4ZN4A

Crystal structure of sqt1 from chaetomium thermophilum solved by mr
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
483
structure length
409
Chain Sequence
ALENDSIAYFDGHKDSVFAIAQHPLYPNIVATGGSEGDADDAPGKGYVLDISATSLNPIFEIDGHTDSINALTFTLPRGDFLVSGGMDGRMRVYAVSVPQNGALAQFKFLAESQETEEINWFAPCPSPDHPNTIALGASDGSVWVFTLDNPVQIVQSYFLHTGPCTAGAWSPDGLLLATVSEDESLHVYDVFGVAASKSLVTDNGQTVVSLTNVDQRFAVEGGLFSVAVSPTGAVVAVGGAGGQIKIVGLPRLSQAGTILASLQIQSDNIESLAFSPSAPILAAGSTDGSIAVFDTSRSFALRRHLRGAHAEDPVVKVEFVKSPPNAAMAGWLLTSCGMDGVVRRWDLRGGTAGPGTLPHMAPSGLVKEWKGHRSGQEGGGVLGFVQGETGERIVTVGDDAVVLVFEAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords sqt1
publication title Co-translational capturing of nascent ribosomal proteins by their dedicated chaperones.
pubmed doi rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
total genus 105
structure length 409
sequence length 483
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4zn4A00
4D6VA 3UVMA 2P9IC 5FQDA 3C9CA 5HE1B 4LG8A 1NR0A 4K3JB 3K26A 4ZOYA 3PXSD 2AGLA 2UZYB 3F3GA 2H9LA 3RMZD 4X3EA 3JAMg 4FB1D 3SFZA 4XYHA 2HESX 4QRJA 3SN6B 2IAAA 4GQBB 2IWKA 5EAMA 3JRPA 4CY3A 4GGDA 5I5IA 5H1MA 2Z2PA 4BL0A 4OWRA 4N14A 2H6QA 4Y7RA 2XL2A 3BG1A 2YNPA 1K32A 2IWFA 3UR4A 4CY5A 2P9LC 4JT5C 2B5LA 3UVOA 2YBAA 2HJBA 3MXXA 4CZYA 2P9KC 2CE9A 3DWLC 4QQEA 2QC5A 2Q7QA 3OL2B 2CO0C 5KDOB 3DXMC 5H14A 2H3XA 3PVUB 4O3UB 2H6NA 3V9FA 3I7PA 4A2MA 3DXKC 5TF2A 5C2VB 1XHMA 3RFGA 4A2LA 3P4FA 3FGBA 1R5MA 4J73A 4ES0A 1B9YA 5IT9g 3K27A 1ERJA 5FKRA 1GXRA 4J8BA 5I5JA 4J87A 4J81A 4FA5D 3FM0A 4FA9D 3JPXA 5EMLB 1N6EA 1B9XA 2P9UC 5K19A 4GM3A 3IJ0A 3NVXA 3OL2A 4O3TB 4GQ2P 2PM9B 4QT8A 2I0RA 1L0QA 2OVRB 5FA5B 4L1QD 4ZOXA 5TEFA 3C99A 2PBIB 2AQ5A 3KRWB 2IURA 3PXWD 5FKQA 1XKSA 2I0SA 4J78A 4HDJA 3PE7A 4FA1D 2AGYA 2YB8B 3JZHA 4CI8A 3JZGA 4Y5RD 2AGWA 2H14A 2H6KA 4GM8A 4TZ4A 5C2WB 3EI2B 3MMYA 4J86A 1OMWB 3F3PA 3N0EA 3IJ1A 2OK6A 3SMRA 1MG2A 4PXWA 3BG0A 2GC7A 2PM9A 3RSEC 3MKSB 4GQ1A 4CC9A 2HYEA 4KFMB 2H68A 3EG6A 4U7AA 5FKTA 3ODTA 3ULEC 2IUVA 1SQ9A 2J56H 3CFVA 5SXMA 1JMZB 3JZNA 2AH1A 4FAVD 2EBSA 3N0DA 5TDHB 2GC4A 4LGNA 4J0XA 1VYHC 5EM2B 2BCJB 3EI1B 4U1EI 4X63B 4IA9A 3EI2A 3V7DB 5CYKB 1K8KC 4OZUA 1FWXA 1JOFA 3A0FA 3SWSD 4K3ID 3EMHA 2YNOA 2B5MA 2HKRA 2YNNA 2P9SC 4AEZA 2OJYA 5FLXg 4JT6C 3VA6A 4ERQA 4J8GA 3UKUC 3OKYB 3IKOA 1JMXB 5AMSA 3SCYA 4NSXA 4CY2A 2MTAH 4E54B 1RI6A 3DSMA 3EWEA 3PXTD 3RFHA 3UVNA 4JSXC 5EM2A 3U4YA 3EI1A 3EI3B 4JSVC 4GGAA 4JD2C 4FHLA 3C75H 3SLED 4AOWA 2BBKH 2QXVA 5CYKA 3I7OA 5GXHA 4PBYA 5JWZA 4L3GD 4GMBA 1U2VC 1SQJA 5A2Qg 2OIZA 5C9ZB 2H9MA 1N6DA 1GP2B 4ERZA 4D0KA 3I2NA 2P9NC 3PVWB 1TBGA 2J55H 4PNKB 4E5ZB 1MG3A 3I8CA 2AH0A 4E54A 3ZWLB 4GZ8A 1S4UX 2H13A 3NVNA 2YMUA 5K1CC 5FKSA 3I7KA 3EI3A 5TEEA 4A09B 4ERYA 5HYNB 2B4EA 2I3TA 2I0TA 5HE2B 4PSXB 1TYQC 2I3SA 3FRXA 2PM6B 4H5IA 3L4MD 3RRMC 3I7HA 4XYIA 3RN0D 3OKWA 4X60B 2PM7B 3I89A 2O9KA 1XIPA 4GGCA 4A08B 5IC7A 4E5ZA 4G56B 4O9DA 4CY1A 4J82A 3BWSA 2XL3A 3SXTD 4PBZA 4LG9A 3JROA 2UZXB 3JB9L 3NVQA 3B7FA 4UI9R 4JSPC 3MZKA 3OKTA 1PEVA 2Z2NA 4A09A 3AL9A 4R7AB 5B4WA 5AJAA 5GXIA 2Z2OA 3UKRC 2GNQA 5AFU3 3I8EA 2HKMA 4QL1A 4EWRA 5CXCB 2B5NA 3J80g 1JJUB 4ESGA 4ZOZA 3RLMD 3C5MA 3GFCA 5H17A 3RN1D 2W18A 5EARA 4A08A 5EMKB 3HFQA 4J79A 2XU7A 5EAPA 4A0AB 4H5JA 1MDAH 3MKQA 3EU7A 3UVKA 2HJ4A 3SHFA 4FAND 5GMKn 2XYIA 2P9PC 4Z8LA 3KRXB 4J84A 3SBQA 1A0RB 1P22A 4CI2A 4BH6A 3V5WB 1PI6A 4CI1A 3IIYA 4A11B 2CNXA 3MZLA 5CXCA 1OLZA 3ORVD 3I7LA 3EI4B 3OTTA 4J77A 3I7NA 1YFQA 4FA4D 4CZVA 3J81g 2IUPA 4FWWA 2AGXA 3AL8B 3AH8B 4BUJC 4PSWB 4A0AA 2AGZA 3GREA 4X61B 5I5MA 3IJCA 5EMJB 4JXMA 3L4OD 3W15A 2OK4A 4JSNC 4J0WA 4I79A 4CZXA 5IGOA 2G9AA 3UVLA 3OKYA 5HQGA 3SVWD 1GOTB 1PBYB 5IGQA 4A11A 1N6FA 3AFCA 2G99A 4O1QD 3PSLA 3CIKB 5CXBB 5EALA 3SBRA 3E0CA 2J57G 4ZOVA 3EI4A 4CI3A 4A0BB 3AL8A 2OVPB 5IJ8E 3CFSB 2TRCB 2H47A 4PC0A 1GG2B 3PSCB 4A7JA 4L3HD 2H9NA 4L9OA 2CN3A 1SHYB 4YVDA 2HXCA 2OVQB 5FXYA 2CO0A 3SJLD 3DM0A 4ZN4A 2CN2A 5HE3B 1QNIA 3VGZA 4XEIC 5CXBA 1U4CA 3F3FA 3IIWA 4MK0B 4GM9A 4O45A 5THAA 3SBPA 2CE8A 4A0BA 1PGUA 1Q47A 2H9PA 5HE0B 4IMMA 2IUQA 5IJ7E 5GSAA 1NEXB 3VH0A 3OW8A 5EMMB
chains in the Genus database with same CATH superfamily
4D6VA 3UVMA 2VDKA 2P9IC 4BCBA 5FQDA 3C9CA 5HE1B 4LG8A 1E8NA 1NR0A 4K3JB 1UTCA 3K26A 4ZOYA 3PXSD 2AGLA 3VI4A 3GC3B 2UZYB 3F3GA 3DDUA 2H9LA 3ZE0A 3RMZD 1GOGA 1JTDB 4X3EA 5C86A 1H2XA 3JAMg 2VDPA 4FB1D 3SFZA 4XYHA 2HESX 3O4JA 4QRJA 4NENA 3SN6B 1UOOA 2IAAA 4GQBB 3GD1I 2IWKA 5EAMA 3JRPA 4CY3A 4GGDA 5I5IA 5H1MA 2Z2PA 4BL0A 4OWRA 4N14A 2H6QA 4Y7RA 4WK0A 2XL2A 3BG1A 3FCUA 1GOHA 2YNPA 1K32A 2IWFA 3UR4A 4CY5A 2P9LC 4JT5C 2B5LA 3O4HA 3UVOA 2YBAA 2HJBA 4UM8A 3MXXA 4CZYA 2P9KC 2CE9A 3DWLC 4QQEA 1I2MB 2QC5A 2Q7QA 3MUOA 2CO0C 3OL2B 5KDOB 3DXMC 1C9IA 5H14A 2H3XA 3PVUB 3MVDK 1UOQA 4O3UB 2H6NA 2HU5A 3V9FA 3K71A 3I7PA 4A2MA 3DXKC 5TF2A 5C2VB 1XHMA 3RFGA 4A2LA 4G1MA 5HDBA 3P4FA 4DNVA 3FGBA 1R5MA 4J73A 4ES0A 1B9YA 5IT9g 1VE6A 3K27A 1ERJA 5FKRA 1GXRA 3IVMA 4J8BA 5I5JA 4J87A 2XZGA 4J81A 4FA5D 3FM0A 4FA9D 3JPXA 5EMLB 3T3PA 1N6EA 4WK4A 1B9XA 2XE4A 2P9UC 3IUNA 5K19A 4GM3A 2EICA 3IJ0A 3NVXA 3OL2A 4O2WA 4O3TB 4GQ2P 2PM9B 4QT8A 2I0RA 1L0QA 1M1XA 2OVRB 5FA5B 3QI0A 4L1QD 4ZOXA 5TEFA 3C99A 1O6FA 2PBIB 2VDRA 5E6SA 2AQ5A 3KRWB 2IURA 3PXWD 3MUNA 3K72A 2VDLA 4AMZA 5FKQA 1XKSA 4G55A 2I0SA 4J78A 4HDJA 3PE7A 4FA1D 2AGYA 2YB8B 3JZHA 4CI8A 3JZGA 3O4GA 4Y5RD 2AGWA 2H14A 2H6KA 4GM8A 4TZ4A 3IJEA 5C2WB 3EI2B 3MMYA 2VZ3A 4MMZA 4J86A 1OMWB 3F3PA 3N0EA 3IJ1A 2OK6A 3SMRA 1MG2A 4PXWA 3BG0A 5E6RA 2GC7A 2PM9A 3RSEC 3MKSB 4GQ1A 4CC9A 2HYEA 4Z7QA 4KFMB 2H68A 3EG6A 4U7AA 5FKTA 3ODTA 3ULEC 2IUVA 1SQ9A 2J56H 3CFVA 5SXMA 1H2YA 2JKXA 1BPOA 1JMZB 3JZNA 2QZPA 2AH1A 3EQ9A 4FAVD 2EBSA 3N0DA 5TDHB 2GC4A 1A12A 4LGNA 4J0XA 2VDMA 1VYHC 5EM2B 4D9SA 2BCJB 4WK2A 3EI1B 4NC4A 4U1EI 5M5TA 4X63B 4IA9A 4Z7NA 4NBMA 3EI2A 1VZ2A 3ZDYA 3V7DB 5CYKB 3IUJA 1K8KC 3ZDZA 4OZUA 1FWXA 4RE6A 1JOFA 3A0FA 3SWSD 4K3ID 4AN0A 3EMHA 2YNOA 2B5MA 2HKRA 2YNNA 2P9SC 4AEZA 2OJYA 5FLXg 4JT6C 3VA6A 4ERQA 4J8GA 4JHPC 1K3IA 3UKUC 3OKYB 3IKOA 1JMXB 5AMSA 3SCYA 4NSXA 4CY2A 2MTAH 4E54B 1RI6A 3DSMA 3EWEA 3PXTD 3RFHA 3EQ8A 3UVNA 4JSXC 5EM2A 3U4YA 2VDQA 3EI1A 3EI3B 3KCIA 4JSVC 4GGAA 4JD2C 4FHLA 3C75H 3IULA 3SLED 4AOWA 1JV2A 2BBKH 2QXVA 5CYKA 3I7OA 3K6SA 5GXHA 4PBYA 5JWZA 3NIFA 4L3GD 4GMBA 1U2VC 1SQJA 5A2Qg 2OIZA 5C9ZB 2H9MA 1N6DA 2VDNA 1GP2B 4ERZA 3VI3A 4D0KA 3I2NA 3T3MA 2P9NC 3PVWB 1TBGA 3O4IA 2J55H 4PNKB 4E5ZB 1MG3A 3I8CA 4Z7OA 2AH0A 4E54A 3ZWLB 4GZ8A 1S4UX 2H13A 2VC2A 3NVNA 5FFGA 2YMUA 5K1CC 1VZ3A 5FKSA 4AMYA 3I7KA 3EI3A 5TEEA 4A09B 4ERYA 3NIGA 5HYNB 2B4EA 2I3TA 2I0TA 5HE2B 4PSXB 1TYQC 3OF7A 2I3SA 3FRXA 2PM6B 3EQ7A 4H5IA 4WJKA 4BCCA 3L4MD 1O6GA 3RRMC 3I7HA 4L1MA 4XYIA 2BKLA 3RN0D 3OKWA 4X60B 2PM7B 3I89A 2O9KA 1XIPA 2EIEA 4GGCA 4A08B 5IC7A 4E5ZA 4G56B 4O9DA 4MMXA 4J82A 4CY1A 3ZE2A 3BWSA 2XL3A 4BP9A 3SXTD 4PBZA 4LG9A 3JROA 2UZXB 3JB9L 3NVQA 3B7FA 4UI9R 4JSPC 3MZKA 3OKTA 1H2ZA 2VDOA 1PEVA 2Z2NA 4A09A 2XDWA 2EIDA 3AL9A 4R7AB 5B4WA 3V4VA 1E5TA 5AJAA 5GXIA 2Z2OA 3UKRC 2GNQA 5AFU3 3I8EA 2HKMA 3ZE1A 4QL1A 4EWRA 5CXCB 4JHNA 2B5NA 3J80g 1JJUB 5FFOA 2WQ8A 4ESGA 5M61A 4ZOZA 3RLMD 3FCSA 3C5MA 3GFCA 5H17A 2HU8A 4BCDA 3RN1D 2W18A 5EARA 4A08A 5EMKB 3HFQA 4J79A 4IRZA 2XU7A 5EAPA 4A0AB 4H5JA 4BP8A 1MDAH 3MKQA 3EU7A 3UVKA 4RE5A 5M5SA 2HJ4A 1YR2A 1GOFA 1C9LA 1L5GA 3SHFA 4FAND 5GMKn 2XYIA 2P9PC 4Z8LA 3KRXB 4J84A 3SBQA 1A0RB 1P22A 4CI2A 3NIDA 4BH6A 5M5RA 3V5WB 1PI6A 4CI1A 3IIYA 4A11B 1QFSA 2CNXA 2QR5A 3MZLA 5CXCA 1OLZA 3ORVD 3I7LA 3EI4B 3OTTA 4J77A 3I7NA 3ZDXA 1U8CA 1YFQA 4FA4D 1UOPA 4CZVA 3J81g 2IUPA 4FWWA 2AGXA 3AL8B 3AH8B 4BUJC 3QHYB 4PSWB 1VE7A 4A0AA 2AGZA 3GREA 4X61B 2HU7A 5I5MA 3IJCA 5EMJB 2VZ1A 4JXMA 5M5UA 3L4OD 3W15A 2OK4A 4JSNC 4J0WA 4I79A 4CZXA 1QFMA 1T2XA 4UM9A 2G9AA 5IGOA 4AX4A 3UVLA 3OKYA 5HQGA 3SVWD 3IUMA 1GOTB 1PBYB 5IGQA 4A11A 1E8MA 1N6FA 3AFCA 2G99A 4O1QD 3PSLA 3CIKB 5CXBB 5EALA 3SBRA 3E0CA 2J57G 4ZOVA 3EI4A 4CI3A 4AN1A 4A0BB 5C92A 3AL8A 2OVPB 4NAAA 4QAMA 5IJ8E 4DNWA 3CFSB 2TRCB 2H47A 3IUQA 4PC0A 1GG2B 3IURA 3PSCB 4A7JA 4L3HD 2H9NA 1H2WA 4L9OA 1SHYB 2CN3A 4YVDA 3V4PA 2HXCA 2OVQB 5FXYA 2CO0A 3SJLD 3DM0A 4ZN4A 4MMYA 2CN2A 4O02A 5HE3B 1QNIA 3VGZA 2EIBA 4XEIC 5CXBA 1U4CA 3F3FA 3IIWA 5M5VA 4MK0B 4GM9A 4O45A 5THAA 3SBPA 5E6UA 2CE8A 4A0BA 1PGUA 1Q47A 2H9PA 5HE0B 4IMMA 2IUQA 5IJ7E 5GSAA 4DNUA 1NEXB 3VH0A 3OW8A 5EMMB 4G1EA 1TYEA
chains in the Genus database with same CATH topology
4D6VA 3UVMA 2P9IC 5FQDA 3C9CA 5HE1B 4LG8A 1NR0A 4K3JB 3K26A 4ZOYA 3PXSD 2AGLA 2UZYB 3F3GA 2H9LA 3RMZD 4X3EA 3JAMg 4FB1D 3SFZA 4XYHA 2HESX 4QRJA 3SN6B 2IAAA 4GQBB 2IWKA 5EAMA 3JRPA 4CY3A 4GGDA 5I5IA 5H1MA 2Z2PA 4BL0A 4OWRA 4N14A 2H6QA 4Y7RA 2XL2A 3BG1A 2YNPA 1K32A 2IWFA 3UR4A 4CY5A 2P9LC 4JT5C 2B5LA 3UVOA 2YBAA 2HJBA 3MXXA 4CZYA 2P9KC 2CE9A 3DWLC 4QQEA 2QC5A 2Q7QA 3OL2B 2CO0C 5KDOB 3DXMC 5H14A 2H3XA 3PVUB 4O3UB 2H6NA 3V9FA 3I7PA 4A2MA 3DXKC 5TF2A 5C2VB 1XHMA 3RFGA 4A2LA 3P4FA 3FGBA 1R5MA 4J73A 4ES0A 1B9YA 5IT9g 3K27A 1ERJA 5FKRA 1GXRA 4J8BA 5I5JA 4J87A 4J81A 4FA5D 3FM0A 4FA9D 3JPXA 5EMLB 1N6EA 1B9XA 2P9UC 5K19A 4GM3A 3IJ0A 3NVXA 3OL2A 4O3TB 4GQ2P 2PM9B 4QT8A 2I0RA 1L0QA 2OVRB 5FA5B 4L1QD 4ZOXA 5TEFA 3C99A 2PBIB 2AQ5A 3KRWB 2IURA 3PXWD 5FKQA 1XKSA 2I0SA 4J78A 4HDJA 3PE7A 4FA1D 2AGYA 2YB8B 3JZHA 4CI8A 3JZGA 4Y5RD 2AGWA 2H14A 2H6KA 4GM8A 4TZ4A 5C2WB 3EI2B 3MMYA 4J86A 1OMWB 3F3PA 3N0EA 3IJ1A 2OK6A 3SMRA 1MG2A 4PXWA 3BG0A 2GC7A 2PM9A 3RSEC 3MKSB 4GQ1A 4CC9A 2HYEA 4KFMB 2H68A 3EG6A 4U7AA 5FKTA 3ODTA 3ULEC 2IUVA 1SQ9A 2J56H 3CFVA 5SXMA 1JMZB 3JZNA 2AH1A 4FAVD 2EBSA 3N0DA 5TDHB 2GC4A 4LGNA 4J0XA 1VYHC 5EM2B 2BCJB 3EI1B 4U1EI 4X63B 4IA9A 3EI2A 3V7DB 5CYKB 1K8KC 4OZUA 1FWXA 1JOFA 3A0FA 3SWSD 4K3ID 3EMHA 2YNOA 2B5MA 2HKRA 2YNNA 2P9SC 4AEZA 2OJYA 5FLXg 4JT6C 3VA6A 4ERQA 4J8GA 3UKUC 3OKYB 3IKOA 1JMXB 5AMSA 3SCYA 4NSXA 4CY2A 2MTAH 4E54B 1RI6A 3DSMA 3EWEA 3PXTD 3RFHA 3UVNA 4JSXC 5EM2A 3U4YA 3EI1A 3EI3B 4JSVC 4GGAA 4JD2C 4FHLA 3C75H 3SLED 4AOWA 2BBKH 2QXVA 5CYKA 3I7OA 5GXHA 4PBYA 5JWZA 4L3GD 4GMBA 1U2VC 1SQJA 5A2Qg 2OIZA 5C9ZB 2H9MA 1N6DA 1GP2B 4ERZA 4D0KA 3I2NA 2P9NC 3PVWB 1TBGA 2J55H 4PNKB 4E5ZB 1MG3A 3I8CA 2AH0A 4E54A 3ZWLB 4GZ8A 1S4UX 2H13A 3NVNA 2YMUA 5K1CC 5FKSA 3I7KA 3EI3A 5TEEA 4A09B 4ERYA 5HYNB 2B4EA 2I3TA 2I0TA 5HE2B 4PSXB 1TYQC 2I3SA 3FRXA 2PM6B 4H5IA 3L4MD 3RRMC 3I7HA 4XYIA 3RN0D 3OKWA 4X60B 2PM7B 3I89A 2O9KA 1XIPA 4GGCA 4A08B 5IC7A 4E5ZA 4G56B 4O9DA 4CY1A 4J82A 3BWSA 2XL3A 3SXTD 4PBZA 4LG9A 3JROA 2UZXB 3JB9L 3NVQA 3B7FA 4UI9R 4JSPC 3MZKA 3OKTA 1PEVA 2Z2NA 4A09A 3AL9A 4R7AB 5B4WA 5AJAA 5GXIA 2Z2OA 3UKRC 2GNQA 5AFU3 3I8EA 2HKMA 4QL1A 4EWRA 5CXCB 2B5NA 3J80g 1JJUB 4ESGA 4ZOZA 3RLMD 3C5MA 3GFCA 5H17A 3RN1D 2W18A 5EARA 4A08A 5EMKB 3HFQA 4J79A 2XU7A 5EAPA 4A0AB 4H5JA 1MDAH 3MKQA 3EU7A 3UVKA 2HJ4A 3SHFA 4FAND 5GMKn 2XYIA 2P9PC 4Z8LA 3KRXB 4J84A 3SBQA 1A0RB 1P22A 4CI2A 4BH6A 3V5WB 1PI6A 4CI1A 3IIYA 4A11B 2CNXA 3MZLA 5CXCA 1OLZA 3ORVD 3I7LA 3EI4B 3OTTA 4J77A 3I7NA 1YFQA 4FA4D 4CZVA 3J81g 2IUPA 4FWWA 2AGXA 3AL8B 3AH8B 4BUJC 4PSWB 4A0AA 2AGZA 3GREA 4X61B 5I5MA 3IJCA 5EMJB 4JXMA 3L4OD 3W15A 2OK4A 4JSNC 4J0WA 4I79A 4CZXA 5IGOA 2G9AA 3UVLA 3OKYA 5HQGA 3SVWD 1GOTB 1PBYB 5IGQA 4A11A 1N6FA 3AFCA 2G99A 4O1QD 3PSLA 3CIKB 5CXBB 5EALA 3SBRA 3E0CA 2J57G 4ZOVA 3EI4A 4CI3A 4A0BB 3AL8A 2OVPB 5IJ8E 3CFSB 2TRCB 2H47A 4PC0A 1GG2B 3PSCB 4A7JA 4L3HD 2H9NA 4L9OA 2CN3A 1SHYB 4YVDA 2HXCA 2OVQB 5FXYA 2CO0A 3SJLD 3DM0A 4ZN4A 2CN2A 5HE3B 1QNIA 3VGZA 4XEIC 5CXBA 1U4CA 3F3FA 3IIWA 4MK0B 4GM9A 4O45A 5THAA 3SBPA 2CE8A 4A0BA 1PGUA 1Q47A 2H9PA 5HE0B 4IMMA 2IUQA 5IJ7E 5GSAA 1NEXB 3VH0A 3OW8A 5EMMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6V A;  3UVM A;  2P9I C;  5FQD A;  3C9C A;  5HE1 B;  4LG8 A;  1NR0 A;  4K3J B;  3K26 A;  4ZOY A;  3PXS D;  2AGL A;  2UZY B;  3F3G A;  2H9L A;  3RMZ D;  4X3E A;  3JAM g;  4FB1 D;  3SFZ A;  4XYH A;  2HES X;  4QRJ A;  3SN6 B;  2IAA A;  4GQB B;  2IWK A;  5EAM A;  3JRP A;  4CY3 A;  4GGD A;  5I5I A;  5H1M A;  2Z2P A;  4BL0 A;  4OWR A;  4N14 A;  2H6Q A;  4Y7R A;  2XL2 A;  3BG1 A;  2YNP A;  1K32 A;  2IWF A;  3UR4 A;  4CY5 A;  2P9L C;  4JT5 C;  2B5L A;  3UVO A;  2YBA A;  2HJB A;  3MXX A;  4CZY A;  2P9K C;  2CE9 A;  3DWL C;  4QQE A;  2QC5 A;  2Q7Q A;  3OL2 B;  2CO0 C;  5KDO B;  3DXM C;  5H14 A;  2H3X A;  3PVU B;  4O3U B;  2H6N A;  3V9F A;  3I7P A;  4A2M A;  3DXK C;  5TF2 A;  5C2V B;  1XHM A;  3RFG A;  4A2L A;  3P4F A;  3FGB A;  1R5M A;  4J73 A;  4ES0 A;  1B9Y A;  5IT9 g;  3K27 A;  1ERJ A;  5FKR A;  1GXR A;  4J8B A;  5I5J A;  4J87 A;  4J81 A;  4FA5 D;  3FM0 A;  4FA9 D;  3JPX A;  5EML B;  1N6E A;  1B9X A;  2P9U C;  5K19 A;  4GM3 A;  3IJ0 A;  3NVX A;  3OL2 A;  4O3T B;  4GQ2 P;  2PM9 B;  4QT8 A;  2I0R A;  1L0Q A;  2OVR B;  5FA5 B;  4L1Q D;  4ZOX A;  5TEF A;  3C99 A;  2PBI B;  2AQ5 A;  3KRW B;  2IUR A;  3PXW D;  5FKQ A;  1XKS A;  2I0S A;  4J78 A;  4HDJ A;  3PE7 A;  4FA1 D;  2AGY A;  2YB8 B;  3JZH A;  4CI8 A;  3JZG A;  4Y5R D;  2AGW A;  2H14 A;  2H6K A;  4GM8 A;  4TZ4 A;  5C2W B;  3EI2 B;  3MMY A;  4J86 A;  1OMW B;  3F3P A;  3N0E A;  3IJ1 A;  2OK6 A;  3SMR A;  1MG2 A;  4PXW A;  3BG0 A;  2GC7 A;  2PM9 A;  3RSE C;  3MKS B;  4GQ1 A;  4CC9 A;  2HYE A;  4KFM B;  2H68 A;  3EG6 A;  4U7A A;  5FKT A;  3ODT A;  3ULE C;  2IUV A;  1SQ9 A;  2J56 H;  3CFV A;  5SXM A;  1JMZ B;  3JZN A;  2AH1 A;  4FAV D;  2EBS A;  3N0D A;  5TDH B;  2GC4 A;  4LGN A;  4J0X A;  1VYH C;  5EM2 B;  2BCJ B;  3EI1 B;  4U1E I;  4X63 B;  4IA9 A;  3EI2 A;  3V7D B;  5CYK B;  1K8K C;  4OZU A;  1FWX A;  1JOF A;  3A0F A;  3SWS D;  4K3I D;  3EMH A;  2YNO A;  2B5M A;  2HKR A;  2YNN A;  2P9S C;  4AEZ A;  2OJY A;  5FLX g;  4JT6 C;  3VA6 A;  4ERQ A;  4J8G A;  3UKU C;  3OKY B;  3IKO A;  1JMX B;  5AMS A;  3SCY A;  4NSX A;  4CY2 A;  2MTA H;  4E54 B;  1RI6 A;  3DSM A;  3EWE A;  3PXT D;  3RFH A;  3UVN A;  4JSX C;  5EM2 A;  3U4Y A;  3EI1 A;  3EI3 B;  4JSV C;  4GGA A;  4JD2 C;  4FHL A;  3C75 H;  3SLE D;  4AOW A;  2BBK H;  2QXV A;  5CYK A;  3I7O A;  5GXH A;  4PBY A;  5JWZ A;  4L3G D;  4GMB A;  1U2V C;  1SQJ A;  5A2Q g;  2OIZ A;  5C9Z B;  2H9M A;  1N6D A;  1GP2 B;  4ERZ A;  4D0K A;  3I2N A;  2P9N C;  3PVW B;  1TBG A;  2J55 H;  4PNK B;  4E5Z B;  1MG3 A;  3I8C A;  2AH0 A;  4E54 A;  3ZWL B;  4GZ8 A;  1S4U X;  2H13 A;  3NVN A;  2YMU A;  5K1C C;  5FKS A;  3I7K A;  3EI3 A;  5TEE A;  4A09 B;  4ERY A;  5HYN B;  2B4E A;  2I3T A;  2I0T A;  5HE2 B;  4PSX B;  1TYQ C;  2I3S A;  3FRX A;  2PM6 B;  4H5I A;  3L4M D;  3RRM C;  3I7H A;  4XYI A;  3RN0 D;  3OKW A;  4X60 B;  2PM7 B;  3I89 A;  2O9K A;  1XIP A;  4GGC A;  4A08 B;  5IC7 A;  4E5Z A;  4G56 B;  4O9D A;  4CY1 A;  4J82 A;  3BWS A;  2XL3 A;  3SXT D;  4PBZ A;  4LG9 A;  3JRO A;  2UZX B;  3JB9 L;  3NVQ A;  3B7F A;  4UI9 R;  4JSP C;  3MZK A;  3OKT A;  1PEV A;  2Z2N A;  4A09 A;  3AL9 A;  4R7A B;  5B4W A;  5AJA A;  5GXI A;  2Z2O A;  3UKR C;  2GNQ A;  5AFU 3;  3I8E A;  2HKM A;  4QL1 A;  4EWR A;  5CXC B;  2B5N A;  3J80 g;  1JJU B;  4ESG A;  4ZOZ A;  3RLM D;  3C5M A;  3GFC A;  5H17 A;  3RN1 D;  2W18 A;  5EAR A;  4A08 A;  5EMK B;  3HFQ A;  4J79 A;  2XU7 A;  5EAP A;  4A0A B;  4H5J A;  1MDA H;  3MKQ A;  3EU7 A;  3UVK A;  2HJ4 A;  3SHF A;  4FAN D;  5GMK n;  2XYI A;  2P9P C;  4Z8L A;  3KRX B;  4J84 A;  3SBQ A;  1A0R B;  1P22 A;  4CI2 A;  4BH6 A;  3V5W B;  1PI6 A;  4CI1 A;  3IIY A;  4A11 B;  2CNX A;  3MZL A;  5CXC A;  1OLZ A;  3ORV D;  3I7L A;  3EI4 B;  3OTT A;  4J77 A;  3I7N A;  1YFQ A;  4FA4 D;  4CZV A;  3J81 g;  2IUP A;  4FWW A;  2AGX A;  3AL8 B;  3AH8 B;  4BUJ C;  4PSW B;  4A0A A;  2AGZ A;  3GRE A;  4X61 B;  5I5M A;  3IJC A;  5EMJ B;  4JXM A;  3L4O D;  3W15 A;  2OK4 A;  4JSN C;  4J0W A;  4I79 A;  4CZX A;  5IGO A;  2G9A A;  3UVL A;  3OKY A;  5HQG A;  3SVW D;  1GOT B;  1PBY B;  5IGQ A;  4A11 A;  1N6F A;  3AFC A;  2G99 A;  4O1Q D;  3PSL A;  3CIK B;  5CXB B;  5EAL A;  3SBR A;  3E0C A;  2J57 G;  4ZOV A;  3EI4 A;  4CI3 A;  4A0B B;  3AL8 A;  2OVP B;  5IJ8 E;  3CFS B;  2TRC B;  2H47 A;  4PC0 A;  1GG2 B;  3PSC B;  4A7J A;  4L3H D;  2H9N A;  4L9O A;  2CN3 A;  1SHY B;  4YVD A;  2HXC A;  2OVQ B;  5FXY A;  2CO0 A;  3SJL D;  3DM0 A;  4ZN4 A;  2CN2 A;  5HE3 B;  1QNI A;  3VGZ A;  4XEI C;  5CXB A;  1U4C A;  3F3F A;  3IIW A;  4MK0 B;  4GM9 A;  4O45 A;  5THA A;  3SBP A;  2CE8 A;  4A0B A;  1PGU A;  1Q47 A;  2H9P A;  5HE0 B;  4IMM A;  2IUQ A;  5IJ7 E;  5GSA A;  1NEX B;  3VH0 A;  3OW8 A;  5EMM B; 
#chains in the Genus database with same CATH topology
 4D6V A;  3UVM A;  2VDK A;  2P9I C;  4BCB A;  5FQD A;  3C9C A;  5HE1 B;  4LG8 A;  1E8N A;  1NR0 A;  4K3J B;  1UTC A;  3K26 A;  4ZOY A;  3PXS D;  2AGL A;  3VI4 A;  3GC3 B;  2UZY B;  3F3G A;  3DDU A;  2H9L A;  3ZE0 A;  3RMZ D;  1GOG A;  1JTD B;  4X3E A;  5C86 A;  1H2X A;  3JAM g;  2VDP A;  4FB1 D;  3SFZ A;  4XYH A;  2HES X;  3O4J A;  4QRJ A;  4NEN A;  3SN6 B;  1UOO A;  2IAA A;  4GQB B;  3GD1 I;  2IWK A;  5EAM A;  3JRP A;  4CY3 A;  4GGD A;  5I5I A;  5H1M A;  2Z2P A;  4BL0 A;  4OWR A;  4N14 A;  2H6Q A;  4Y7R A;  4WK0 A;  2XL2 A;  3BG1 A;  3FCU A;  1GOH A;  2YNP A;  1K32 A;  2IWF A;  3UR4 A;  4CY5 A;  2P9L C;  4JT5 C;  2B5L A;  3O4H A;  3UVO A;  2YBA A;  2HJB A;  4UM8 A;  3MXX A;  4CZY A;  2P9K C;  2CE9 A;  3DWL C;  4QQE A;  1I2M B;  2QC5 A;  2Q7Q A;  3MUO A;  2CO0 C;  3OL2 B;  5KDO B;  3DXM C;  1C9I A;  5H14 A;  2H3X A;  3PVU B;  3MVD K;  1UOQ A;  4O3U B;  2H6N A;  2HU5 A;  3V9F A;  3K71 A;  3I7P A;  4A2M A;  3DXK C;  5TF2 A;  5C2V B;  1XHM A;  3RFG A;  4A2L A;  4G1M A;  5HDB A;  3P4F A;  4DNV A;  3FGB A;  1R5M A;  4J73 A;  4ES0 A;  1B9Y A;  5IT9 g;  1VE6 A;  3K27 A;  1ERJ A;  5FKR A;  1GXR A;  3IVM A;  4J8B A;  5I5J A;  4J87 A;  2XZG A;  4J81 A;  4FA5 D;  3FM0 A;  4FA9 D;  3JPX A;  5EML B;  3T3P A;  1N6E A;  4WK4 A;  1B9X A;  2XE4 A;  2P9U C;  3IUN A;  5K19 A;  4GM3 A;  2EIC A;  3IJ0 A;  3NVX A;  3OL2 A;  4O2W A;  4O3T B;  4GQ2 P;  2PM9 B;  4QT8 A;  2I0R A;  1L0Q A;  1M1X A;  2OVR B;  5FA5 B;  3QI0 A;  4L1Q D;  4ZOX A;  5TEF A;  3C99 A;  1O6F A;  2PBI B;  2VDR A;  5E6S A;  2AQ5 A;  3KRW B;  2IUR A;  3PXW D;  3MUN A;  3K72 A;  2VDL A;  4AMZ A;  5FKQ A;  1XKS A;  4G55 A;  2I0S A;  4J78 A;  4HDJ A;  3PE7 A;  4FA1 D;  2AGY A;  2YB8 B;  3JZH A;  4CI8 A;  3JZG A;  3O4G A;  4Y5R D;  2AGW A;  2H14 A;  2H6K A;  4GM8 A;  4TZ4 A;  3IJE A;  5C2W B;  3EI2 B;  3MMY A;  2VZ3 A;  4MMZ A;  4J86 A;  1OMW B;  3F3P A;  3N0E A;  3IJ1 A;  2OK6 A;  3SMR A;  1MG2 A;  4PXW A;  3BG0 A;  5E6R A;  2GC7 A;  2PM9 A;  3RSE C;  3MKS B;  4GQ1 A;  4CC9 A;  2HYE A;  4Z7Q A;  4KFM B;  2H68 A;  3EG6 A;  4U7A A;  5FKT A;  3ODT A;  3ULE C;  2IUV A;  1SQ9 A;  2J56 H;  3CFV A;  5SXM A;  1H2Y A;  2JKX A;  1BPO A;  1JMZ B;  3JZN A;  2QZP A;  2AH1 A;  3EQ9 A;  4FAV D;  2EBS A;  3N0D A;  5TDH B;  2GC4 A;  1A12 A;  4LGN A;  4J0X A;  2VDM A;  1VYH C;  5EM2 B;  4D9S A;  2BCJ B;  4WK2 A;  3EI1 B;  4NC4 A;  4U1E I;  5M5T A;  4X63 B;  4IA9 A;  4Z7N A;  4NBM A;  3EI2 A;  1VZ2 A;  3ZDY A;  3V7D B;  5CYK B;  3IUJ A;  1K8K C;  3ZDZ A;  4OZU A;  1FWX A;  4RE6 A;  1JOF A;  3A0F A;  3SWS D;  4K3I D;  4AN0 A;  3EMH A;  2YNO A;  2B5M A;  2HKR A;  2YNN A;  2P9S C;  4AEZ A;  2OJY A;  5FLX g;  4JT6 C;  3VA6 A;  4ERQ A;  4J8G A;  4JHP C;  1K3I A;  3UKU C;  3OKY B;  3IKO A;  1JMX B;  5AMS A;  3SCY A;  4NSX A;  4CY2 A;  2MTA H;  4E54 B;  1RI6 A;  3DSM A;  3EWE A;  3PXT D;  3RFH A;  3EQ8 A;  3UVN A;  4JSX C;  5EM2 A;  3U4Y A;  2VDQ A;  3EI1 A;  3EI3 B;  3KCI A;  4JSV C;  4GGA A;  4JD2 C;  4FHL A;  3C75 H;  3IUL A;  3SLE D;  4AOW A;  1JV2 A;  2BBK H;  2QXV A;  5CYK A;  3I7O A;  3K6S A;  5GXH A;  4PBY A;  5JWZ A;  3NIF A;  4L3G D;  4GMB A;  1U2V C;  1SQJ A;  5A2Q g;  2OIZ A;  5C9Z B;  2H9M A;  1N6D A;  2VDN A;  1GP2 B;  4ERZ A;  3VI3 A;  4D0K A;  3I2N A;  3T3M A;  2P9N C;  3PVW B;  1TBG A;  3O4I A;  2J55 H;  4PNK B;  4E5Z B;  1MG3 A;  3I8C A;  4Z7O A;  2AH0 A;  4E54 A;  3ZWL B;  4GZ8 A;  1S4U X;  2H13 A;  2VC2 A;  3NVN A;  5FFG A;  2YMU A;  5K1C C;  1VZ3 A;  5FKS A;  4AMY A;  3I7K A;  3EI3 A;  5TEE A;  4A09 B;  4ERY A;  3NIG A;  5HYN B;  2B4E A;  2I3T A;  2I0T A;  5HE2 B;  4PSX B;  1TYQ C;  3OF7 A;  2I3S A;  3FRX A;  2PM6 B;  3EQ7 A;  4H5I A;  4WJK A;  4BCC A;  3L4M D;  1O6G A;  3RRM C;  3I7H A;  4L1M A;  4XYI A;  2BKL A;  3RN0 D;  3OKW A;  4X60 B;  2PM7 B;  3I89 A;  2O9K A;  1XIP A;  2EIE A;  4GGC A;  4A08 B;  5IC7 A;  4E5Z A;  4G56 B;  4O9D A;  4MMX A;  4J82 A;  4CY1 A;  3ZE2 A;  3BWS A;  2XL3 A;  4BP9 A;  3SXT D;  4PBZ A;  4LG9 A;  3JRO A;  2UZX B;  3JB9 L;  3NVQ A;  3B7F A;  4UI9 R;  4JSP C;  3MZK A;  3OKT A;  1H2Z A;  2VDO A;  1PEV A;  2Z2N A;  4A09 A;  2XDW A;  2EID A;  3AL9 A;  4R7A B;  5B4W A;  3V4V A;  1E5T A;  5AJA A;  5GXI A;  2Z2O A;  3UKR C;  2GNQ A;  5AFU 3;  3I8E A;  2HKM A;  3ZE1 A;  4QL1 A;  4EWR A;  5CXC B;  4JHN A;  2B5N A;  3J80 g;  1JJU B;  5FFO A;  2WQ8 A;  4ESG A;  5M61 A;  4ZOZ A;  3RLM D;  3FCS A;  3C5M A;  3GFC A;  5H17 A;  2HU8 A;  4BCD A;  3RN1 D;  2W18 A;  5EAR A;  4A08 A;  5EMK B;  3HFQ A;  4J79 A;  4IRZ A;  2XU7 A;  5EAP A;  4A0A B;  4H5J A;  4BP8 A;  1MDA H;  3MKQ A;  3EU7 A;  3UVK A;  4RE5 A;  5M5S A;  2HJ4 A;  1YR2 A;  1GOF A;  1C9L A;  1L5G A;  3SHF A;  4FAN D;  5GMK n;  2XYI A;  2P9P C;  4Z8L A;  3KRX B;  4J84 A;  3SBQ A;  1A0R B;  1P22 A;  4CI2 A;  3NID A;  4BH6 A;  5M5R A;  3V5W B;  1PI6 A;  4CI1 A;  3IIY A;  4A11 B;  1QFS A;  2CNX A;  2QR5 A;  3MZL A;  5CXC A;  1OLZ A;  3ORV D;  3I7L A;  3EI4 B;  3OTT A;  4J77 A;  3I7N A;  3ZDX A;  1U8C A;  1YFQ A;  4FA4 D;  1UOP A;  4CZV A;  3J81 g;  2IUP A;  4FWW A;  2AGX A;  3AL8 B;  3AH8 B;  4BUJ C;  3QHY B;  4PSW B;  1VE7 A;  4A0A A;  2AGZ A;  3GRE A;  4X61 B;  2HU7 A;  5I5M A;  3IJC A;  5EMJ B;  2VZ1 A;  4JXM A;  5M5U A;  3L4O D;  3W15 A;  2OK4 A;  4JSN C;  4J0W A;  4I79 A;  4CZX A;  1QFM A;  1T2X A;  4UM9 A;  2G9A A;  5IGO A;  4AX4 A;  3UVL A;  3OKY A;  5HQG A;  3SVW D;  3IUM A;  1GOT B;  1PBY B;  5IGQ A;  4A11 A;  1E8M A;  1N6F A;  3AFC A;  2G99 A;  4O1Q D;  3PSL A;  3CIK B;  5CXB B;  5EAL A;  3SBR A;  3E0C A;  2J57 G;  4ZOV A;  3EI4 A;  4CI3 A;  4AN1 A;  4A0B B;  5C92 A;  3AL8 A;  2OVP B;  4NAA A;  4QAM A;  5IJ8 E;  4DNW A;  3CFS B;  2TRC B;  2H47 A;  3IUQ A;  4PC0 A;  1GG2 B;  3IUR A;  3PSC B;  4A7J A;  4L3H D;  2H9N A;  1H2W A;  4L9O A;  1SHY B;  2CN3 A;  4YVD A;  3V4P A;  2HXC A;  2OVQ B;  5FXY A;  2CO0 A;  3SJL D;  3DM0 A;  4ZN4 A;  4MMY A;  2CN2 A;  4O02 A;  5HE3 B;  1QNI A;  3VGZ A;  2EIB A;  4XEI C;  5CXB A;  1U4C A;  3F3F A;  3IIW A;  5M5V A;  4MK0 B;  4GM9 A;  4O45 A;  5THA A;  3SBP A;  5E6U A;  2CE8 A;  4A0B A;  1PGU A;  1Q47 A;  2H9P A;  5HE0 B;  4IMM A;  2IUQ A;  5IJ7 E;  5GSA A;  4DNU A;  1NEX B;  3VH0 A;  3OW8 A;  5EMM B;  4G1E A;  1TYE A; 
#chains in the Genus database with same CATH homology
 4D6V A;  3UVM A;  2P9I C;  5FQD A;  3C9C A;  5HE1 B;  4LG8 A;  1NR0 A;  4K3J B;  3K26 A;  4ZOY A;  3PXS D;  2AGL A;  2UZY B;  3F3G A;  2H9L A;  3RMZ D;  4X3E A;  3JAM g;  4FB1 D;  3SFZ A;  4XYH A;  2HES X;  4QRJ A;  3SN6 B;  2IAA A;  4GQB B;  2IWK A;  5EAM A;  3JRP A;  4CY3 A;  4GGD A;  5I5I A;  5H1M A;  2Z2P A;  4BL0 A;  4OWR A;  4N14 A;  2H6Q A;  4Y7R A;  2XL2 A;  3BG1 A;  2YNP A;  1K32 A;  2IWF A;  3UR4 A;  4CY5 A;  2P9L C;  4JT5 C;  2B5L A;  3UVO A;  2YBA A;  2HJB A;  3MXX A;  4CZY A;  2P9K C;  2CE9 A;  3DWL C;  4QQE A;  2QC5 A;  2Q7Q A;  3OL2 B;  2CO0 C;  5KDO B;  3DXM C;  5H14 A;  2H3X A;  3PVU B;  4O3U B;  2H6N A;  3V9F A;  3I7P A;  4A2M A;  3DXK C;  5TF2 A;  5C2V B;  1XHM A;  3RFG A;  4A2L A;  3P4F A;  3FGB A;  1R5M A;  4J73 A;  4ES0 A;  1B9Y A;  5IT9 g;  3K27 A;  1ERJ A;  5FKR A;  1GXR A;  4J8B A;  5I5J A;  4J87 A;  4J81 A;  4FA5 D;  3FM0 A;  4FA9 D;  3JPX A;  5EML B;  1N6E A;  1B9X A;  2P9U C;  5K19 A;  4GM3 A;  3IJ0 A;  3NVX A;  3OL2 A;  4O3T B;  4GQ2 P;  2PM9 B;  4QT8 A;  2I0R A;  1L0Q A;  2OVR B;  5FA5 B;  4L1Q D;  4ZOX A;  5TEF A;  3C99 A;  2PBI B;  2AQ5 A;  3KRW B;  2IUR A;  3PXW D;  5FKQ A;  1XKS A;  2I0S A;  4J78 A;  4HDJ A;  3PE7 A;  4FA1 D;  2AGY A;  2YB8 B;  3JZH A;  4CI8 A;  3JZG A;  4Y5R D;  2AGW A;  2H14 A;  2H6K A;  4GM8 A;  4TZ4 A;  5C2W B;  3EI2 B;  3MMY A;  4J86 A;  1OMW B;  3F3P A;  3N0E A;  3IJ1 A;  2OK6 A;  3SMR A;  1MG2 A;  4PXW A;  3BG0 A;  2GC7 A;  2PM9 A;  3RSE C;  3MKS B;  4GQ1 A;  4CC9 A;  2HYE A;  4KFM B;  2H68 A;  3EG6 A;  4U7A A;  5FKT A;  3ODT A;  3ULE C;  2IUV A;  1SQ9 A;  2J56 H;  3CFV A;  5SXM A;  1JMZ B;  3JZN A;  2AH1 A;  4FAV D;  2EBS A;  3N0D A;  5TDH B;  2GC4 A;  4LGN A;  4J0X A;  1VYH C;  5EM2 B;  2BCJ B;  3EI1 B;  4U1E I;  4X63 B;  4IA9 A;  3EI2 A;  3V7D B;  5CYK B;  1K8K C;  4OZU A;  1FWX A;  1JOF A;  3A0F A;  3SWS D;  4K3I D;  3EMH A;  2YNO A;  2B5M A;  2HKR A;  2YNN A;  2P9S C;  4AEZ A;  2OJY A;  5FLX g;  4JT6 C;  3VA6 A;  4ERQ A;  4J8G A;  3UKU C;  3OKY B;  3IKO A;  1JMX B;  5AMS A;  3SCY A;  4NSX A;  4CY2 A;  2MTA H;  4E54 B;  1RI6 A;  3DSM A;  3EWE A;  3PXT D;  3RFH A;  3UVN A;  4JSX C;  5EM2 A;  3U4Y A;  3EI1 A;  3EI3 B;  4JSV C;  4GGA A;  4JD2 C;  4FHL A;  3C75 H;  3SLE D;  4AOW A;  2BBK H;  2QXV A;  5CYK A;  3I7O A;  5GXH A;  4PBY A;  5JWZ A;  4L3G D;  4GMB A;  1U2V C;  1SQJ A;  5A2Q g;  2OIZ A;  5C9Z B;  2H9M A;  1N6D A;  1GP2 B;  4ERZ A;  4D0K A;  3I2N A;  2P9N C;  3PVW B;  1TBG A;  2J55 H;  4PNK B;  4E5Z B;  1MG3 A;  3I8C A;  2AH0 A;  4E54 A;  3ZWL B;  4GZ8 A;  1S4U X;  2H13 A;  3NVN A;  2YMU A;  5K1C C;  5FKS A;  3I7K A;  3EI3 A;  5TEE A;  4A09 B;  4ERY A;  5HYN B;  2B4E A;  2I3T A;  2I0T A;  5HE2 B;  4PSX B;  1TYQ C;  2I3S A;  3FRX A;  2PM6 B;  4H5I A;  3L4M D;  3RRM C;  3I7H A;  4XYI A;  3RN0 D;  3OKW A;  4X60 B;  2PM7 B;  3I89 A;  2O9K A;  1XIP A;  4GGC A;  4A08 B;  5IC7 A;  4E5Z A;  4G56 B;  4O9D A;  4CY1 A;  4J82 A;  3BWS A;  2XL3 A;  3SXT D;  4PBZ A;  4LG9 A;  3JRO A;  2UZX B;  3JB9 L;  3NVQ A;  3B7F A;  4UI9 R;  4JSP C;  3MZK A;  3OKT A;  1PEV A;  2Z2N A;  4A09 A;  3AL9 A;  4R7A B;  5B4W A;  5AJA A;  5GXI A;  2Z2O A;  3UKR C;  2GNQ A;  5AFU 3;  3I8E A;  2HKM A;  4QL1 A;  4EWR A;  5CXC B;  2B5N A;  3J80 g;  1JJU B;  4ESG A;  4ZOZ A;  3RLM D;  3C5M A;  3GFC A;  5H17 A;  3RN1 D;  2W18 A;  5EAR A;  4A08 A;  5EMK B;  3HFQ A;  4J79 A;  2XU7 A;  5EAP A;  4A0A B;  4H5J A;  1MDA H;  3MKQ A;  3EU7 A;  3UVK A;  2HJ4 A;  3SHF A;  4FAN D;  5GMK n;  2XYI A;  2P9P C;  4Z8L A;  3KRX B;  4J84 A;  3SBQ A;  1A0R B;  1P22 A;  4CI2 A;  4BH6 A;  3V5W B;  1PI6 A;  4CI1 A;  3IIY A;  4A11 B;  2CNX A;  3MZL A;  5CXC A;  1OLZ A;  3ORV D;  3I7L A;  3EI4 B;  3OTT A;  4J77 A;  3I7N A;  1YFQ A;  4FA4 D;  4CZV A;  3J81 g;  2IUP A;  4FWW A;  2AGX A;  3AL8 B;  3AH8 B;  4BUJ C;  4PSW B;  4A0A A;  2AGZ A;  3GRE A;  4X61 B;  5I5M A;  3IJC A;  5EMJ B;  4JXM A;  3L4O D;  3W15 A;  2OK4 A;  4JSN C;  4J0W A;  4I79 A;  4CZX A;  5IGO A;  2G9A A;  3UVL A;  3OKY A;  5HQG A;  3SVW D;  1GOT B;  1PBY B;  5IGQ A;  4A11 A;  1N6F A;  3AFC A;  2G99 A;  4O1Q D;  3PSL A;  3CIK B;  5CXB B;  5EAL A;  3SBR A;  3E0C A;  2J57 G;  4ZOV A;  3EI4 A;  4CI3 A;  4A0B B;  3AL8 A;  2OVP B;  5IJ8 E;  3CFS B;  2TRC B;  2H47 A;  4PC0 A;  1GG2 B;  3PSC B;  4A7J A;  4L3H D;  2H9N A;  4L9O A;  2CN3 A;  1SHY B;  4YVD A;  2HXC A;  2OVQ B;  5FXY A;  2CO0 A;  3SJL D;  3DM0 A;  4ZN4 A;  2CN2 A;  5HE3 B;  1QNI A;  3VGZ A;  4XEI C;  5CXB A;  1U4C A;  3F3F A;  3IIW A;  4MK0 B;  4GM9 A;  4O45 A;  5THA A;  3SBP A;  2CE8 A;  4A0B A;  1PGU A;  1Q47 A;  2H9P A;  5HE0 B;  4IMM A;  2IUQ A;  5IJ7 E;  5GSA A;  1NEX B;  3VH0 A;  3OW8 A;  5EMM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...