4ZN4A

Crystal structure of sqt1 from chaetomium thermophilum solved by mr
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
483
structure length
409
Chain Sequence
ALENDSIAYFDGHKDSVFAIAQHPLYPNIVATGGSEGDADDAPGKGYVLDISATSLNPIFEIDGHTDSINALTFTLPRGDFLVSGGMDGRMRVYAVSVPQNGALAQFKFLAESQETEEINWFAPCPSPDHPNTIALGASDGSVWVFTLDNPVQIVQSYFLHTGPCTAGAWSPDGLLLATVSEDESLHVYDVFGVAASKSLVTDNGQTVVSLTNVDQRFAVEGGLFSVAVSPTGAVVAVGGAGGQIKIVGLPRLSQAGTILASLQIQSDNIESLAFSPSAPILAAGSTDGSIAVFDTSRSFALRRHLRGAHAEDPVVKVEFVKSPPNAAMAGWLLTSCGMDGVVRRWDLRGGTAGPGTLPHMAPSGLVKEWKGHRSGQEGGGVLGFVQGETGERIVTVGDDAVVLVFEAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-translational capturing of nascent ribosomal proteins by their dedicated chaperones.
pubmed doi rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
molecule tags Chaperone
molecule keywords sqt1
total genus 105
structure length 409
sequence length 483
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4zn4A00
3JZHA 3C5MA 4Y5RD 5EMKB 1OLZA 4BL0A 3SBQA 4JD2C 4L1QD 4GQ2P 4J0WA 3I7OA 3UVOA 2HYEA 4FA9D 2B5MA 5IGOA 2H3XA 5FKSA 3MZKA 3N0EA 3B7FA 3I8EA 4L9OA 3SN6B 4KFMB 3MMYA 3UVKA 2Q7QA 1N6DA 4N14A 4PNKB 4CY1A 4HDJA 4K3ID 3GFCA 2G99A 3GREA 3PXWD 3IIYA 2H9PA 3E0CA 5CXCB 4ERYA 4FA5D 2IURA 2HKRA 2YNNA 3OKWA 4AOWA 4YVDA 5HE1B 4CI3A 3C75H 4NSXA 4X3EA 1GG2B 3SBRA 1PBYB 4CZYA 3BWSA 2OIZA 4ZOVA 5TDHB 3SLED 3AH8B 5CXCA 4OWRA 5I5JA 4J86A 3SWSD 5AFU3 2H9NA 3MZLA 1Q47A 4A09B 2AGXA 1L0QA 1QNIA 1P22A 4GMBA 3FRXA 5I5MA 5TF2A 4A0AA 2MTAH 3HFQA 3CIKB 2H13A 4JT6C 3I7KA 2P9UC 3JPXA 3N0DA 4Y7RA 4FAND 4FA1D 1S4UX 1K32A 4U7AA 5EARA 5FKTA 4ES0A 2IUQA 3EI1A 5EAPA 2XU7A 1SQJA 5FLXg 3JROA 4UI9R 5GMKn 3OKYA 3A0FA 3F3FA 1K8KC 2IAAA 4GZ8A 3SVWD 5EAMA 2XL2A 3OW8A 3PSLA 4E54A 5CYKB 4GQBB 3SFZA 3J80g 5THAA 3EI1B 4XEIC 3NVXA 4A11B 4PXWA 4GGDA 4J0XA 3PXTD 5EM2B 3RFHA 4A0AB 3OKYB 4BH6A 3EI2B 3RMZD 4QRJA 1VYHC 3KRXB 4CI2A 1XIPA 4PBZA 3I7HA 1N6FA 2BCJB 4XYIA 4A08A 4GGAA 4A0BA 2IUVA 4AEZA 2H9LA 5C9ZB 3CFVA 3EI4B 5IT9g 5GSAA 5IJ7E 2P9NC 1JMXB 4FB1D 3I89A 4FHLA 2Z2OA 2O9KA 2IWFA 1PGUA 3OKTA 4ERQA 3DWLC 4ZOZA 2YBAA 5IGQA 2B4EA 5FKRA 3SCYA 1NEXB 2IWKA 3RSEC 1RI6A 1JMZB 4J8GA 2CE8A 1MG2A 4XYHA 2I3TA 4H5JA 4ZOYA 4L3GD 2H6KA 3NVQA 5CXBB 5EMLB 5EALA 5EM2A 2B5LA 4IMMA 4QQEA 3DM0A 4J77A 3SJLD 4G56B 1U2VC 2TRCB 4A2LA 3JZGA 4J73A 4O3UB 1GP2B 4A2MA 2UZXB 3EU7A 5HE0B 2B5NA 4CI8A 4JSPC 2H47A 2G9AA 5K19A 4PC0A 4CZVA 3CFSB 2P9LC 5FA5B 2J55H 2CN2A 2PM6B 3UR4A 3I7LA 3IKOA 1R5MA 3MKSB 4X60B 2XL3A 1SQ9A 5AMSA 4O45A 4A0BB 2I0SA 1A0RB 2XYIA 1GOTB 3RFGA 3OTTA 2HJBA 4LGNA 3JB9L 4E54B 1N6EA 3OL2B 2OJYA 2OVQB 3V9FA 1YFQA 4IA9A 4ZN4A 4J82A 4R7AB 4D6VA 2HKMA 2P9PC 2GC4A 3MXXA 4K3JB 1MDAH 4E5ZB 1OMWB 4FA4D 5GXIA 3NVNA 2AGLA 1TYQC 3C9CA 5HQGA 2I0RA 4J8BA 1B9YA 3UKRC 5AJAA 3DXKC 1JOFA 2P9IC 3EI3A 5H1MA 3C99A 5IC7A 4EWRA 4E5ZA 1XHMA 2OK6A 3F3PA 3ODTA 3IIWA 4X63B 2I3SA 2GNQA 4GM9A 3PVUB 3VGZA 2OVRB 4GM8A 3UVLA 3RLMD 3BG1A 3RRMC 3IJ0A 3VA6A 4QL1A 5HE2B 5GXHA 4J79A 3RN1D 2H6QA 5A2Qg 3L4MD 1JJUB 4U1EI 2H6NA 2I0TA 3BG0A 5CXBA 3SXTD 5SXMA 3V5WB 2Z2PA 5I5IA 3J81g 3UVMA 4A7JA 2YB8B 3DXMC 4JSXC 2PM9A 5K1CC 2Z2NA 3PXSD 3IJ1A 4J87A 4CY3A 5C2VB 2AGZA 2J57G 3EG6A 5IJ8E 4PSWB 2PM7B 1PI6A 4MK0B 3EMHA 4ZOXA 3UKUC 2HJ4A 4GQ1A 1B9XA 4O9DA 4A09A 3I7PA 2OK4A 3DSMA 3ULEC 4TZ4A 2CO0C 3EI4A 5JWZA 4BUJC 4CY2A 3RN0D 3EWEA 2AGYA 2W18A 3SBPA 2QXVA 3V7DB 3F3GA 4LG9A 3VH0A 4Z8LA 2AH0A 3K27A 1U4CA 3FM0A 3PE7A 5FQDA 5H17A 3AFCA 2J56H 3AL8B 4D0KA 4JT5C 4JSNC 2AH1A 1MG3A 2IUPA 5HE3B 4FWWA 2GC7A 2YNOA 1TBGA 3JZNA 3U4YA 4J84A 1NR0A 4O3TB 5CYKA 5FXYA 3SMRA 4JXMA 4FAVD 4OZUA 2PBIB 4PBYA 3P4FA 3JRPA 1FWXA 2YNPA 2BBKH 4PSXB 2UZYB 4L3HD 2P9KC 4QT8A 2EBSA 1SHYB 3SHFA 4H5IA 3EI2A 4ESGA 2AGWA 1GXRA 4CI1A 3IJCA 4J78A 3L4OD 5TEEA 3W15A 2H9MA 5FKQA 5HYNB 4LG8A 4I79A 2OVPB 2CE9A 4A08B 3ORVD 1XKSA 4GGCA 4GM3A 4CY5A 3I7NA 2HXCA 3PSCB 5EMMB 5TEFA 2P9SC 3KRWB 2YMUA 2CNXA 3ZWLB 2CO0A 2H68A 5H14A 5C2WB 1PEVA 1ERJA 3AL9A 2QC5A 2H14A 3OL2A 5B4WA 4ERZA 2CN3A 2PM9B 4X61B 4J81A 4CC9A 3I2NA 4O1QD 3UVNA 4CZXA 3JAMg 3FGBA 3K26A 5KDOB 3AL8A 3PVWB 2HESX 3MKQA 4A11A 2AQ5A 3EI3B 4JSVC 5EMJB 3I8CA
chains in the Genus database with same CATH superfamily
3JZHA 3C5MA 4Y5RD 5EMKB 1OLZA 4BL0A 3SBQA 1JTDB 4JD2C 4L1QD 4GQ2P 4J0WA 3I7OA 2JKXA 3UVOA 2HYEA 4FA9D 2B5MA 5IGOA 2H3XA 5FKSA 3MZKA 3N0EA 3B7FA 3I8EA 4L9OA 3SN6B 1E5TA 4G1EA 4KFMB 4DNVA 3MMYA 3UVKA 2Q7QA 1N6DA 4N14A 4PNKB 4CY1A 4HDJA 4K3ID 3GFCA 1A12A 1GOGA 2G99A 3GREA 3PXWD 3QHYB 3IIYA 2H9PA 4DNWA 4Z7OA 3E0CA 5CXCB 2XZGA 4ERYA 4FA5D 2IURA 2HKRA 2YNNA 3O4JA 3OKWA 3V4PA 4AOWA 4YVDA 5HE1B 4CI3A 3C75H 4NSXA 3GC3B 4X3EA 1GG2B 3SBRA 1PBYB 4CZYA 3BWSA 2OIZA 4ZOVA 5TDHB 3SLED 3AH8B 4G55A 2VDNA 5CXCA 4OWRA 5I5JA 4MMYA 4J86A 3SWSD 5AFU3 2H9NA 3MZLA 3EQ7A 3KCIA 4WK4A 1Q47A 4A09B 2AGXA 2EIEA 1L0QA 1QNIA 1C9LA 1P22A 4WJKA 4GMBA 3FRXA 5I5MA 5TF2A 4A0AA 2MTAH 3HFQA 3CIKB 2H13A 4JT6C 3FCUA 3I7KA 1C9IA 3JPXA 3N0DA 2P9UC 4Y7RA 1E8NA 2VDKA 3OF7A 4FAND 4FA1D 1S4UX 3QI0A 1K32A 4U7AA 5EARA 5FKTA 4ES0A 2IUQA 3EI1A 4G1MA 5EAPA 2XU7A 1SQJA 5FLXg 1UTCA 2VZ1A 3JROA 1U8CA 4UI9R 5GMKn 3OKYA 5E6SA 3A0FA 3F3FA 1K8KC 2IAAA 4GZ8A 3SVWD 5EAMA 3ZE1A 2XL2A 3OW8A 3PSLA 4E54A 5CYKB 4GQBB 3SFZA 1L5GA 2QR5A 3J80g 2HU7A 5THAA 5C92A 3EQ9A 3EI1B 4XEIC 3NVXA 4JHNA 4A11B 5E6UA 4PXWA 4GGDA 4J0XA 3T3MA 3ZDZA 3PXTD 5EM2B 3RFHA 4A0AB 3OKYB 4BH6A 3MVDK 3EI2B 3RMZD 4QRJA 1VYHC 3KRXB 2XE4A 4CI2A 1XIPA 4PBZA 4MMZA 3I7HA 4NC4A 1N6FA 2BCJB 4XYIA 4A08A 4GGAA 2EIDA 4A0BA 2IUVA 4AEZA 2H9LA 5C9ZB 3CFVA 3EI4B 5IT9g 5GSAA 5IJ7E 2P9NC 1JMXB 4FB1D 3I89A 4FHLA 2Z2OA 2O9KA 2IWFA 1PGUA 3OKTA 4ERQA 3DWLC 4ZOZA 2YBAA 5IGQA 2B4EA 5FKRA 3SCYA 1NEXB 2IWKA 1UOOA 4BCDA 3RSEC 1RI6A 1JMZB 4J8GA 2CE8A 1MG2A 4XYHA 2VZ3A 3IUMA 2I3TA 4H5JA 4BP8A 4ZOYA 3K71A 4L3GD 2H6KA 3NVQA 5CXBB 5EMLB 1GOFA 5EALA 5EM2A 2B5LA 3IVMA 4IMMA 4QQEA 3DM0A 1VE6A 4J77A 3SJLD 4G56B 1U2VC 2TRCB 4A2LA 3ZDXA 3JZGA 4J73A 4O3UB 1GP2B 4A2MA 2UZXB 3EU7A 5HE0B 2B5NA 4CI8A 4JSPC 3IUJA 2H47A 1H2ZA 2G9AA 5K19A 4PC0A 4CZVA 2HU5A 3CFSB 2P9LC 1QFMA 4NAAA 5M61A 5FA5B 2J55H 2CN2A 2PM6B 3UR4A 3I7LA 1M1XA 4AN0A 3IKOA 1R5MA 3MKSB 4NBMA 4X60B 2XL3A 2VDRA 1SQ9A 5AMSA 4O2WA 4O45A 4RE6A 4A0BB 2I0SA 1A0RB 2XYIA 1GOTB 3FCSA 5M5TA 3RFGA 3OTTA 2HJBA 4LGNA 3JB9L 4E54B 1N6EA 3OL2B 2OJYA 5HDBA 2OVQB 1YFQA 3V9FA 4IA9A 4BCCA 4ZN4A 3IUQA 4J82A 4R7AB 4D6VA 2HKMA 2P9PC 2GC4A 3MXXA 4K3JB 1MDAH 1O6GA 1OMWB 3ZE0A 2VDPA 4FA4D 4E5ZB 5GXIA 3NVNA 2AGLA 1TYQC 3C9CA 5HQGA 4DNUA 1QFSA 4NENA 4IRZA 2I0RA 4J8BA 4QAMA 1YR2A 1B9YA 3UKRC 3T3PA 4UM9A 5AJAA 3V4VA 3DXKC 5FFGA 1JOFA 2P9IC 3EI3A 5H1MA 3C99A 5IC7A 4EWRA 4E5ZA 3IJEA 1XHMA 2OK6A 3F3PA 3ODTA 3IIWA 4X63B 2VDQA 2I3SA 2GNQA 4GM9A 3PVUB 3VGZA 2OVRB 1UOPA 3NIFA 1GOHA 4GM8A 3UVLA 3RLMD 3BG1A 3RRMC 2BKLA 3IJ0A 3VI4A 3VA6A 4QL1A 5HE2B 5GXHA 1T2XA 4J79A 3RN1D 2H6QA 5A2Qg 3L4MD 1JJUB 4U1EI 2H6NA 3O4HA 2I0TA 5M5SA 3BG0A 5CXBA 3SXTD 4AN1A 5SXMA 1VE7A 4Z7NA 3V5WB 2Z2PA 5I5IA 3J81g 3UVMA 4A7JA 2YB8B 3ZE2A 3DXMC 4JSXC 2PM9A 5K1CC 2Z2NA 2HU8A 4MMXA 1K3IA 3PXSD 3IJ1A 4J87A 4CY3A 1JV2A 5C2VB 2AGZA 2J57G 3EG6A 2WQ8A 5IJ8E 4PSWB 2PM7B 1PI6A 3IUNA 1TYEA 4MK0B 3EMHA 4ZOXA 4BCBA 4L1MA 3UKUC 3DDUA 3EQ8A 2HJ4A 4GQ1A 1B9XA 4O9DA 4A09A 3I7PA 2OK4A 3DSMA 2VDMA 3ULEC 1H2WA 4TZ4A 2CO0C 5FFOA 3EI4A 5JWZA 4BP9A 4BUJC 4CY2A 3RN0D 3EWEA 2AGYA 2W18A 3SBPA 2QXVA 3V7DB 3F3GA 4LG9A 3VH0A 4Z8LA 2AH0A 3K27A 1U4CA 3FM0A 2XDWA 3PE7A 5FQDA 5H17A 3AFCA 2J56H 3AL8B 4D0KA 4JT5C 4JSNC 2AH1A 3IULA 3K72A 1MG3A 2IUPA 5HE3B 4FWWA 5E6RA 2GC7A 2YNOA 1TBGA 3JZNA 3U4YA 4J84A 1NR0A 4O3TB 1I2MB 5CYKA 5FXYA 3GD1I 3SMRA 1VZ2A 4JXMA 3NIDA 4FAVD 2VDOA 4OZUA 2PBIB 3MUOA 4PBYA 4AMYA 3P4FA 1BPOA 3JRPA 1FWXA 2YNPA 2BBKH 4PSXB 2UZYB 4L3HD 2P9KC 4QT8A 2EBSA 1SHYB 3SHFA 4H5IA 4AX4A 5M5RA 4ESGA 3EI2A 4RE5A 2AGWA 5M5VA 1GXRA 3NIGA 1O6FA 4CI1A 3IJCA 4J78A 3L4OD 5TEEA 5C86A 3W15A 2H9MA 1VZ3A 5FKQA 5HYNB 4LG8A 4I79A 2OVPB 4Z7QA 3VI3A 2CE9A 2VDLA 4A08B 3ORVD 2EICA 1XKSA 4GGCA 4GM3A 5M5UA 4CY5A 3I7NA 4O02A 3PSCB 2HXCA 5EMMB 1UOQA 5TEFA 2P9SC 3O4GA 3KRWB 2YMUA 2CNXA 3ZWLB 3IURA 2CO0A 2VC2A 2H68A 4WK2A 5H14A 5C2WB 3MUNA 1PEVA 1E8MA 1ERJA 3AL9A 2QC5A 4UM8A 3K6SA 2H14A 3OL2A 5B4WA 4ERZA 2CN3A 2PM9B 4X61B 4J81A 1H2YA 4CC9A 3I2NA 4O1QD 1H2XA 3ZDYA 3UVNA 4CZXA 3JAMg 3FGBA 3K26A 3O4IA 4AMZA 2QZPA 5KDOB 3AL8A 3PVWB 4WK0A 4JHPC 2HESX 2EIBA 3MKQA 4D9SA 4A11A 2AQ5A 3EI3B 4JSVC 5EMJB 3I8CA
chains in the Genus database with same CATH topology
3JZHA 3C5MA 4Y5RD 5EMKB 1OLZA 4BL0A 3SBQA 4JD2C 4L1QD 4GQ2P 4J0WA 3I7OA 3UVOA 2HYEA 4FA9D 2B5MA 5IGOA 2H3XA 5FKSA 3MZKA 3N0EA 3B7FA 3I8EA 4L9OA 3SN6B 4KFMB 3MMYA 3UVKA 2Q7QA 1N6DA 4N14A 4PNKB 4CY1A 4HDJA 4K3ID 3GFCA 2G99A 3GREA 3PXWD 3IIYA 2H9PA 3E0CA 5CXCB 4ERYA 4FA5D 2IURA 2HKRA 2YNNA 3OKWA 4AOWA 4YVDA 5HE1B 4CI3A 3C75H 4NSXA 4X3EA 1GG2B 3SBRA 1PBYB 4CZYA 3BWSA 2OIZA 4ZOVA 5TDHB 3SLED 3AH8B 5CXCA 4OWRA 5I5JA 4J86A 3SWSD 5AFU3 2H9NA 3MZLA 1Q47A 4A09B 2AGXA 1L0QA 1QNIA 1P22A 4GMBA 3FRXA 5I5MA 5TF2A 4A0AA 2MTAH 3HFQA 3CIKB 2H13A 4JT6C 3I7KA 2P9UC 3JPXA 3N0DA 4Y7RA 4FAND 4FA1D 1S4UX 1K32A 4U7AA 5EARA 5FKTA 4ES0A 2IUQA 3EI1A 5EAPA 2XU7A 1SQJA 5FLXg 3JROA 4UI9R 5GMKn 3OKYA 3A0FA 3F3FA 1K8KC 2IAAA 4GZ8A 3SVWD 5EAMA 2XL2A 3OW8A 3PSLA 4E54A 5CYKB 4GQBB 3SFZA 3J80g 5THAA 3EI1B 4XEIC 3NVXA 4A11B 4PXWA 4GGDA 4J0XA 3PXTD 5EM2B 3RFHA 4A0AB 3OKYB 4BH6A 3EI2B 3RMZD 4QRJA 1VYHC 3KRXB 4CI2A 1XIPA 4PBZA 3I7HA 1N6FA 2BCJB 4XYIA 4A08A 4GGAA 4A0BA 2IUVA 4AEZA 2H9LA 5C9ZB 3CFVA 3EI4B 5IT9g 5GSAA 5IJ7E 2P9NC 1JMXB 4FB1D 3I89A 4FHLA 2Z2OA 2O9KA 2IWFA 1PGUA 3OKTA 4ERQA 3DWLC 4ZOZA 2YBAA 5IGQA 2B4EA 5FKRA 3SCYA 1NEXB 2IWKA 3RSEC 1RI6A 1JMZB 4J8GA 2CE8A 1MG2A 4XYHA 2I3TA 4H5JA 4ZOYA 4L3GD 2H6KA 3NVQA 5CXBB 5EMLB 5EALA 5EM2A 2B5LA 4IMMA 4QQEA 3DM0A 4J77A 3SJLD 4G56B 1U2VC 2TRCB 4A2LA 3JZGA 4J73A 4O3UB 1GP2B 4A2MA 2UZXB 3EU7A 5HE0B 2B5NA 4CI8A 4JSPC 2H47A 2G9AA 5K19A 4PC0A 4CZVA 3CFSB 2P9LC 5FA5B 2J55H 2CN2A 2PM6B 3UR4A 3I7LA 3IKOA 1R5MA 3MKSB 4X60B 2XL3A 1SQ9A 5AMSA 4O45A 4A0BB 2I0SA 1A0RB 2XYIA 1GOTB 3RFGA 3OTTA 2HJBA 4LGNA 3JB9L 4E54B 1N6EA 3OL2B 2OJYA 2OVQB 3V9FA 1YFQA 4IA9A 4ZN4A 4J82A 4R7AB 4D6VA 2HKMA 2P9PC 2GC4A 3MXXA 4K3JB 1MDAH 4E5ZB 1OMWB 4FA4D 5GXIA 3NVNA 2AGLA 1TYQC 3C9CA 5HQGA 2I0RA 4J8BA 1B9YA 3UKRC 5AJAA 3DXKC 1JOFA 2P9IC 3EI3A 5H1MA 3C99A 5IC7A 4EWRA 4E5ZA 1XHMA 2OK6A 3F3PA 3ODTA 3IIWA 4X63B 2I3SA 2GNQA 4GM9A 3PVUB 3VGZA 2OVRB 4GM8A 3UVLA 3RLMD 3BG1A 3RRMC 3IJ0A 3VA6A 4QL1A 5HE2B 5GXHA 4J79A 3RN1D 2H6QA 5A2Qg 3L4MD 1JJUB 4U1EI 2H6NA 2I0TA 3BG0A 5CXBA 3SXTD 5SXMA 3V5WB 2Z2PA 5I5IA 3J81g 3UVMA 4A7JA 2YB8B 3DXMC 4JSXC 2PM9A 5K1CC 2Z2NA 3PXSD 3IJ1A 4J87A 4CY3A 5C2VB 2AGZA 2J57G 3EG6A 5IJ8E 4PSWB 2PM7B 1PI6A 4MK0B 3EMHA 4ZOXA 3UKUC 2HJ4A 4GQ1A 1B9XA 4O9DA 4A09A 3I7PA 2OK4A 3DSMA 3ULEC 4TZ4A 2CO0C 3EI4A 5JWZA 4BUJC 4CY2A 3RN0D 3EWEA 2AGYA 2W18A 3SBPA 2QXVA 3V7DB 3F3GA 4LG9A 3VH0A 4Z8LA 2AH0A 3K27A 1U4CA 3FM0A 3PE7A 5FQDA 5H17A 3AFCA 2J56H 3AL8B 4D0KA 4JT5C 4JSNC 2AH1A 1MG3A 2IUPA 5HE3B 4FWWA 2GC7A 2YNOA 1TBGA 3JZNA 3U4YA 4J84A 1NR0A 4O3TB 5CYKA 5FXYA 3SMRA 4JXMA 4FAVD 4OZUA 2PBIB 4PBYA 3P4FA 3JRPA 1FWXA 2YNPA 2BBKH 4PSXB 2UZYB 4L3HD 2P9KC 4QT8A 2EBSA 1SHYB 3SHFA 4H5IA 3EI2A 4ESGA 2AGWA 1GXRA 4CI1A 3IJCA 4J78A 3L4OD 5TEEA 3W15A 2H9MA 5FKQA 5HYNB 4LG8A 4I79A 2OVPB 2CE9A 4A08B 3ORVD 1XKSA 4GGCA 4GM3A 4CY5A 3I7NA 2HXCA 3PSCB 5EMMB 5TEFA 2P9SC 3KRWB 2YMUA 2CNXA 3ZWLB 2CO0A 2H68A 5H14A 5C2WB 1PEVA 1ERJA 3AL9A 2QC5A 2H14A 3OL2A 5B4WA 4ERZA 2CN3A 2PM9B 4X61B 4J81A 4CC9A 3I2NA 4O1QD 3UVNA 4CZXA 3JAMg 3FGBA 3K26A 5KDOB 3AL8A 3PVWB 2HESX 3MKQA 4A11A 2AQ5A 3EI3B 4JSVC 5EMJB 3I8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JZH A;  3C5M A;  4Y5R D;  5EMK B;  1OLZ A;  4BL0 A;  3SBQ A;  4JD2 C;  4L1Q D;  4GQ2 P;  4J0W A;  3I7O A;  3UVO A;  2HYE A;  4FA9 D;  2B5M A;  5IGO A;  2H3X A;  5FKS A;  3MZK A;  3N0E A;  3B7F A;  3I8E A;  4L9O A;  3SN6 B;  4KFM B;  3MMY A;  3UVK A;  2Q7Q A;  1N6D A;  4N14 A;  4PNK B;  4CY1 A;  4HDJ A;  4K3I D;  3GFC A;  2G99 A;  3GRE A;  3PXW D;  3IIY A;  2H9P A;  3E0C A;  5CXC B;  4ERY A;  4FA5 D;  2IUR A;  2HKR A;  2YNN A;  3OKW A;  4AOW A;  4YVD A;  5HE1 B;  4CI3 A;  3C75 H;  4NSX A;  4X3E A;  1GG2 B;  3SBR A;  1PBY B;  4CZY A;  3BWS A;  2OIZ A;  4ZOV A;  5TDH B;  3SLE D;  3AH8 B;  5CXC A;  4OWR A;  5I5J A;  4J86 A;  3SWS D;  5AFU 3;  2H9N A;  3MZL A;  1Q47 A;  4A09 B;  2AGX A;  1L0Q A;  1QNI A;  1P22 A;  4GMB A;  3FRX A;  5I5M A;  5TF2 A;  4A0A A;  2MTA H;  3HFQ A;  3CIK B;  2H13 A;  4JT6 C;  3I7K A;  2P9U C;  3JPX A;  3N0D A;  4Y7R A;  4FAN D;  4FA1 D;  1S4U X;  1K32 A;  4U7A A;  5EAR A;  5FKT A;  4ES0 A;  2IUQ A;  3EI1 A;  5EAP A;  2XU7 A;  1SQJ A;  5FLX g;  3JRO A;  4UI9 R;  5GMK n;  3OKY A;  3A0F A;  3F3F A;  1K8K C;  2IAA A;  4GZ8 A;  3SVW D;  5EAM A;  2XL2 A;  3OW8 A;  3PSL A;  4E54 A;  5CYK B;  4GQB B;  3SFZ A;  3J80 g;  5THA A;  3EI1 B;  4XEI C;  3NVX A;  4A11 B;  4PXW A;  4GGD A;  4J0X A;  3PXT D;  5EM2 B;  3RFH A;  4A0A B;  3OKY B;  4BH6 A;  3EI2 B;  3RMZ D;  4QRJ A;  1VYH C;  3KRX B;  4CI2 A;  1XIP A;  4PBZ A;  3I7H A;  1N6F A;  2BCJ B;  4XYI A;  4A08 A;  4GGA A;  4A0B A;  2IUV A;  4AEZ A;  2H9L A;  5C9Z B;  3CFV A;  3EI4 B;  5IT9 g;  5GSA A;  5IJ7 E;  2P9N C;  1JMX B;  4FB1 D;  3I89 A;  4FHL A;  2Z2O A;  2O9K A;  2IWF A;  1PGU A;  3OKT A;  4ERQ A;  3DWL C;  4ZOZ A;  2YBA A;  5IGQ A;  2B4E A;  5FKR A;  3SCY A;  1NEX B;  2IWK A;  3RSE C;  1RI6 A;  1JMZ B;  4J8G A;  2CE8 A;  1MG2 A;  4XYH A;  2I3T A;  4H5J A;  4ZOY A;  4L3G D;  2H6K A;  3NVQ A;  5CXB B;  5EML B;  5EAL A;  5EM2 A;  2B5L A;  4IMM A;  4QQE A;  3DM0 A;  4J77 A;  3SJL D;  4G56 B;  1U2V C;  2TRC B;  4A2L A;  3JZG A;  4J73 A;  4O3U B;  1GP2 B;  4A2M A;  2UZX B;  3EU7 A;  5HE0 B;  2B5N A;  4CI8 A;  4JSP C;  2H47 A;  2G9A A;  5K19 A;  4PC0 A;  4CZV A;  3CFS B;  2P9L C;  5FA5 B;  2J55 H;  2CN2 A;  2PM6 B;  3UR4 A;  3I7L A;  3IKO A;  1R5M A;  3MKS B;  4X60 B;  2XL3 A;  1SQ9 A;  5AMS A;  4O45 A;  4A0B B;  2I0S A;  1A0R B;  2XYI A;  1GOT B;  3RFG A;  3OTT A;  2HJB A;  4LGN A;  3JB9 L;  4E54 B;  1N6E A;  3OL2 B;  2OJY A;  2OVQ B;  3V9F A;  1YFQ A;  4IA9 A;  4ZN4 A;  4J82 A;  4R7A B;  4D6V A;  2HKM A;  2P9P C;  2GC4 A;  3MXX A;  4K3J B;  1MDA H;  4E5Z B;  1OMW B;  4FA4 D;  5GXI A;  3NVN A;  2AGL A;  1TYQ C;  3C9C A;  5HQG A;  2I0R A;  4J8B A;  1B9Y A;  3UKR C;  5AJA A;  3DXK C;  1JOF A;  2P9I C;  3EI3 A;  5H1M A;  3C99 A;  5IC7 A;  4EWR A;  4E5Z A;  1XHM A;  2OK6 A;  3F3P A;  3ODT A;  3IIW A;  4X63 B;  2I3S A;  2GNQ A;  4GM9 A;  3PVU B;  3VGZ A;  2OVR B;  4GM8 A;  3UVL A;  3RLM D;  3BG1 A;  3RRM C;  3IJ0 A;  3VA6 A;  4QL1 A;  5HE2 B;  5GXH A;  4J79 A;  3RN1 D;  2H6Q A;  5A2Q g;  3L4M D;  1JJU B;  4U1E I;  2H6N A;  2I0T A;  3BG0 A;  5CXB A;  3SXT D;  5SXM A;  3V5W B;  2Z2P A;  5I5I A;  3J81 g;  3UVM A;  4A7J A;  2YB8 B;  3DXM C;  4JSX C;  2PM9 A;  5K1C C;  2Z2N A;  3PXS D;  3IJ1 A;  4J87 A;  4CY3 A;  5C2V B;  2AGZ A;  2J57 G;  3EG6 A;  5IJ8 E;  4PSW B;  2PM7 B;  1PI6 A;  4MK0 B;  3EMH A;  4ZOX A;  3UKU C;  2HJ4 A;  4GQ1 A;  1B9X A;  4O9D A;  4A09 A;  3I7P A;  2OK4 A;  3DSM A;  3ULE C;  4TZ4 A;  2CO0 C;  3EI4 A;  5JWZ A;  4BUJ C;  4CY2 A;  3RN0 D;  3EWE A;  2AGY A;  2W18 A;  3SBP A;  2QXV A;  3V7D B;  3F3G A;  4LG9 A;  3VH0 A;  4Z8L A;  2AH0 A;  3K27 A;  1U4C A;  3FM0 A;  3PE7 A;  5FQD A;  5H17 A;  3AFC A;  2J56 H;  3AL8 B;  4D0K A;  4JT5 C;  4JSN C;  2AH1 A;  1MG3 A;  2IUP A;  5HE3 B;  4FWW A;  2GC7 A;  2YNO A;  1TBG A;  3JZN A;  3U4Y A;  4J84 A;  1NR0 A;  4O3T B;  5CYK A;  5FXY A;  3SMR A;  4JXM A;  4FAV D;  4OZU A;  2PBI B;  4PBY A;  3P4F A;  3JRP A;  1FWX A;  2YNP A;  2BBK H;  4PSX B;  2UZY B;  4L3H D;  2P9K C;  4QT8 A;  2EBS A;  1SHY B;  3SHF A;  4H5I A;  3EI2 A;  4ESG A;  2AGW A;  1GXR A;  4CI1 A;  3IJC A;  4J78 A;  3L4O D;  5TEE A;  3W15 A;  2H9M A;  5FKQ A;  5HYN B;  4LG8 A;  4I79 A;  2OVP B;  2CE9 A;  4A08 B;  3ORV D;  1XKS A;  4GGC A;  4GM3 A;  4CY5 A;  3I7N A;  2HXC A;  3PSC B;  5EMM B;  5TEF A;  2P9S C;  3KRW B;  2YMU A;  2CNX A;  3ZWL B;  2CO0 A;  2H68 A;  5H14 A;  5C2W B;  1PEV A;  1ERJ A;  3AL9 A;  2QC5 A;  2H14 A;  3OL2 A;  5B4W A;  4ERZ A;  2CN3 A;  2PM9 B;  4X61 B;  4J81 A;  4CC9 A;  3I2N A;  4O1Q D;  3UVN A;  4CZX A;  3JAM g;  3FGB A;  3K26 A;  5KDO B;  3AL8 A;  3PVW B;  2HES X;  3MKQ A;  4A11 A;  2AQ5 A;  3EI3 B;  4JSV C;  5EMJ B;  3I8C A; 
#chains in the Genus database with same CATH topology
 3JZH A;  3C5M A;  4Y5R D;  5EMK B;  1OLZ A;  4BL0 A;  3SBQ A;  1JTD B;  4JD2 C;  4L1Q D;  4GQ2 P;  4J0W A;  3I7O A;  2JKX A;  3UVO A;  2HYE A;  4FA9 D;  2B5M A;  5IGO A;  2H3X A;  5FKS A;  3MZK A;  3N0E A;  3B7F A;  3I8E A;  4L9O A;  3SN6 B;  1E5T A;  4G1E A;  4KFM B;  4DNV A;  3MMY A;  3UVK A;  2Q7Q A;  1N6D A;  4N14 A;  4PNK B;  4CY1 A;  4HDJ A;  4K3I D;  3GFC A;  1A12 A;  1GOG A;  2G99 A;  3GRE A;  3PXW D;  3QHY B;  3IIY A;  2H9P A;  4DNW A;  4Z7O A;  3E0C A;  5CXC B;  2XZG A;  4ERY A;  4FA5 D;  2IUR A;  2HKR A;  2YNN A;  3O4J A;  3OKW A;  3V4P A;  4AOW A;  4YVD A;  5HE1 B;  4CI3 A;  3C75 H;  4NSX A;  3GC3 B;  4X3E A;  1GG2 B;  3SBR A;  1PBY B;  4CZY A;  3BWS A;  2OIZ A;  4ZOV A;  5TDH B;  3SLE D;  3AH8 B;  4G55 A;  2VDN A;  5CXC A;  4OWR A;  5I5J A;  4MMY A;  4J86 A;  3SWS D;  5AFU 3;  2H9N A;  3MZL A;  3EQ7 A;  3KCI A;  4WK4 A;  1Q47 A;  4A09 B;  2AGX A;  2EIE A;  1L0Q A;  1QNI A;  1C9L A;  1P22 A;  4WJK A;  4GMB A;  3FRX A;  5I5M A;  5TF2 A;  4A0A A;  2MTA H;  3HFQ A;  3CIK B;  2H13 A;  4JT6 C;  3FCU A;  3I7K A;  1C9I A;  3JPX A;  3N0D A;  2P9U C;  4Y7R A;  1E8N A;  2VDK A;  3OF7 A;  4FAN D;  4FA1 D;  1S4U X;  3QI0 A;  1K32 A;  4U7A A;  5EAR A;  5FKT A;  4ES0 A;  2IUQ A;  3EI1 A;  4G1M A;  5EAP A;  2XU7 A;  1SQJ A;  5FLX g;  1UTC A;  2VZ1 A;  3JRO A;  1U8C A;  4UI9 R;  5GMK n;  3OKY A;  5E6S A;  3A0F A;  3F3F A;  1K8K C;  2IAA A;  4GZ8 A;  3SVW D;  5EAM A;  3ZE1 A;  2XL2 A;  3OW8 A;  3PSL A;  4E54 A;  5CYK B;  4GQB B;  3SFZ A;  1L5G A;  2QR5 A;  3J80 g;  2HU7 A;  5THA A;  5C92 A;  3EQ9 A;  3EI1 B;  4XEI C;  3NVX A;  4JHN A;  4A11 B;  5E6U A;  4PXW A;  4GGD A;  4J0X A;  3T3M A;  3ZDZ A;  3PXT D;  5EM2 B;  3RFH A;  4A0A B;  3OKY B;  4BH6 A;  3MVD K;  3EI2 B;  3RMZ D;  4QRJ A;  1VYH C;  3KRX B;  2XE4 A;  4CI2 A;  1XIP A;  4PBZ A;  4MMZ A;  3I7H A;  4NC4 A;  1N6F A;  2BCJ B;  4XYI A;  4A08 A;  4GGA A;  2EID A;  4A0B A;  2IUV A;  4AEZ A;  2H9L A;  5C9Z B;  3CFV A;  3EI4 B;  5IT9 g;  5GSA A;  5IJ7 E;  2P9N C;  1JMX B;  4FB1 D;  3I89 A;  4FHL A;  2Z2O A;  2O9K A;  2IWF A;  1PGU A;  3OKT A;  4ERQ A;  3DWL C;  4ZOZ A;  2YBA A;  5IGQ A;  2B4E A;  5FKR A;  3SCY A;  1NEX B;  2IWK A;  1UOO A;  4BCD A;  3RSE C;  1RI6 A;  1JMZ B;  4J8G A;  2CE8 A;  1MG2 A;  4XYH A;  2VZ3 A;  3IUM A;  2I3T A;  4H5J A;  4BP8 A;  4ZOY A;  3K71 A;  4L3G D;  2H6K A;  3NVQ A;  5CXB B;  5EML B;  1GOF A;  5EAL A;  5EM2 A;  2B5L A;  3IVM A;  4IMM A;  4QQE A;  3DM0 A;  1VE6 A;  4J77 A;  3SJL D;  4G56 B;  1U2V C;  2TRC B;  4A2L A;  3ZDX A;  3JZG A;  4J73 A;  4O3U B;  1GP2 B;  4A2M A;  2UZX B;  3EU7 A;  5HE0 B;  2B5N A;  4CI8 A;  4JSP C;  3IUJ A;  2H47 A;  1H2Z A;  2G9A A;  5K19 A;  4PC0 A;  4CZV A;  2HU5 A;  3CFS B;  2P9L C;  1QFM A;  4NAA A;  5M61 A;  5FA5 B;  2J55 H;  2CN2 A;  2PM6 B;  3UR4 A;  3I7L A;  1M1X A;  4AN0 A;  3IKO A;  1R5M A;  3MKS B;  4NBM A;  4X60 B;  2XL3 A;  2VDR A;  1SQ9 A;  5AMS A;  4O2W A;  4O45 A;  4RE6 A;  4A0B B;  2I0S A;  1A0R B;  2XYI A;  1GOT B;  3FCS A;  5M5T A;  3RFG A;  3OTT A;  2HJB A;  4LGN A;  3JB9 L;  4E54 B;  1N6E A;  3OL2 B;  2OJY A;  5HDB A;  2OVQ B;  1YFQ A;  3V9F A;  4IA9 A;  4BCC A;  4ZN4 A;  3IUQ A;  4J82 A;  4R7A B;  4D6V A;  2HKM A;  2P9P C;  2GC4 A;  3MXX A;  4K3J B;  1MDA H;  1O6G A;  1OMW B;  3ZE0 A;  2VDP A;  4FA4 D;  4E5Z B;  5GXI A;  3NVN A;  2AGL A;  1TYQ C;  3C9C A;  5HQG A;  4DNU A;  1QFS A;  4NEN A;  4IRZ A;  2I0R A;  4J8B A;  4QAM A;  1YR2 A;  1B9Y A;  3UKR C;  3T3P A;  4UM9 A;  5AJA A;  3V4V A;  3DXK C;  5FFG A;  1JOF A;  2P9I C;  3EI3 A;  5H1M A;  3C99 A;  5IC7 A;  4EWR A;  4E5Z A;  3IJE A;  1XHM A;  2OK6 A;  3F3P A;  3ODT A;  3IIW A;  4X63 B;  2VDQ A;  2I3S A;  2GNQ A;  4GM9 A;  3PVU B;  3VGZ A;  2OVR B;  1UOP A;  3NIF A;  1GOH A;  4GM8 A;  3UVL A;  3RLM D;  3BG1 A;  3RRM C;  2BKL A;  3IJ0 A;  3VI4 A;  3VA6 A;  4QL1 A;  5HE2 B;  5GXH A;  1T2X A;  4J79 A;  3RN1 D;  2H6Q A;  5A2Q g;  3L4M D;  1JJU B;  4U1E I;  2H6N A;  3O4H A;  2I0T A;  5M5S A;  3BG0 A;  5CXB A;  3SXT D;  4AN1 A;  5SXM A;  1VE7 A;  4Z7N A;  3V5W B;  2Z2P A;  5I5I A;  3J81 g;  3UVM A;  4A7J A;  2YB8 B;  3ZE2 A;  3DXM C;  4JSX C;  2PM9 A;  5K1C C;  2Z2N A;  2HU8 A;  4MMX A;  1K3I A;  3PXS D;  3IJ1 A;  4J87 A;  4CY3 A;  1JV2 A;  5C2V B;  2AGZ A;  2J57 G;  3EG6 A;  2WQ8 A;  5IJ8 E;  4PSW B;  2PM7 B;  1PI6 A;  3IUN A;  1TYE A;  4MK0 B;  3EMH A;  4ZOX A;  4BCB A;  4L1M A;  3UKU C;  3DDU A;  3EQ8 A;  2HJ4 A;  4GQ1 A;  1B9X A;  4O9D A;  4A09 A;  3I7P A;  2OK4 A;  3DSM A;  2VDM A;  3ULE C;  1H2W A;  4TZ4 A;  2CO0 C;  5FFO A;  3EI4 A;  5JWZ A;  4BP9 A;  4BUJ C;  4CY2 A;  3RN0 D;  3EWE A;  2AGY A;  2W18 A;  3SBP A;  2QXV A;  3V7D B;  3F3G A;  4LG9 A;  3VH0 A;  4Z8L A;  2AH0 A;  3K27 A;  1U4C A;  3FM0 A;  2XDW A;  3PE7 A;  5FQD A;  5H17 A;  3AFC A;  2J56 H;  3AL8 B;  4D0K A;  4JT5 C;  4JSN C;  2AH1 A;  3IUL A;  3K72 A;  1MG3 A;  2IUP A;  5HE3 B;  4FWW A;  5E6R A;  2GC7 A;  2YNO A;  1TBG A;  3JZN A;  3U4Y A;  4J84 A;  1NR0 A;  4O3T B;  1I2M B;  5CYK A;  5FXY A;  3GD1 I;  3SMR A;  1VZ2 A;  4JXM A;  3NID A;  4FAV D;  2VDO A;  4OZU A;  2PBI B;  3MUO A;  4PBY A;  4AMY A;  3P4F A;  1BPO A;  3JRP A;  1FWX A;  2YNP A;  2BBK H;  4PSX B;  2UZY B;  4L3H D;  2P9K C;  4QT8 A;  2EBS A;  1SHY B;  3SHF A;  4H5I A;  4AX4 A;  5M5R A;  4ESG A;  3EI2 A;  4RE5 A;  2AGW A;  5M5V A;  1GXR A;  3NIG A;  1O6F A;  4CI1 A;  3IJC A;  4J78 A;  3L4O D;  5TEE A;  5C86 A;  3W15 A;  2H9M A;  1VZ3 A;  5FKQ A;  5HYN B;  4LG8 A;  4I79 A;  2OVP B;  4Z7Q A;  3VI3 A;  2CE9 A;  2VDL A;  4A08 B;  3ORV D;  2EIC A;  1XKS A;  4GGC A;  4GM3 A;  5M5U A;  4CY5 A;  3I7N A;  4O02 A;  3PSC B;  2HXC A;  5EMM B;  1UOQ A;  5TEF A;  2P9S C;  3O4G A;  3KRW B;  2YMU A;  2CNX A;  3ZWL B;  3IUR A;  2CO0 A;  2VC2 A;  2H68 A;  4WK2 A;  5H14 A;  5C2W B;  3MUN A;  1PEV A;  1E8M A;  1ERJ A;  3AL9 A;  2QC5 A;  4UM8 A;  3K6S A;  2H14 A;  3OL2 A;  5B4W A;  4ERZ A;  2CN3 A;  2PM9 B;  4X61 B;  4J81 A;  1H2Y A;  4CC9 A;  3I2N A;  4O1Q D;  1H2X A;  3ZDY A;  3UVN A;  4CZX A;  3JAM g;  3FGB A;  3K26 A;  3O4I A;  4AMZ A;  2QZP A;  5KDO B;  3AL8 A;  3PVW B;  4WK0 A;  4JHP C;  2HES X;  2EIB A;  3MKQ A;  4D9S A;  4A11 A;  2AQ5 A;  3EI3 B;  4JSV C;  5EMJ B;  3I8C A; 
#chains in the Genus database with same CATH homology
 3JZH A;  3C5M A;  4Y5R D;  5EMK B;  1OLZ A;  4BL0 A;  3SBQ A;  4JD2 C;  4L1Q D;  4GQ2 P;  4J0W A;  3I7O A;  3UVO A;  2HYE A;  4FA9 D;  2B5M A;  5IGO A;  2H3X A;  5FKS A;  3MZK A;  3N0E A;  3B7F A;  3I8E A;  4L9O A;  3SN6 B;  4KFM B;  3MMY A;  3UVK A;  2Q7Q A;  1N6D A;  4N14 A;  4PNK B;  4CY1 A;  4HDJ A;  4K3I D;  3GFC A;  2G99 A;  3GRE A;  3PXW D;  3IIY A;  2H9P A;  3E0C A;  5CXC B;  4ERY A;  4FA5 D;  2IUR A;  2HKR A;  2YNN A;  3OKW A;  4AOW A;  4YVD A;  5HE1 B;  4CI3 A;  3C75 H;  4NSX A;  4X3E A;  1GG2 B;  3SBR A;  1PBY B;  4CZY A;  3BWS A;  2OIZ A;  4ZOV A;  5TDH B;  3SLE D;  3AH8 B;  5CXC A;  4OWR A;  5I5J A;  4J86 A;  3SWS D;  5AFU 3;  2H9N A;  3MZL A;  1Q47 A;  4A09 B;  2AGX A;  1L0Q A;  1QNI A;  1P22 A;  4GMB A;  3FRX A;  5I5M A;  5TF2 A;  4A0A A;  2MTA H;  3HFQ A;  3CIK B;  2H13 A;  4JT6 C;  3I7K A;  2P9U C;  3JPX A;  3N0D A;  4Y7R A;  4FAN D;  4FA1 D;  1S4U X;  1K32 A;  4U7A A;  5EAR A;  5FKT A;  4ES0 A;  2IUQ A;  3EI1 A;  5EAP A;  2XU7 A;  1SQJ A;  5FLX g;  3JRO A;  4UI9 R;  5GMK n;  3OKY A;  3A0F A;  3F3F A;  1K8K C;  2IAA A;  4GZ8 A;  3SVW D;  5EAM A;  2XL2 A;  3OW8 A;  3PSL A;  4E54 A;  5CYK B;  4GQB B;  3SFZ A;  3J80 g;  5THA A;  3EI1 B;  4XEI C;  3NVX A;  4A11 B;  4PXW A;  4GGD A;  4J0X A;  3PXT D;  5EM2 B;  3RFH A;  4A0A B;  3OKY B;  4BH6 A;  3EI2 B;  3RMZ D;  4QRJ A;  1VYH C;  3KRX B;  4CI2 A;  1XIP A;  4PBZ A;  3I7H A;  1N6F A;  2BCJ B;  4XYI A;  4A08 A;  4GGA A;  4A0B A;  2IUV A;  4AEZ A;  2H9L A;  5C9Z B;  3CFV A;  3EI4 B;  5IT9 g;  5GSA A;  5IJ7 E;  2P9N C;  1JMX B;  4FB1 D;  3I89 A;  4FHL A;  2Z2O A;  2O9K A;  2IWF A;  1PGU A;  3OKT A;  4ERQ A;  3DWL C;  4ZOZ A;  2YBA A;  5IGQ A;  2B4E A;  5FKR A;  3SCY A;  1NEX B;  2IWK A;  3RSE C;  1RI6 A;  1JMZ B;  4J8G A;  2CE8 A;  1MG2 A;  4XYH A;  2I3T A;  4H5J A;  4ZOY A;  4L3G D;  2H6K A;  3NVQ A;  5CXB B;  5EML B;  5EAL A;  5EM2 A;  2B5L A;  4IMM A;  4QQE A;  3DM0 A;  4J77 A;  3SJL D;  4G56 B;  1U2V C;  2TRC B;  4A2L A;  3JZG A;  4J73 A;  4O3U B;  1GP2 B;  4A2M A;  2UZX B;  3EU7 A;  5HE0 B;  2B5N A;  4CI8 A;  4JSP C;  2H47 A;  2G9A A;  5K19 A;  4PC0 A;  4CZV A;  3CFS B;  2P9L C;  5FA5 B;  2J55 H;  2CN2 A;  2PM6 B;  3UR4 A;  3I7L A;  3IKO A;  1R5M A;  3MKS B;  4X60 B;  2XL3 A;  1SQ9 A;  5AMS A;  4O45 A;  4A0B B;  2I0S A;  1A0R B;  2XYI A;  1GOT B;  3RFG A;  3OTT A;  2HJB A;  4LGN A;  3JB9 L;  4E54 B;  1N6E A;  3OL2 B;  2OJY A;  2OVQ B;  3V9F A;  1YFQ A;  4IA9 A;  4ZN4 A;  4J82 A;  4R7A B;  4D6V A;  2HKM A;  2P9P C;  2GC4 A;  3MXX A;  4K3J B;  1MDA H;  4E5Z B;  1OMW B;  4FA4 D;  5GXI A;  3NVN A;  2AGL A;  1TYQ C;  3C9C A;  5HQG A;  2I0R A;  4J8B A;  1B9Y A;  3UKR C;  5AJA A;  3DXK C;  1JOF A;  2P9I C;  3EI3 A;  5H1M A;  3C99 A;  5IC7 A;  4EWR A;  4E5Z A;  1XHM A;  2OK6 A;  3F3P A;  3ODT A;  3IIW A;  4X63 B;  2I3S A;  2GNQ A;  4GM9 A;  3PVU B;  3VGZ A;  2OVR B;  4GM8 A;  3UVL A;  3RLM D;  3BG1 A;  3RRM C;  3IJ0 A;  3VA6 A;  4QL1 A;  5HE2 B;  5GXH A;  4J79 A;  3RN1 D;  2H6Q A;  5A2Q g;  3L4M D;  1JJU B;  4U1E I;  2H6N A;  2I0T A;  3BG0 A;  5CXB A;  3SXT D;  5SXM A;  3V5W B;  2Z2P A;  5I5I A;  3J81 g;  3UVM A;  4A7J A;  2YB8 B;  3DXM C;  4JSX C;  2PM9 A;  5K1C C;  2Z2N A;  3PXS D;  3IJ1 A;  4J87 A;  4CY3 A;  5C2V B;  2AGZ A;  2J57 G;  3EG6 A;  5IJ8 E;  4PSW B;  2PM7 B;  1PI6 A;  4MK0 B;  3EMH A;  4ZOX A;  3UKU C;  2HJ4 A;  4GQ1 A;  1B9X A;  4O9D A;  4A09 A;  3I7P A;  2OK4 A;  3DSM A;  3ULE C;  4TZ4 A;  2CO0 C;  3EI4 A;  5JWZ A;  4BUJ C;  4CY2 A;  3RN0 D;  3EWE A;  2AGY A;  2W18 A;  3SBP A;  2QXV A;  3V7D B;  3F3G A;  4LG9 A;  3VH0 A;  4Z8L A;  2AH0 A;  3K27 A;  1U4C A;  3FM0 A;  3PE7 A;  5FQD A;  5H17 A;  3AFC A;  2J56 H;  3AL8 B;  4D0K A;  4JT5 C;  4JSN C;  2AH1 A;  1MG3 A;  2IUP A;  5HE3 B;  4FWW A;  2GC7 A;  2YNO A;  1TBG A;  3JZN A;  3U4Y A;  4J84 A;  1NR0 A;  4O3T B;  5CYK A;  5FXY A;  3SMR A;  4JXM A;  4FAV D;  4OZU A;  2PBI B;  4PBY A;  3P4F A;  3JRP A;  1FWX A;  2YNP A;  2BBK H;  4PSX B;  2UZY B;  4L3H D;  2P9K C;  4QT8 A;  2EBS A;  1SHY B;  3SHF A;  4H5I A;  3EI2 A;  4ESG A;  2AGW A;  1GXR A;  4CI1 A;  3IJC A;  4J78 A;  3L4O D;  5TEE A;  3W15 A;  2H9M A;  5FKQ A;  5HYN B;  4LG8 A;  4I79 A;  2OVP B;  2CE9 A;  4A08 B;  3ORV D;  1XKS A;  4GGC A;  4GM3 A;  4CY5 A;  3I7N A;  2HXC A;  3PSC B;  5EMM B;  5TEF A;  2P9S C;  3KRW B;  2YMU A;  2CNX A;  3ZWL B;  2CO0 A;  2H68 A;  5H14 A;  5C2W B;  1PEV A;  1ERJ A;  3AL9 A;  2QC5 A;  2H14 A;  3OL2 A;  5B4W A;  4ERZ A;  2CN3 A;  2PM9 B;  4X61 B;  4J81 A;  4CC9 A;  3I2N A;  4O1Q D;  3UVN A;  4CZX A;  3JAM g;  3FGB A;  3K26 A;  5KDO B;  3AL8 A;  3PVW B;  2HES X;  3MKQ A;  4A11 A;  2AQ5 A;  3EI3 B;  4JSV C;  5EMJ B;  3I8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...