4ZN4A

Crystal structure of sqt1 from chaetomium thermophilum solved by mr
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
483
structure length
409
Chain Sequence
ALENDSIAYFDGHKDSVFAIAQHPLYPNIVATGGSEGDADDAPGKGYVLDISATSLNPIFEIDGHTDSINALTFTLPRGDFLVSGGMDGRMRVYAVSVPQNGALAQFKFLAESQETEEINWFAPCPSPDHPNTIALGASDGSVWVFTLDNPVQIVQSYFLHTGPCTAGAWSPDGLLLATVSEDESLHVYDVFGVAASKSLVTDNGQTVVSLTNVDQRFAVEGGLFSVAVSPTGAVVAVGGAGGQIKIVGLPRLSQAGTILASLQIQSDNIESLAFSPSAPILAAGSTDGSIAVFDTSRSFALRRHLRGAHAEDPVVKVEFVKSPPNAAMAGWLLTSCGMDGVVRRWDLRGGTAGPGTLPHMAPSGLVKEWKGHRSGQEGGGVLGFVQGETGERIVTVGDDAVVLVFEAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sqt1
publication title Co-translational capturing of nascent ribosomal proteins by their dedicated chaperones.
pubmed doi rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
molecule tags Chaperone
total genus 105
structure length 409
sequence length 483
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4zn4A00
3C5MA 1JMXB 4GZ8A 4OWRA 3OTTA 1SHYB 5I5JA 4H5JA 5EALA 2XL2A 5B4WA 2MTAH 3SVWD 4FA9D 4CZXA 4LG9A 5HE2B 4FA5D 3F3FA 5TDHB 4JSNC 2AQ5A 2I3TA 1PI6A 2BCJB 2IUQA 3UKUC 2H3XA 5IJ7E 1PEVA 4PXWA 2CN3A 2H14A 2P9NC 2P9PC 5CXCA 2PBIB 3DSMA 5IT9g 5A2Qg 4A2LA 4L3GD 4O1QD 1VYHC 1U4CA 3ORVD 3SCYA 5SXMA 4JT5C 1NEXB 4ES0A 5HQGA 4A08B 2J56H 4L1QD 3I8EA 4ZOXA 1RI6A 3RN1D 2H9MA 2CNXA 1L0QA 3DM0A 3RSEC 3BWSA 2P9IC 2I0RA 3MKQA 2H9PA 4JT6C 4QQEA 4A09A 4U1EI 2H6QA 5TEFA 2CE9A 4D0KA 4FAVD 3I7NA 1JOFA 2HXCA 2QXVA 4Z8LA 4IMMA 4X63B 4A0BB 2GC7A 4E5ZA 2IWFA 3NVNA 3SN6B 3V5WB 2G9AA 3I7KA 3EWEA 3UVMA 4A09B 4FB1D 4HDJA 2IURA 3V9FA 1OMWB 4ZOYA 3EI3A 3C75H 3PSCB 3VGZA 2AGWA 1XKSA 4E5ZB 5IC7A 5FKSA 4CI2A 4CI1A 4A11A 3SJLD 3JB9L 4PSWB 1PGUA 3SWSD 4N14A 5IGOA 4BL0A 3C9CA 2OIZA 5I5IA 4L3HD 3VA6A 3EU7A 3W15A 4UI9R 1YFQA 2BBKH 5EMKB 4GMBA 4I79A 2B5NA 2I0SA 4J78A 4GQ1A 3B7FA 4X60B 3MZKA 2Q7QA 5THAA 2YNOA 4AOWA 4A11B 2XU7A 4J73A 3SHFA 1K8KC 4O45A 5AJAA 5GXHA 5IGQA 3RMZD 2GC4A 2OVRB 3CFVA 2Z2PA 2W18A 4J86A 3HFQA 3IIWA 3L4OD 4GM9A 2OVPB 4O3UB 2J55H 3AL8B 4FA1D 1B9YA 4U7AA 3OKWA 4CZYA 4JSPC 4PBZA 2GNQA 4ZN4A 4J79A 5K1CC 5TEEA 4JD2C 4XYHA 3UVOA 1MG2A 4A08A 1PBYB 3BG0A 4ERYA 3AFCA 5HYNB 2OK4A 1OLZA 3FM0A 3C99A 4NSXA 2I0TA 3MMYA 5HE1B 4GQ2P 2UZYB 3EI1A 3PVWB 4Y5RD 4TZ4A 5I5MA 4QL1A 2P9UC 4X3EA 1B9XA 3UR4A 4L9OA 3CFSB 2XYIA 2H68A 2IUPA 3V7DB 1A0RB 3EI4A 4O9DA 4CI3A 4ERZA 4QRJA 2UZXB 4A0BA 3MKSB 3GFCA 3AL9A 5EARA 4CC9A 4QT8A 3K27A 1K32A 3EI1B 5C2WB 5FKRA 4GGCA 4CI8A 2HJ4A 4A7JA 3PXTD 3JAMg 4JXMA 3EI4B 2HYEA 3OKYB 2YBAA 3EMHA 4AEZA 4OZUA 4JSXC 3SXTD 5GMKn 4JSVC 5FKQA 3JZNA 3RLMD 2B5MA 1SQJA 2Z2NA 4FA4D 1GXRA 3I89A 5EM2B 3MZLA 4PSXB 5AFU3 2AH0A 3ULEC 3J81g 2IAAA 2HESX 4GGAA 3RFGA 2AGXA 3J80g 5C2VB 4J8GA 5H17A 4YVDA 1QNIA 5TF2A 4K3ID 3I7PA 1MDAH 4EWRA 2P9KC 2J57G 3FRXA 2YNNA 5K19A 2I3SA 3AL8A 1R5MA 5CXBA 5FLXg 4GM3A 5GSAA 4ERQA 3VH0A 2Z2OA 2CE8A 1S4UX 2HJBA 2H6NA 4O3TB 5CYKA 2O9KA 3N0EA 4E54B 2H9NA 4CY3A 2IUVA 3P4FA 5CXBB 2HKRA 3RFHA 4FAND 1ERJA 4J0XA 5HE3B 4J77A 3NVXA 5CYKB 4A0AB 5EMJB 4CY5A 3FGBA 3IJ0A 1GG2B 2H13A 2H6KA 3N0DA 1N6DA 2AGYA 5FXYA 4FHLA 3OL2B 1P22A 3CIKB 4X61B 2EBSA 3U4YA 2CO0A 3ZWLB 1GOTB 3BG1A 3ODTA 4PC0A 3E0CA 4IA9A 3JZHA 5IJ8E 4KFMB 4GQBB 3I8CA 3KRXB 4A2MA 2TRCB 1JJUB 5EMLB 1JMZB 3PE7A 3OKYA 4BH6A 3MXXA 1Q47A 2B4EA 5H1MA 3EG6A 1FWXA 2P9SC 5GXIA 3OW8A 5HE0B 4J8BA 2H47A 3A0FA 3I7OA 4XEIC 3SMRA 4J81A 3SLED 2P9LC 2PM7B 4ZOVA 3PSLA 2YNPA 1TYQC 2YB8B 4XYIA 5EM2A 1GP2B 3SBRA 4CY2A 4R7AB 4G56B 5C9ZB 1TBGA 3KRWB 3NVQA 5CXCB 2IWKA 3I2NA 5JWZA 4LG8A 2PM6B 5FQDA 2YMUA 3PXWD 3AH8B 5KDOB 3IJCA 1U2VC 3RN0D 3OKTA 2AGZA 3PVUB 4H5IA 3JROA 4LGNA 2CO0C 3SFZA 3UVLA 2QC5A 3JZGA 4J0WA 4MK0B 2CN2A 3PXSD 3F3GA 3DXKC 3IIYA 4GM8A 4J84A 1SQ9A 4BUJC 3DWLC 1N6EA 3K26A 4FWWA 5EAPA 3UKRC 5EMMB 3UVNA 4E54A 3SBQA 3EI2A 4CZVA 3L4MD 3GREA 2PM9A 2G99A 1XHMA 2AH1A 4ZOZA 3IJ1A 5EAMA 5H14A 2OK6A 4PNKB 4A0AA 3RRMC 4PBYA 4J82A 1MG3A 4ESGA 3OL2A 3EI2B 2XL3A 3IKOA 5FA5B 2PM9B 2AGLA 3F3PA 4CY1A 3EI3B 3I7LA 2HKMA 1NR0A 3UVKA 2OJYA 4J87A 5AMSA 1XIPA 3JRPA 4GGDA 1N6FA 2B5LA 4Y7RA 3I7HA 4K3JB 2OVQB 5FKTA 4D6VA 2H9LA 3JPXA 3DXMC 3SBPA
chains in the Genus database with same CATH superfamily
3C5MA 1JMXB 4GZ8A 1C9LA 4OWRA 3OTTA 4Z7NA 4MMZA 1SHYB 5I5JA 4H5JA 2WQ8A 5EALA 2XL2A 5B4WA 2MTAH 3SVWD 4FA9D 4CZXA 4LG9A 5HE2B 4FA5D 3F3FA 3OF7A 5TDHB 4JSNC 2AQ5A 4NAAA 2I3TA 1PI6A 2BCJB 4NBMA 5C92A 2IUQA 3UKUC 3IULA 2H3XA 5IJ7E 1GOHA 1PEVA 4PXWA 2CN3A 1I2MB 4JHPC 2H14A 2P9NC 2P9PC 4UM9A 3EQ9A 5CXCA 3IUNA 2PBIB 3DSMA 3IUQA 5IT9g 5A2Qg 4A2LA 4L3GD 4O1QD 1VYHC 5FFOA 1U4CA 3ORVD 3SCYA 4MMYA 5SXMA 4JT5C 1NEXB 4ES0A 5HQGA 4A08B 2HU5A 2J56H 4L1QD 3I8EA 4ZOXA 1BPOA 1RI6A 3RN1D 2H9MA 2CNXA 1L0QA 2XZGA 3DM0A 3RSEC 4BCCA 3BWSA 2P9IC 2I0RA 3MKQA 2H9PA 2VDQA 4JT6C 2QZPA 5M5TA 4QQEA 3O4IA 2VZ3A 4A09A 4U1EI 2H6QA 5TEFA 2CE9A 4D0KA 1VZ2A 3QHYB 4FAVD 3T3MA 3I7NA 1JOFA 2HXCA 2QXVA 5M5RA 4Z8LA 4IMMA 4X63B 5M5VA 4A0BB 2GC7A 4E5ZA 2IWFA 3IJEA 3NVNA 3SN6B 3V5WB 3K72A 2G9AA 3I7KA 1H2XA 3EWEA 1JTDB 3GC3B 3UVMA 3K71A 4A09B 3V4VA 4FB1D 4HDJA 2IURA 2VDNA 1OMWB 3V9FA 4Z7OA 4ZOYA 2BKLA 3EI3A 3C75H 3PSCB 3VGZA 2AGWA 1XKSA 4E5ZB 5IC7A 4JHNA 5FKSA 4CI2A 4CI1A 4A11A 3SJLD 3JB9L 4PSWB 1PGUA 3SWSD 4N14A 5IGOA 4BL0A 3C9CA 2OIZA 5I5IA 4L3HD 1H2YA 3VA6A 4DNWA 1T2XA 4DNVA 3EU7A 3W15A 4UI9R 1YFQA 2BBKH 1JV2A 3IVMA 5EMKB 4GMBA 4I79A 2B5NA 2I0SA 4J78A 1VE6A 3B7FA 3IURA 3MZKA 4G55A 4GQ1A 4X60B 2Q7QA 5THAA 2YNOA 4AOWA 1A12A 4A11B 4BCBA 2XU7A 4J73A 4WK0A 3SHFA 1K8KC 4O45A 5AJAA 5GXHA 5IGQA 1E8NA 3MUOA 3RMZD 2GC4A 2OVRB 3CFVA 2Z2PA 2W18A 3MUNA 4J86A 3HFQA 3IIWA 3L4OD 1C9IA 4GM9A 2OVPB 4BP8A 4O3UB 2J55H 3AL8B 4FA1D 1B9YA 4WK4A 4U7AA 3OKWA 4CZYA 4JSPC 4PBZA 2GNQA 4BCDA 4ZN4A 4J79A 5K1CC 5TEEA 4JD2C 4XYHA 3UVOA 1MG2A 4A08A 1PBYB 3BG0A 4ERYA 3AFCA 3ZE2A 5HYNB 2OK4A 1OLZA 3FM0A 3C99A 4NSXA 2I0TA 3MMYA 5E6SA 5HE1B 3IUJA 4GQ2P 2UZYB 3ZE0A 3EI1A 1O6GA 3PVWB 4NENA 4TZ4A 4Y5RD 4QL1A 5I5MA 2P9UC 4X3EA 1B9XA 3UR4A 3CFSB 4L9OA 2XYIA 2H68A 2IUPA 3V7DB 1A0RB 3EI4A 4L1MA 4O9DA 4CI3A 4ERZA 4QRJA 3IUMA 1GOGA 3O4HA 2HU8A 2UZXB 4AN1A 4A0BA 2EIBA 3MKSB 3ZDZA 3GFCA 3AL9A 5EARA 4CC9A 4QT8A 4MMXA 3K27A 1K32A 3EI1B 5C2WB 5FKRA 4GGCA 4CI8A 2HJ4A 4A7JA 3PXTD 3JAMg 4JXMA 3EI4B 2HYEA 3OKYB 1YR2A 2YBAA 3V4PA 3EMHA 4AEZA 4JSXC 4O02A 4OZUA 3SXTD 5GMKn 4NC4A 4RE5A 4JSVC 5FKQA 3JZNA 3RLMD 2B5MA 1SQJA 2Z2NA 1E5TA 4FA4D 1GXRA 3I89A 5EM2B 1H2WA 3MZLA 4PSXB 5AFU3 2AH0A 3ULEC 4AMZA 3J81g 2IAAA 2HESX 4BP9A 4GGAA 1K3IA 3RFGA 2AGXA 3J80g 5C2VB 4J8GA 5H17A 4YVDA 4AMYA 2VC2A 1QNIA 4G1MA 4UM8A 5TF2A 4K3ID 3I7PA 1MDAH 4EWRA 2P9KC 2J57G 3FRXA 2YNNA 5K19A 2I3SA 3AL8A 1R5MA 5CXBA 5FLXg 4GM3A 5GSAA 4ERQA 3VH0A 2Z2OA 4O2WA 2CE8A 1S4UX 2HJBA 2H6NA 1UOOA 4O3TB 5CYKA 2O9KA 1UOPA 1VZ3A 3QI0A 3DDUA 4AN0A 3N0EA 4E54B 2H9NA 1UOQA 4CY3A 2IUVA 3P4FA 1U8CA 5CXBB 3ZDXA 2HKRA 3RFHA 4FAND 1ERJA 4J0XA 5HE3B 4J77A 1TYEA 1UTCA 5HDBA 3KCIA 3NVXA 5CYKB 4A0AB 5EMJB 4CY5A 3FGBA 3IJ0A 3EQ8A 1GG2B 2H13A 2H6KA 3MVDK 3N0DA 1N6DA 2AGYA 5FXYA 4FHLA 3OL2B 1QFSA 1P22A 3CIKB 3ZE1A 2EICA 1M1XA 4X61B 2EBSA 5E6RA 3U4YA 2CO0A 4QAMA 3ZWLB 1GOTB 3BG1A 3ODTA 4PC0A 3E0CA 4IA9A 3JZHA 5IJ8E 4KFMB 4GQBB 3I8CA 3KRXB 4A2MA 2TRCB 4D9SA 1JJUB 2JKXA 5EMLB 1JMZB 3T3PA 3PE7A 3OKYA 4BH6A 3MXXA 1Q47A 2B4EA 5H1MA 3EG6A 1FWXA 2P9SC 5GXIA 1E8MA 3VI4A 3OW8A 5HE0B 4J8BA 2H47A 3A0FA 2XDWA 3I7OA 4XEIC 2VDMA 4J81A 3SMRA 3SLED 2P9LC 2PM7B 2VDPA 3VI3A 4ZOVA 1GOFA 3PSLA 2YNPA 2VDOA 1TYQC 2YB8B 4XYIA 5EM2A 1GP2B 2VDKA 3SBRA 4CY2A 4R7AB 4G56B 5C9ZB 1TBGA 3KRWB 3NVQA 4RE6A 5CXCB 2IWKA 5C86A 3I2NA 5JWZA 4LG8A 2PM6B 5FQDA 3K6SA 2YMUA 3PXWD 3EQ7A 2VDLA 3AH8B 5KDOB 3IJCA 1U2VC 3RN0D 3OKTA 2AGZA 3NIGA 3PVUB 3O4JA 4H5IA 3JROA 4LGNA 2CO0C 3SFZA 5FFGA 3UVLA 2QC5A 3JZGA 4J0WA 4MK0B 2CN2A 3PXSD 1H2ZA 3F3GA 3DXKC 3IIYA 4GM8A 4J84A 1SQ9A 4BUJC 1L5GA 3DWLC 1N6EA 5M5SA 3K26A 4FWWA 5EAPA 3UKRC 5EMMB 3UVNA 2EIEA 4E54A 3SBQA 3EI2A 2QR5A 4CZVA 4G1EA 3L4MD 3GREA 2PM9A 2G99A 4AX4A 1XHMA 2AH1A 4ZOZA 3IJ1A 5EAMA 5H14A 5E6UA 2OK6A 3O4GA 4PNKB 4WK2A 3ZDYA 4A0AA 3RRMC 3NIFA 4PBYA 1QFMA 4J82A 1MG3A 4IRZA 4ESGA 3OL2A 3EI2B 2HU7A 2VZ1A 1VE7A 2XL3A 3FCSA 3IKOA 2EIDA 2VDRA 1O6FA 5FA5B 2PM9B 2AGLA 3F3PA 3GD1I 4CY1A 3EI3B 3I7LA 5M5UA 4WJKA 2HKMA 1NR0A 3UVKA 2OJYA 5M61A 4J87A 5AMSA 1XIPA 4DNUA 2XE4A 3JRPA 4GGDA 1N6FA 2B5LA 3FCUA 4Y7RA 4Z7QA 3I7HA 4K3JB 2OVQB 5FKTA 3NIDA 4D6VA 2H9LA 3JPXA 3DXMC 3SBPA
chains in the Genus database with same CATH topology
3C5MA 1JMXB 4GZ8A 4OWRA 3OTTA 1SHYB 5I5JA 4H5JA 5EALA 2XL2A 5B4WA 2MTAH 3SVWD 4FA9D 4CZXA 4LG9A 5HE2B 4FA5D 3F3FA 5TDHB 4JSNC 2AQ5A 2I3TA 1PI6A 2BCJB 2IUQA 3UKUC 2H3XA 5IJ7E 1PEVA 4PXWA 2CN3A 2H14A 2P9NC 2P9PC 5CXCA 2PBIB 3DSMA 5IT9g 5A2Qg 4A2LA 4L3GD 4O1QD 1VYHC 1U4CA 3ORVD 3SCYA 5SXMA 4JT5C 1NEXB 4ES0A 5HQGA 4A08B 2J56H 4L1QD 3I8EA 4ZOXA 1RI6A 3RN1D 2H9MA 2CNXA 1L0QA 3DM0A 3RSEC 3BWSA 2P9IC 2I0RA 3MKQA 2H9PA 4JT6C 4QQEA 4A09A 4U1EI 2H6QA 5TEFA 2CE9A 4D0KA 4FAVD 3I7NA 1JOFA 2HXCA 2QXVA 4Z8LA 4IMMA 4X63B 4A0BB 2GC7A 4E5ZA 2IWFA 3NVNA 3SN6B 3V5WB 2G9AA 3I7KA 3EWEA 3UVMA 4A09B 4FB1D 4HDJA 2IURA 3V9FA 1OMWB 4ZOYA 3EI3A 3C75H 3PSCB 3VGZA 2AGWA 1XKSA 4E5ZB 5IC7A 5FKSA 4CI2A 4CI1A 4A11A 3SJLD 3JB9L 4PSWB 1PGUA 3SWSD 4N14A 5IGOA 4BL0A 3C9CA 2OIZA 5I5IA 4L3HD 3VA6A 3EU7A 3W15A 4UI9R 1YFQA 2BBKH 5EMKB 4GMBA 4I79A 2B5NA 2I0SA 4J78A 4GQ1A 3B7FA 4X60B 3MZKA 2Q7QA 5THAA 2YNOA 4AOWA 4A11B 2XU7A 4J73A 3SHFA 1K8KC 4O45A 5AJAA 5GXHA 5IGQA 3RMZD 2GC4A 2OVRB 3CFVA 2Z2PA 2W18A 4J86A 3HFQA 3IIWA 3L4OD 4GM9A 2OVPB 4O3UB 2J55H 3AL8B 4FA1D 1B9YA 4U7AA 3OKWA 4CZYA 4JSPC 4PBZA 2GNQA 4ZN4A 4J79A 5K1CC 5TEEA 4JD2C 4XYHA 3UVOA 1MG2A 4A08A 1PBYB 3BG0A 4ERYA 3AFCA 5HYNB 2OK4A 1OLZA 3FM0A 3C99A 4NSXA 2I0TA 3MMYA 5HE1B 4GQ2P 2UZYB 3EI1A 3PVWB 4Y5RD 4TZ4A 5I5MA 4QL1A 2P9UC 4X3EA 1B9XA 3UR4A 4L9OA 3CFSB 2XYIA 2H68A 2IUPA 3V7DB 1A0RB 3EI4A 4O9DA 4CI3A 4ERZA 4QRJA 2UZXB 4A0BA 3MKSB 3GFCA 3AL9A 5EARA 4CC9A 4QT8A 3K27A 1K32A 3EI1B 5C2WB 5FKRA 4GGCA 4CI8A 2HJ4A 4A7JA 3PXTD 3JAMg 4JXMA 3EI4B 2HYEA 3OKYB 2YBAA 3EMHA 4AEZA 4OZUA 4JSXC 3SXTD 5GMKn 4JSVC 5FKQA 3JZNA 3RLMD 2B5MA 1SQJA 2Z2NA 4FA4D 1GXRA 3I89A 5EM2B 3MZLA 4PSXB 5AFU3 2AH0A 3ULEC 3J81g 2IAAA 2HESX 4GGAA 3RFGA 2AGXA 3J80g 5C2VB 4J8GA 5H17A 4YVDA 1QNIA 5TF2A 4K3ID 3I7PA 1MDAH 4EWRA 2P9KC 2J57G 3FRXA 2YNNA 5K19A 2I3SA 3AL8A 1R5MA 5CXBA 5FLXg 4GM3A 5GSAA 4ERQA 3VH0A 2Z2OA 2CE8A 1S4UX 2HJBA 2H6NA 4O3TB 5CYKA 2O9KA 3N0EA 4E54B 2H9NA 4CY3A 2IUVA 3P4FA 5CXBB 2HKRA 3RFHA 4FAND 1ERJA 4J0XA 5HE3B 4J77A 3NVXA 5CYKB 4A0AB 5EMJB 4CY5A 3FGBA 3IJ0A 1GG2B 2H13A 2H6KA 3N0DA 1N6DA 2AGYA 5FXYA 4FHLA 3OL2B 1P22A 3CIKB 4X61B 2EBSA 3U4YA 2CO0A 3ZWLB 1GOTB 3BG1A 3ODTA 4PC0A 3E0CA 4IA9A 3JZHA 5IJ8E 4KFMB 4GQBB 3I8CA 3KRXB 4A2MA 2TRCB 1JJUB 5EMLB 1JMZB 3PE7A 3OKYA 4BH6A 3MXXA 1Q47A 2B4EA 5H1MA 3EG6A 1FWXA 2P9SC 5GXIA 3OW8A 5HE0B 4J8BA 2H47A 3A0FA 3I7OA 4XEIC 3SMRA 4J81A 3SLED 2P9LC 2PM7B 4ZOVA 3PSLA 2YNPA 1TYQC 2YB8B 4XYIA 5EM2A 1GP2B 3SBRA 4CY2A 4R7AB 4G56B 5C9ZB 1TBGA 3KRWB 3NVQA 5CXCB 2IWKA 3I2NA 5JWZA 4LG8A 2PM6B 5FQDA 2YMUA 3PXWD 3AH8B 5KDOB 3IJCA 1U2VC 3RN0D 3OKTA 2AGZA 3PVUB 4H5IA 3JROA 4LGNA 2CO0C 3SFZA 3UVLA 2QC5A 3JZGA 4J0WA 4MK0B 2CN2A 3PXSD 3F3GA 3DXKC 3IIYA 4GM8A 4J84A 1SQ9A 4BUJC 3DWLC 1N6EA 3K26A 4FWWA 5EAPA 3UKRC 5EMMB 3UVNA 4E54A 3SBQA 3EI2A 4CZVA 3L4MD 3GREA 2PM9A 2G99A 1XHMA 2AH1A 4ZOZA 3IJ1A 5EAMA 5H14A 2OK6A 4PNKB 4A0AA 3RRMC 4PBYA 4J82A 1MG3A 4ESGA 3OL2A 3EI2B 2XL3A 3IKOA 5FA5B 2PM9B 2AGLA 3F3PA 4CY1A 3EI3B 3I7LA 2HKMA 1NR0A 3UVKA 2OJYA 4J87A 5AMSA 1XIPA 3JRPA 4GGDA 1N6FA 2B5LA 4Y7RA 3I7HA 4K3JB 2OVQB 5FKTA 4D6VA 2H9LA 3JPXA 3DXMC 3SBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5M A;  1JMX B;  4GZ8 A;  4OWR A;  3OTT A;  1SHY B;  5I5J A;  4H5J A;  5EAL A;  2XL2 A;  5B4W A;  2MTA H;  3SVW D;  4FA9 D;  4CZX A;  4LG9 A;  5HE2 B;  4FA5 D;  3F3F A;  5TDH B;  4JSN C;  2AQ5 A;  2I3T A;  1PI6 A;  2BCJ B;  2IUQ A;  3UKU C;  2H3X A;  5IJ7 E;  1PEV A;  4PXW A;  2CN3 A;  2H14 A;  2P9N C;  2P9P C;  5CXC A;  2PBI B;  3DSM A;  5IT9 g;  5A2Q g;  4A2L A;  4L3G D;  4O1Q D;  1VYH C;  1U4C A;  3ORV D;  3SCY A;  5SXM A;  4JT5 C;  1NEX B;  4ES0 A;  5HQG A;  4A08 B;  2J56 H;  4L1Q D;  3I8E A;  4ZOX A;  1RI6 A;  3RN1 D;  2H9M A;  2CNX A;  1L0Q A;  3DM0 A;  3RSE C;  3BWS A;  2P9I C;  2I0R A;  3MKQ A;  2H9P A;  4JT6 C;  4QQE A;  4A09 A;  4U1E I;  2H6Q A;  5TEF A;  2CE9 A;  4D0K A;  4FAV D;  3I7N A;  1JOF A;  2HXC A;  2QXV A;  4Z8L A;  4IMM A;  4X63 B;  4A0B B;  2GC7 A;  4E5Z A;  2IWF A;  3NVN A;  3SN6 B;  3V5W B;  2G9A A;  3I7K A;  3EWE A;  3UVM A;  4A09 B;  4FB1 D;  4HDJ A;  2IUR A;  3V9F A;  1OMW B;  4ZOY A;  3EI3 A;  3C75 H;  3PSC B;  3VGZ A;  2AGW A;  1XKS A;  4E5Z B;  5IC7 A;  5FKS A;  4CI2 A;  4CI1 A;  4A11 A;  3SJL D;  3JB9 L;  4PSW B;  1PGU A;  3SWS D;  4N14 A;  5IGO A;  4BL0 A;  3C9C A;  2OIZ A;  5I5I A;  4L3H D;  3VA6 A;  3EU7 A;  3W15 A;  4UI9 R;  1YFQ A;  2BBK H;  5EMK B;  4GMB A;  4I79 A;  2B5N A;  2I0S A;  4J78 A;  4GQ1 A;  3B7F A;  4X60 B;  3MZK A;  2Q7Q A;  5THA A;  2YNO A;  4AOW A;  4A11 B;  2XU7 A;  4J73 A;  3SHF A;  1K8K C;  4O45 A;  5AJA A;  5GXH A;  5IGQ A;  3RMZ D;  2GC4 A;  2OVR B;  3CFV A;  2Z2P A;  2W18 A;  4J86 A;  3HFQ A;  3IIW A;  3L4O D;  4GM9 A;  2OVP B;  4O3U B;  2J55 H;  3AL8 B;  4FA1 D;  1B9Y A;  4U7A A;  3OKW A;  4CZY A;  4JSP C;  4PBZ A;  2GNQ A;  4ZN4 A;  4J79 A;  5K1C C;  5TEE A;  4JD2 C;  4XYH A;  3UVO A;  1MG2 A;  4A08 A;  1PBY B;  3BG0 A;  4ERY A;  3AFC A;  5HYN B;  2OK4 A;  1OLZ A;  3FM0 A;  3C99 A;  4NSX A;  2I0T A;  3MMY A;  5HE1 B;  4GQ2 P;  2UZY B;  3EI1 A;  3PVW B;  4Y5R D;  4TZ4 A;  5I5M A;  4QL1 A;  2P9U C;  4X3E A;  1B9X A;  3UR4 A;  4L9O A;  3CFS B;  2XYI A;  2H68 A;  2IUP A;  3V7D B;  1A0R B;  3EI4 A;  4O9D A;  4CI3 A;  4ERZ A;  4QRJ A;  2UZX B;  4A0B A;  3MKS B;  3GFC A;  3AL9 A;  5EAR A;  4CC9 A;  4QT8 A;  3K27 A;  1K32 A;  3EI1 B;  5C2W B;  5FKR A;  4GGC A;  4CI8 A;  2HJ4 A;  4A7J A;  3PXT D;  3JAM g;  4JXM A;  3EI4 B;  2HYE A;  3OKY B;  2YBA A;  3EMH A;  4AEZ A;  4OZU A;  4JSX C;  3SXT D;  5GMK n;  4JSV C;  5FKQ A;  3JZN A;  3RLM D;  2B5M A;  1SQJ A;  2Z2N A;  4FA4 D;  1GXR A;  3I89 A;  5EM2 B;  3MZL A;  4PSX B;  5AFU 3;  2AH0 A;  3ULE C;  3J81 g;  2IAA A;  2HES X;  4GGA A;  3RFG A;  2AGX A;  3J80 g;  5C2V B;  4J8G A;  5H17 A;  4YVD A;  1QNI A;  5TF2 A;  4K3I D;  3I7P A;  1MDA H;  4EWR A;  2P9K C;  2J57 G;  3FRX A;  2YNN A;  5K19 A;  2I3S A;  3AL8 A;  1R5M A;  5CXB A;  5FLX g;  4GM3 A;  5GSA A;  4ERQ A;  3VH0 A;  2Z2O A;  2CE8 A;  1S4U X;  2HJB A;  2H6N A;  4O3T B;  5CYK A;  2O9K A;  3N0E A;  4E54 B;  2H9N A;  4CY3 A;  2IUV A;  3P4F A;  5CXB B;  2HKR A;  3RFH A;  4FAN D;  1ERJ A;  4J0X A;  5HE3 B;  4J77 A;  3NVX A;  5CYK B;  4A0A B;  5EMJ B;  4CY5 A;  3FGB A;  3IJ0 A;  1GG2 B;  2H13 A;  2H6K A;  3N0D A;  1N6D A;  2AGY A;  5FXY A;  4FHL A;  3OL2 B;  1P22 A;  3CIK B;  4X61 B;  2EBS A;  3U4Y A;  2CO0 A;  3ZWL B;  1GOT B;  3BG1 A;  3ODT A;  4PC0 A;  3E0C A;  4IA9 A;  3JZH A;  5IJ8 E;  4KFM B;  4GQB B;  3I8C A;  3KRX B;  4A2M A;  2TRC B;  1JJU B;  5EML B;  1JMZ B;  3PE7 A;  3OKY A;  4BH6 A;  3MXX A;  1Q47 A;  2B4E A;  5H1M A;  3EG6 A;  1FWX A;  2P9S C;  5GXI A;  3OW8 A;  5HE0 B;  4J8B A;  2H47 A;  3A0F A;  3I7O A;  4XEI C;  3SMR A;  4J81 A;  3SLE D;  2P9L C;  2PM7 B;  4ZOV A;  3PSL A;  2YNP A;  1TYQ C;  2YB8 B;  4XYI A;  5EM2 A;  1GP2 B;  3SBR A;  4CY2 A;  4R7A B;  4G56 B;  5C9Z B;  1TBG A;  3KRW B;  3NVQ A;  5CXC B;  2IWK A;  3I2N A;  5JWZ A;  4LG8 A;  2PM6 B;  5FQD A;  2YMU A;  3PXW D;  3AH8 B;  5KDO B;  3IJC A;  1U2V C;  3RN0 D;  3OKT A;  2AGZ A;  3PVU B;  4H5I A;  3JRO A;  4LGN A;  2CO0 C;  3SFZ A;  3UVL A;  2QC5 A;  3JZG A;  4J0W A;  4MK0 B;  2CN2 A;  3PXS D;  3F3G A;  3DXK C;  3IIY A;  4GM8 A;  4J84 A;  1SQ9 A;  4BUJ C;  3DWL C;  1N6E A;  3K26 A;  4FWW A;  5EAP A;  3UKR C;  5EMM B;  3UVN A;  4E54 A;  3SBQ A;  3EI2 A;  4CZV A;  3L4M D;  3GRE A;  2PM9 A;  2G99 A;  1XHM A;  2AH1 A;  4ZOZ A;  3IJ1 A;  5EAM A;  5H14 A;  2OK6 A;  4PNK B;  4A0A A;  3RRM C;  4PBY A;  4J82 A;  1MG3 A;  4ESG A;  3OL2 A;  3EI2 B;  2XL3 A;  3IKO A;  5FA5 B;  2PM9 B;  2AGL A;  3F3P A;  4CY1 A;  3EI3 B;  3I7L A;  2HKM A;  1NR0 A;  3UVK A;  2OJY A;  4J87 A;  5AMS A;  1XIP A;  3JRP A;  4GGD A;  1N6F A;  2B5L A;  4Y7R A;  3I7H A;  4K3J B;  2OVQ B;  5FKT A;  4D6V A;  2H9L A;  3JPX A;  3DXM C;  3SBP A; 
#chains in the Genus database with same CATH topology
 3C5M A;  1JMX B;  4GZ8 A;  1C9L A;  4OWR A;  3OTT A;  4Z7N A;  4MMZ A;  1SHY B;  5I5J A;  4H5J A;  2WQ8 A;  5EAL A;  2XL2 A;  5B4W A;  2MTA H;  3SVW D;  4FA9 D;  4CZX A;  4LG9 A;  5HE2 B;  4FA5 D;  3F3F A;  3OF7 A;  5TDH B;  4JSN C;  2AQ5 A;  4NAA A;  2I3T A;  1PI6 A;  2BCJ B;  4NBM A;  5C92 A;  2IUQ A;  3UKU C;  3IUL A;  2H3X A;  5IJ7 E;  1GOH A;  1PEV A;  4PXW A;  2CN3 A;  1I2M B;  4JHP C;  2H14 A;  2P9N C;  2P9P C;  4UM9 A;  3EQ9 A;  5CXC A;  3IUN A;  2PBI B;  3DSM A;  3IUQ A;  5IT9 g;  5A2Q g;  4A2L A;  4L3G D;  4O1Q D;  1VYH C;  5FFO A;  1U4C A;  3ORV D;  3SCY A;  4MMY A;  5SXM A;  4JT5 C;  1NEX B;  4ES0 A;  5HQG A;  4A08 B;  2HU5 A;  2J56 H;  4L1Q D;  3I8E A;  4ZOX A;  1BPO A;  1RI6 A;  3RN1 D;  2H9M A;  2CNX A;  1L0Q A;  2XZG A;  3DM0 A;  3RSE C;  4BCC A;  3BWS A;  2P9I C;  2I0R A;  3MKQ A;  2H9P A;  2VDQ A;  4JT6 C;  2QZP A;  5M5T A;  4QQE A;  3O4I A;  2VZ3 A;  4A09 A;  4U1E I;  2H6Q A;  5TEF A;  2CE9 A;  4D0K A;  1VZ2 A;  3QHY B;  4FAV D;  3T3M A;  3I7N A;  1JOF A;  2HXC A;  2QXV A;  5M5R A;  4Z8L A;  4IMM A;  4X63 B;  5M5V A;  4A0B B;  2GC7 A;  4E5Z A;  2IWF A;  3IJE A;  3NVN A;  3SN6 B;  3V5W B;  3K72 A;  2G9A A;  3I7K A;  1H2X A;  3EWE A;  1JTD B;  3GC3 B;  3UVM A;  3K71 A;  4A09 B;  3V4V A;  4FB1 D;  4HDJ A;  2IUR A;  2VDN A;  1OMW B;  3V9F A;  4Z7O A;  4ZOY A;  2BKL A;  3EI3 A;  3C75 H;  3PSC B;  3VGZ A;  2AGW A;  1XKS A;  4E5Z B;  5IC7 A;  4JHN A;  5FKS A;  4CI2 A;  4CI1 A;  4A11 A;  3SJL D;  3JB9 L;  4PSW B;  1PGU A;  3SWS D;  4N14 A;  5IGO A;  4BL0 A;  3C9C A;  2OIZ A;  5I5I A;  4L3H D;  1H2Y A;  3VA6 A;  4DNW A;  1T2X A;  4DNV A;  3EU7 A;  3W15 A;  4UI9 R;  1YFQ A;  2BBK H;  1JV2 A;  3IVM A;  5EMK B;  4GMB A;  4I79 A;  2B5N A;  2I0S A;  4J78 A;  1VE6 A;  3B7F A;  3IUR A;  3MZK A;  4G55 A;  4GQ1 A;  4X60 B;  2Q7Q A;  5THA A;  2YNO A;  4AOW A;  1A12 A;  4A11 B;  4BCB A;  2XU7 A;  4J73 A;  4WK0 A;  3SHF A;  1K8K C;  4O45 A;  5AJA A;  5GXH A;  5IGQ A;  1E8N A;  3MUO A;  3RMZ D;  2GC4 A;  2OVR B;  3CFV A;  2Z2P A;  2W18 A;  3MUN A;  4J86 A;  3HFQ A;  3IIW A;  3L4O D;  1C9I A;  4GM9 A;  2OVP B;  4BP8 A;  4O3U B;  2J55 H;  3AL8 B;  4FA1 D;  1B9Y A;  4WK4 A;  4U7A A;  3OKW A;  4CZY A;  4JSP C;  4PBZ A;  2GNQ A;  4BCD A;  4ZN4 A;  4J79 A;  5K1C C;  5TEE A;  4JD2 C;  4XYH A;  3UVO A;  1MG2 A;  4A08 A;  1PBY B;  3BG0 A;  4ERY A;  3AFC A;  3ZE2 A;  5HYN B;  2OK4 A;  1OLZ A;  3FM0 A;  3C99 A;  4NSX A;  2I0T A;  3MMY A;  5E6S A;  5HE1 B;  3IUJ A;  4GQ2 P;  2UZY B;  3ZE0 A;  3EI1 A;  1O6G A;  3PVW B;  4NEN A;  4TZ4 A;  4Y5R D;  4QL1 A;  5I5M A;  2P9U C;  4X3E A;  1B9X A;  3UR4 A;  3CFS B;  4L9O A;  2XYI A;  2H68 A;  2IUP A;  3V7D B;  1A0R B;  3EI4 A;  4L1M A;  4O9D A;  4CI3 A;  4ERZ A;  4QRJ A;  3IUM A;  1GOG A;  3O4H A;  2HU8 A;  2UZX B;  4AN1 A;  4A0B A;  2EIB A;  3MKS B;  3ZDZ A;  3GFC A;  3AL9 A;  5EAR A;  4CC9 A;  4QT8 A;  4MMX A;  3K27 A;  1K32 A;  3EI1 B;  5C2W B;  5FKR A;  4GGC A;  4CI8 A;  2HJ4 A;  4A7J A;  3PXT D;  3JAM g;  4JXM A;  3EI4 B;  2HYE A;  3OKY B;  1YR2 A;  2YBA A;  3V4P A;  3EMH A;  4AEZ A;  4JSX C;  4O02 A;  4OZU A;  3SXT D;  5GMK n;  4NC4 A;  4RE5 A;  4JSV C;  5FKQ A;  3JZN A;  3RLM D;  2B5M A;  1SQJ A;  2Z2N A;  1E5T A;  4FA4 D;  1GXR A;  3I89 A;  5EM2 B;  1H2W A;  3MZL A;  4PSX B;  5AFU 3;  2AH0 A;  3ULE C;  4AMZ A;  3J81 g;  2IAA A;  2HES X;  4BP9 A;  4GGA A;  1K3I A;  3RFG A;  2AGX A;  3J80 g;  5C2V B;  4J8G A;  5H17 A;  4YVD A;  4AMY A;  2VC2 A;  1QNI A;  4G1M A;  4UM8 A;  5TF2 A;  4K3I D;  3I7P A;  1MDA H;  4EWR A;  2P9K C;  2J57 G;  3FRX A;  2YNN A;  5K19 A;  2I3S A;  3AL8 A;  1R5M A;  5CXB A;  5FLX g;  4GM3 A;  5GSA A;  4ERQ A;  3VH0 A;  2Z2O A;  4O2W A;  2CE8 A;  1S4U X;  2HJB A;  2H6N A;  1UOO A;  4O3T B;  5CYK A;  2O9K A;  1UOP A;  1VZ3 A;  3QI0 A;  3DDU A;  4AN0 A;  3N0E A;  4E54 B;  2H9N A;  1UOQ A;  4CY3 A;  2IUV A;  3P4F A;  1U8C A;  5CXB B;  3ZDX A;  2HKR A;  3RFH A;  4FAN D;  1ERJ A;  4J0X A;  5HE3 B;  4J77 A;  1TYE A;  1UTC A;  5HDB A;  3KCI A;  3NVX A;  5CYK B;  4A0A B;  5EMJ B;  4CY5 A;  3FGB A;  3IJ0 A;  3EQ8 A;  1GG2 B;  2H13 A;  2H6K A;  3MVD K;  3N0D A;  1N6D A;  2AGY A;  5FXY A;  4FHL A;  3OL2 B;  1QFS A;  1P22 A;  3CIK B;  3ZE1 A;  2EIC A;  1M1X A;  4X61 B;  2EBS A;  5E6R A;  3U4Y A;  2CO0 A;  4QAM A;  3ZWL B;  1GOT B;  3BG1 A;  3ODT A;  4PC0 A;  3E0C A;  4IA9 A;  3JZH A;  5IJ8 E;  4KFM B;  4GQB B;  3I8C A;  3KRX B;  4A2M A;  2TRC B;  4D9S A;  1JJU B;  2JKX A;  5EML B;  1JMZ B;  3T3P A;  3PE7 A;  3OKY A;  4BH6 A;  3MXX A;  1Q47 A;  2B4E A;  5H1M A;  3EG6 A;  1FWX A;  2P9S C;  5GXI A;  1E8M A;  3VI4 A;  3OW8 A;  5HE0 B;  4J8B A;  2H47 A;  3A0F A;  2XDW A;  3I7O A;  4XEI C;  2VDM A;  4J81 A;  3SMR A;  3SLE D;  2P9L C;  2PM7 B;  2VDP A;  3VI3 A;  4ZOV A;  1GOF A;  3PSL A;  2YNP A;  2VDO A;  1TYQ C;  2YB8 B;  4XYI A;  5EM2 A;  1GP2 B;  2VDK A;  3SBR A;  4CY2 A;  4R7A B;  4G56 B;  5C9Z B;  1TBG A;  3KRW B;  3NVQ A;  4RE6 A;  5CXC B;  2IWK A;  5C86 A;  3I2N A;  5JWZ A;  4LG8 A;  2PM6 B;  5FQD A;  3K6S A;  2YMU A;  3PXW D;  3EQ7 A;  2VDL A;  3AH8 B;  5KDO B;  3IJC A;  1U2V C;  3RN0 D;  3OKT A;  2AGZ A;  3NIG A;  3PVU B;  3O4J A;  4H5I A;  3JRO A;  4LGN A;  2CO0 C;  3SFZ A;  5FFG A;  3UVL A;  2QC5 A;  3JZG A;  4J0W A;  4MK0 B;  2CN2 A;  3PXS D;  1H2Z A;  3F3G A;  3DXK C;  3IIY A;  4GM8 A;  4J84 A;  1SQ9 A;  4BUJ C;  1L5G A;  3DWL C;  1N6E A;  5M5S A;  3K26 A;  4FWW A;  5EAP A;  3UKR C;  5EMM B;  3UVN A;  2EIE A;  4E54 A;  3SBQ A;  3EI2 A;  2QR5 A;  4CZV A;  4G1E A;  3L4M D;  3GRE A;  2PM9 A;  2G99 A;  4AX4 A;  1XHM A;  2AH1 A;  4ZOZ A;  3IJ1 A;  5EAM A;  5H14 A;  5E6U A;  2OK6 A;  3O4G A;  4PNK B;  4WK2 A;  3ZDY A;  4A0A A;  3RRM C;  3NIF A;  4PBY A;  1QFM A;  4J82 A;  1MG3 A;  4IRZ A;  4ESG A;  3OL2 A;  3EI2 B;  2HU7 A;  2VZ1 A;  1VE7 A;  2XL3 A;  3FCS A;  3IKO A;  2EID A;  2VDR A;  1O6F A;  5FA5 B;  2PM9 B;  2AGL A;  3F3P A;  3GD1 I;  4CY1 A;  3EI3 B;  3I7L A;  5M5U A;  4WJK A;  2HKM A;  1NR0 A;  3UVK A;  2OJY A;  5M61 A;  4J87 A;  5AMS A;  1XIP A;  4DNU A;  2XE4 A;  3JRP A;  4GGD A;  1N6F A;  2B5L A;  3FCU A;  4Y7R A;  4Z7Q A;  3I7H A;  4K3J B;  2OVQ B;  5FKT A;  3NID A;  4D6V A;  2H9L A;  3JPX A;  3DXM C;  3SBP A; 
#chains in the Genus database with same CATH homology
 3C5M A;  1JMX B;  4GZ8 A;  4OWR A;  3OTT A;  1SHY B;  5I5J A;  4H5J A;  5EAL A;  2XL2 A;  5B4W A;  2MTA H;  3SVW D;  4FA9 D;  4CZX A;  4LG9 A;  5HE2 B;  4FA5 D;  3F3F A;  5TDH B;  4JSN C;  2AQ5 A;  2I3T A;  1PI6 A;  2BCJ B;  2IUQ A;  3UKU C;  2H3X A;  5IJ7 E;  1PEV A;  4PXW A;  2CN3 A;  2H14 A;  2P9N C;  2P9P C;  5CXC A;  2PBI B;  3DSM A;  5IT9 g;  5A2Q g;  4A2L A;  4L3G D;  4O1Q D;  1VYH C;  1U4C A;  3ORV D;  3SCY A;  5SXM A;  4JT5 C;  1NEX B;  4ES0 A;  5HQG A;  4A08 B;  2J56 H;  4L1Q D;  3I8E A;  4ZOX A;  1RI6 A;  3RN1 D;  2H9M A;  2CNX A;  1L0Q A;  3DM0 A;  3RSE C;  3BWS A;  2P9I C;  2I0R A;  3MKQ A;  2H9P A;  4JT6 C;  4QQE A;  4A09 A;  4U1E I;  2H6Q A;  5TEF A;  2CE9 A;  4D0K A;  4FAV D;  3I7N A;  1JOF A;  2HXC A;  2QXV A;  4Z8L A;  4IMM A;  4X63 B;  4A0B B;  2GC7 A;  4E5Z A;  2IWF A;  3NVN A;  3SN6 B;  3V5W B;  2G9A A;  3I7K A;  3EWE A;  3UVM A;  4A09 B;  4FB1 D;  4HDJ A;  2IUR A;  3V9F A;  1OMW B;  4ZOY A;  3EI3 A;  3C75 H;  3PSC B;  3VGZ A;  2AGW A;  1XKS A;  4E5Z B;  5IC7 A;  5FKS A;  4CI2 A;  4CI1 A;  4A11 A;  3SJL D;  3JB9 L;  4PSW B;  1PGU A;  3SWS D;  4N14 A;  5IGO A;  4BL0 A;  3C9C A;  2OIZ A;  5I5I A;  4L3H D;  3VA6 A;  3EU7 A;  3W15 A;  4UI9 R;  1YFQ A;  2BBK H;  5EMK B;  4GMB A;  4I79 A;  2B5N A;  2I0S A;  4J78 A;  4GQ1 A;  3B7F A;  4X60 B;  3MZK A;  2Q7Q A;  5THA A;  2YNO A;  4AOW A;  4A11 B;  2XU7 A;  4J73 A;  3SHF A;  1K8K C;  4O45 A;  5AJA A;  5GXH A;  5IGQ A;  3RMZ D;  2GC4 A;  2OVR B;  3CFV A;  2Z2P A;  2W18 A;  4J86 A;  3HFQ A;  3IIW A;  3L4O D;  4GM9 A;  2OVP B;  4O3U B;  2J55 H;  3AL8 B;  4FA1 D;  1B9Y A;  4U7A A;  3OKW A;  4CZY A;  4JSP C;  4PBZ A;  2GNQ A;  4ZN4 A;  4J79 A;  5K1C C;  5TEE A;  4JD2 C;  4XYH A;  3UVO A;  1MG2 A;  4A08 A;  1PBY B;  3BG0 A;  4ERY A;  3AFC A;  5HYN B;  2OK4 A;  1OLZ A;  3FM0 A;  3C99 A;  4NSX A;  2I0T A;  3MMY A;  5HE1 B;  4GQ2 P;  2UZY B;  3EI1 A;  3PVW B;  4Y5R D;  4TZ4 A;  5I5M A;  4QL1 A;  2P9U C;  4X3E A;  1B9X A;  3UR4 A;  4L9O A;  3CFS B;  2XYI A;  2H68 A;  2IUP A;  3V7D B;  1A0R B;  3EI4 A;  4O9D A;  4CI3 A;  4ERZ A;  4QRJ A;  2UZX B;  4A0B A;  3MKS B;  3GFC A;  3AL9 A;  5EAR A;  4CC9 A;  4QT8 A;  3K27 A;  1K32 A;  3EI1 B;  5C2W B;  5FKR A;  4GGC A;  4CI8 A;  2HJ4 A;  4A7J A;  3PXT D;  3JAM g;  4JXM A;  3EI4 B;  2HYE A;  3OKY B;  2YBA A;  3EMH A;  4AEZ A;  4OZU A;  4JSX C;  3SXT D;  5GMK n;  4JSV C;  5FKQ A;  3JZN A;  3RLM D;  2B5M A;  1SQJ A;  2Z2N A;  4FA4 D;  1GXR A;  3I89 A;  5EM2 B;  3MZL A;  4PSX B;  5AFU 3;  2AH0 A;  3ULE C;  3J81 g;  2IAA A;  2HES X;  4GGA A;  3RFG A;  2AGX A;  3J80 g;  5C2V B;  4J8G A;  5H17 A;  4YVD A;  1QNI A;  5TF2 A;  4K3I D;  3I7P A;  1MDA H;  4EWR A;  2P9K C;  2J57 G;  3FRX A;  2YNN A;  5K19 A;  2I3S A;  3AL8 A;  1R5M A;  5CXB A;  5FLX g;  4GM3 A;  5GSA A;  4ERQ A;  3VH0 A;  2Z2O A;  2CE8 A;  1S4U X;  2HJB A;  2H6N A;  4O3T B;  5CYK A;  2O9K A;  3N0E A;  4E54 B;  2H9N A;  4CY3 A;  2IUV A;  3P4F A;  5CXB B;  2HKR A;  3RFH A;  4FAN D;  1ERJ A;  4J0X A;  5HE3 B;  4J77 A;  3NVX A;  5CYK B;  4A0A B;  5EMJ B;  4CY5 A;  3FGB A;  3IJ0 A;  1GG2 B;  2H13 A;  2H6K A;  3N0D A;  1N6D A;  2AGY A;  5FXY A;  4FHL A;  3OL2 B;  1P22 A;  3CIK B;  4X61 B;  2EBS A;  3U4Y A;  2CO0 A;  3ZWL B;  1GOT B;  3BG1 A;  3ODT A;  4PC0 A;  3E0C A;  4IA9 A;  3JZH A;  5IJ8 E;  4KFM B;  4GQB B;  3I8C A;  3KRX B;  4A2M A;  2TRC B;  1JJU B;  5EML B;  1JMZ B;  3PE7 A;  3OKY A;  4BH6 A;  3MXX A;  1Q47 A;  2B4E A;  5H1M A;  3EG6 A;  1FWX A;  2P9S C;  5GXI A;  3OW8 A;  5HE0 B;  4J8B A;  2H47 A;  3A0F A;  3I7O A;  4XEI C;  3SMR A;  4J81 A;  3SLE D;  2P9L C;  2PM7 B;  4ZOV A;  3PSL A;  2YNP A;  1TYQ C;  2YB8 B;  4XYI A;  5EM2 A;  1GP2 B;  3SBR A;  4CY2 A;  4R7A B;  4G56 B;  5C9Z B;  1TBG A;  3KRW B;  3NVQ A;  5CXC B;  2IWK A;  3I2N A;  5JWZ A;  4LG8 A;  2PM6 B;  5FQD A;  2YMU A;  3PXW D;  3AH8 B;  5KDO B;  3IJC A;  1U2V C;  3RN0 D;  3OKT A;  2AGZ A;  3PVU B;  4H5I A;  3JRO A;  4LGN A;  2CO0 C;  3SFZ A;  3UVL A;  2QC5 A;  3JZG A;  4J0W A;  4MK0 B;  2CN2 A;  3PXS D;  3F3G A;  3DXK C;  3IIY A;  4GM8 A;  4J84 A;  1SQ9 A;  4BUJ C;  3DWL C;  1N6E A;  3K26 A;  4FWW A;  5EAP A;  3UKR C;  5EMM B;  3UVN A;  4E54 A;  3SBQ A;  3EI2 A;  4CZV A;  3L4M D;  3GRE A;  2PM9 A;  2G99 A;  1XHM A;  2AH1 A;  4ZOZ A;  3IJ1 A;  5EAM A;  5H14 A;  2OK6 A;  4PNK B;  4A0A A;  3RRM C;  4PBY A;  4J82 A;  1MG3 A;  4ESG A;  3OL2 A;  3EI2 B;  2XL3 A;  3IKO A;  5FA5 B;  2PM9 B;  2AGL A;  3F3P A;  4CY1 A;  3EI3 B;  3I7L A;  2HKM A;  1NR0 A;  3UVK A;  2OJY A;  4J87 A;  5AMS A;  1XIP A;  3JRP A;  4GGD A;  1N6F A;  2B5L A;  4Y7R A;  3I7H A;  4K3J B;  2OVQ B;  5FKT A;  4D6V A;  2H9L A;  3JPX A;  3DXM C;  3SBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...