0 A;  3PE7 A;  4PXW A;  1K3I A;  2EIE A;  3SWS D;  2J56 H;  1N6E A;  2AGZ A;  2B5N A;  5FKQ A;  5M5U A;  5GMK n;  2PM9 A;  3NVN A;  2I3S A;  2HYE A;  2EIB A;  5E6U A;  2G99 A;  3UVO A;  4AEZ A;  1VE6 A;  3EI3 B;  4BH6 A;  4FA9 D;  3PXW D;  3DSM A;  5FKS A;  3O4H A;  4FHL A;  3RFG A;  3UVN A;  3GD1 I;  3IUM A;  3EI2 B;  5EM2 B;  1QFM A;  5CYK A;  2CN3 A;  2I0T A;  3VGZ A;  3EI1 A;  4E5Z B;  3DDU A;  3PSL A;  2YMU A;  5C9Z B;  3GFC A;  5CXB A;  3I7H A;  1E8M A;  1UTC A;  1H2Y A;  2GNQ A;  4O45 A;  4A09 A;  4MK0 B;  4UM8 A;  4WK4 A;  4H5I A;  4MMX A;  3KRX B;  4D6V A;  3BWS A;  5EMM B;  1R5M A;  2EIC A;  3OKY B;  3MMY A;  3U4Y A;  3FCU A;  4QQE A;  2VDK A;  3F3G A;  3T3P A;  4LG8 A;  4ZN4 A;  5I5I A;  3VI3 A;  1GG2 B;  4QT8 A;  2H9L A;  1JTD B;  3FCS A;  1E5T A;  1B9X A;  3V4V A;  4BCC A;  3NIG A;  2OVR B;  3MUO A;  5H1M A;  5K1C C;  3I89 A;  2VDM A;  5EAR A;  2YB8 B;  4A0A A;  1MDA H;  2OK6 A;  2I0S A;  4Y5R D;  2H13 A;  2B5M A;  4O02 A;  5AFU 3;  1M1X A;  2HKR A;  5JWZ A;  3AL9 A;  5SXM A;  4AN1 A;  2IWK A;  4J86 A;  3DXK C;  5E6R A;  3JZH A;  5FKR A;  3KCI A;  3ZE0 A;  2P9N C;  4FAN D;  2OIZ A;  3UVL A;  5EAM A;  1XIP A;  3K26 A;  2O9K A;  5I5J A;  1C9L A;  2Z2O A;  3EI4 A;  3UKR C;  4OWR A;  3ULE C;  4CI8 A;  1A12 A;  2VC2 A;  4J79 A;  2XYI A;  3IJ0 A;  3CIK B;  3I8C A;  4PNK B;  4PSW B;  4JSX C;  2AQ5 A;  4WK2 A;  2XL3 A;  1OLZ A;  5HE1 B;  4XEI C;  4Y7R A;  1PBY B;  2H9N A;  4YVD A;  4AN0 A;  3JPX A;  4ZOV A;  4CZY A;  1H2Z A;  2HU8 A;  4FA5 D;  2IUP A;  5AJA A;  3MZK A;  1JMZ B;  1PI6 A;  1TBG A;  4J78 A;  4RE5 A;  4CI2 A;  5M5S A;  4X63 B;  4AMY A;  5A2Q g;  2MTA H;  3ODT A;  2AGY A;  2XL2 A;  3O4J A;  3HFQ A;  3QHY B;  4ES0 A;  5HYN B;  4N14 A;  3AL8 B;  4CY3 A;  2XZG A;  3NIF A;  5IGQ A;  2OVQ B;  3EQ9 A;  4OZU A;  5H14 A;  5IC7 A;  4FWW A;  3B7F A;  3IUR A;  5HQG A;  1O6G A;  2Z2N A;  1JMX B;  5HDB A;  3SBR A;  5GSA A;  1S4U X;  2EBS A;  4JD2 C;  3L4O D;  4JSN C;  5IJ7 E;  4E54 B;  1GP2 B;  3UR4 A;  2UZY B;  3JRO A;  3SBQ A;  4PBZ A;  3IJE A;  4PC0 A;  1P22 A;  3JZG A;  2H68 A;  1VE7 A;  1GOH A;  2CO0 A;  3VH0 A;  2QXV A;  3VA6 A;  3OL2 B;  3C75 H;  3C99 A;  4J82 A;  3JZN A;  4A08 A;  2IUQ A;  1N6D A;  4AX4 A;  5AMS A;  2HJB A;  1MG3 A;  2B4E A;  1PGU A;  4O3T B;  1VZ2 A;  1XHM A;  2VZ3 A;  3DXM C;  3IUJ A;  4J0X A;  5CXC A;  1C9I A;  3IUQ A;  4U1E I;  4DNU A;  2EID A;  3O4G A;  4JT6 C;  3ZDY A;  3IJ1 A;  3V4P A;  2P9U C;  4GQB B;  3JRP A;  3I7P A;  4MMY A;  3DM0 A;  3EU7 A;  2PM9 B;  3AFC A;  4L3G D;  3MZL A;  1B9Y A;  3MKS B;  2G9A A;  2OVP B;  3KRW B;  2H6K A;  2VDQ A;  4JT5 C;  4O2W A;  2QC5 A;  4L3H D;  4BL0 A;  2H6N A;  1UOO A;  3ZE1 A;  5CYK B;  4X61 B;  3EI1 B;  3F3P A;  1YR2 A;  3J80 g;  3SLE D;  3K6S A;  3EQ7 A;  5CXB B;  4L1Q D;  2H14 A;  4X3E A;  5EAP A;  3NVQ A;  4A2L A;  2CN2 A;  4Z8L A;  4A09 B;  1U8C A;  1QNI A;  4BP9 A;  5FKT A;  5GXH A;  2VZ1 A;  3SMR A;  3NVX A;  2P9P C;  5EML B;  3A0F A;  3OF7 A;  3K72 A;  1JJU B;  5M5V A;  1K8K C;  3UKU C;  4CY1 A;  3V9F A;  4CZV A;  2GC7 A;  5TEE A;  3SCY A;  4ZOZ A;  4CI3 A;  2J57 G;  4A11 A;  1H2W A;  2H47 A;  5I5M A;  1ERJ A;  4J8G A;  4A0A B;  3IJC A;  4ESG A;  3L4M D;  3ORV D;  1T2X A;  4GM3 A;  1E8N A;  1Q47 A;  2HU5 A;  3EQ8 A;  4A0B A;  4BCB A;  3RRM C;  1JV2 A;  3I7L A;  3F3F A;  3SN6 B;  4EWR A;  4H5J A;  5M5R A;  2VDN A;  4J84 A;  2OJY A;  1SHY B;  4NEN A;  5C86 A;  3MXX A;  1RI6 A;  3EI4 B;  4JHP C;  4JSV C;  2P9K C;  2XU7 A;  4O1Q D;  2H9P A;  5TEF A;  4BP8 A;  3PVU B;  4RE6 A;  4GM8 A;  4G56 B;  1GXR A;  5M61 A;  3N0D A;  5M5T A;  3N0E A;  3BG0 A;  1OMW B;  3RFH A;  3IUN A;  1UOQ A;  3I7K A;  2VDR A;  5FXY A;  3V7D B;  3FM0 A;  3C9C A;  4D9S A;  3SHF A;  4ZOY A;  3I8E A;  5C2V B;  4DNV A;  4WJK A;  2PM6 B;  4PBY A;  2CNX A;  3SVW D;  1MG2 A;  4JSP C;  3MKQ A;  1UOP A;  2I3T A;  4NBM A;  3RMZ D;  3E0C A;  4J87 A;  5KDO B;  4CY5 A;  4CI1 A;  4I79 A;  2H9M A;  2VDP A;  3PXT D;  5TF2 A;  4K3I D;  3J81 g;  3MUN A;  4FB1 D;  2IUV A;  4CY2 A;  3RN1 D;  4NC4 A;  1XKS A;  3IVM A;  5IGO A;  3PVW B;  3BG1 A;  2OK4 A;  2CO0 C;  4BCD A;  2YNO A;  4GGC A;  4A08 B;  1H2X A;  1QFS A;  4MMZ A;  4ERQ A;  3I2N A;  3EI3 A;  3IIY A;  3FGB A;  4TZ4 A;  1JOF A;  4HDJ A;  3ZDX A;  3W15 A;  4X60 B;  2AGL A;  3EI2 A;  3GRE A;  5EM2 A;  5CXC B;  2AGW A;  4J77 A;  2XDW A;  4J81 A;  4E5Z A;  4A7J A;  4UI9 R;  4O3U B;  4LGN A;  1TYE A;  2H3X A;  4WK0 A;  3CFV A;  5FFG A;  3UVM A;  4GQ1 A; 
#chains in the Genus database with same CATH homology
 4MMX A;  3V4P A;  3ZDY A;  1L5G A;  5E6R A;  3IJE A;  4MMY A;  4MMZ A;  3FCU A;  4WK0 A;  3ZE0 A;  2VDK A;  3K6S A;  3VI4 A;  4G1M A;  5E6S A;  3T3P A;  4Z7O A;  3ZDZ A;  3VI3 A;  5FFO A;  3ZDX A;  2VDP A;  3FCS A;  4WK2 A;  3V4V A;  4UM9 A;  1U8C A;  3NIG A;  3NIF A;  2VDL A;  2VC2 A;  4IRZ A;  3K71 A;  2VDM A;  2VDQ A;  4Z7N A;  3NID A;  4Z7Q A;  5E6U A;  3T3M A;  4G1E A;  1JV2 A;  2VDR A;  3K72 A;  3ZE1 A;  3ZE2 A;  5HDB A;  4WJK A;  4UM8 A;  1TYE A;  2VDN A;  4O02 A;  2VDO A;  5FFG A;  4WK4 A;  4NEN A;  1M1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...