4ZN4A

Crystal structure of sqt1 from chaetomium thermophilum solved by mr
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
483
structure length
409
Chain Sequence
b'ALENDSIAYFDGHKDSVFAIAQHPLYPNIVATGGSEGDADDAPGKGYVLDISATSLNPIFEIDGHTDSINALTFTLPRGDFLVSGGMDGRMRVYAVSVPQNGALAQFKFLAESQETEEINWFAPCPSPDHPNTIALGASDGSVWVFTLDNPVQIVQSYFLHTGPCTAGAWSPDGLLLATVSEDESLHVYDVFGVAASKSLVTDNGQTVVSLTNVDQRFAVEGGLFSVAVSPTGAVVAVGGAGGQIKIVGLPRLSQAGTILASLQIQSDNIESLAFSPSAPILAAGSTDGSIAVFDTSRSFALRRHLRGAHAEDPVVKVEFVKSPPNAAMAGWLLTSCGMDGVVRRWDLRGGTAGPGTLPHMAPSGLVKEWKGHRSGQEGGGVLGFVQGETGERIVTVGDDAVVLVFEAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sqt1
publication title Co-translational capturing of nascent ribosomal proteins by their dedicated chaperones.
pubmed doi rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
molecule tags Chaperone
total genus 105
structure length 409
sequence length 483
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4zn4A00
3OW8A 5HE1B 4PC0A 1A0RB 3JROA 4O3TB 2PM7B 2J57G 2PM9A 3GREA 1TYQC 3I7NA 3I8CA 3EI4A 3UKRC 1SQJA 3JZNA 3JAMg 1SHYB 2Z2OA 4ZOVA 1B9XA 4HDJA 3I2NA 4J81A 4LG8A 3DSMA 3BG1A 5THAA 4PBZA 5H14A 5IT9g 4X60B 2P9PC 4X3EA 5A2Qg 5HE2B 5FKTA 5AFU3 3PSLA 2YNPA 4XEIC 4FB1D 2Z2NA 3I7KA 4E5ZA 2B5MA 4D6VA 2OVPB 5KDOB 4ERQA 3VGZA 3CFVA 4K3JB 1NR0A 2H6KA 2IWFA 4Z8LA 3CFSB 1ERJA 4ZOZA 3MKQA 1N6FA 3K27A 4PSXB 2CNXA 3I7HA 5IJ7E 2B4EA 4BUJC 5GSAA 4L9OA 4A08A 4J84A 3AL9A 3L4MD 5CXCA 4PSWB 4CY2A 4QL1A 4MK0B 2Q7QA 2J55H 5FQDA 2I3SA 2H14A 4GM8A 3RN0D 1FWXA 1Q47A 5H17A 3JZHA 4ERYA 3I7LA 4CC9A 4ERZA 4IA9A 2H9MA 1K8KC 3F3PA 5FKQA 3V5WB 2PBIB 3C99A 4IMMA 3BWSA 5EMKB 5B4WA 1B9YA 5FXYA 3IKOA 3EWEA 2GC4A 4GQBB 2OVQB 3IJ0A 2XYIA 2HJ4A 3PVUB 3MXXA 3EI3B 1XHMA 2YMUA 3EG6A 2OK4A 4GM9A 2AGZA 3W15A 3PVWB 3VA6A 3SXTD 4J86A 5I5MA 2OVRB 5IC7A 5K1CC 3SLED 2BBKH 4ZOYA 2H3XA 4LGNA 3DWLC 4N14A 4FAVD 4UI9R 4NSXA 5I5JA 4JSVC 3HFQA 3I8EA 4CI8A 5IJ8E 4O3UB 4OZUA 3KRXB 1PEVA 5TEFA 4A09B 4A09A 4BL0A 3UVOA 5C2VB 4J87A 3AFCA 5TF2A 2IUPA 4JSXC 4E54B 4E54A 4JT6C 1PBYB 1L0QA 1R5MA 1N6DA 3EI1B 3EI1A 4A11B 2HXCA 3RFHA 1U2VC 1S4UX 4O1QD 2GNQA 2IURA 2B5LA 2W18A 3DXMC 1GXRA 3NVQA 4U7AA 2AGYA 2TRCB 3ZWLB 5HQGA 1RI6A 5TEEA 3UVNA 4QQEA 2P9KC 3AL8B 4H5JA 3P4FA 2J56H 4Y5RD 4ZN4A 5FLXg 2XL3A 5FA5B 2G99A 4K3ID 5C9ZB 3OKTA 3SVWD 5GMKn 3OKYB 3OKYA 3SBPA 1N6EA 5EMJB 4GM3A 4EWRA 3A0FA 4L1QD 3UVMA 3IIWA 1YFQA 4O9DA 4FA4D 1JMXB 2H9PA 1OLZA 4O45A 4AOWA 4FA1D 3UR4A 3FM0A 3UKUC 3SN6B 2UZYB 2AGXA 3I7PA 3IIYA 5IGOA 3PXWD 2P9UC 2H9NA 3FGBA 3MZLA 4D0KA 4LG9A 3C9CA 5EARA 2QXVA 4QRJA 4GGAA 4A0AB 4J77A 2CE8A 4J0XA 4J79A 2AGWA 4CI2A 4JSPC 3J81g 5H1MA 3I89A 4PBYA 4J8BA 2H6QA 4YVDA 3SCYA 3SHFA 4FA5D 4J73A 1XKSA 4CY5A 3DXKC 5FKRA 2GC7A 1XIPA 3BG0A 3EI3A 3RRMC 5EALA 4A2LA 4GZ8A 5C2WB 4FA9D 3RLMD 3SFZA 3E0CA 2P9LC 4A7JA 2Z2PA 1MG3A 4Y7RA 1GP2B 4CZXA 3JRPA 2P9IC 3DM0A 3I7OA 2MTAH 1NEXB 4U1EI 4PNKB 2YNOA 3UVLA 4FAND 2I0SA 3MMYA 3PXSD 4X63B 2CN3A 3OL2B 3EI2B 1JMZB 3EI2A 1OMWB 4H5IA 1U4CA 5TDHB 4TZ4A 2IAAA 2HKMA 2IUQA 3K26A 3C5MA 4CZVA 3ODTA 2HYEA 3U4YA 2P9SC 4J0WA 2QC5A 5HE0B 5EMMB 4J78A 5EM2A 5EM2B 2CO0C 3OTTA 4A11A 3MKSB 4L3GD 4G56B 4CI3A 5AJAA 3V7DB 2PM9B 3EI4B 4BH6A 2YB8B 4CZYA 2AH1A 3F3FA 2XU7A 4A0BB 3EU7A 4A0BA 3JZGA 2G9AA 3F3GA 3MZKA 4CI1A 4JT5C 3AL8A 2YNNA 1JOFA 2H68A 1GOTB 3PSCB 2I3TA 4KFMB 3N0EA 4JXMA 3J80g 3SJLD 2YBAA 4ESGA 2IWKA 2OJYA 4X61B 2BCJB 2OIZA 4CY1A 5GXIA 4E5ZB 1PI6A 4XYHA 3RSEC 3NVNA 5HYNB 3SWSD 3JB9L 3UVKA 5SXMA 3B7FA 3SMRA 3NVXA 4QT8A 4JD2C 4CY3A 2I0TA 4ES0A 2H6NA 5EAPA 3EMHA 3ORVD 1SQ9A 5EMLB 1MG2A 3KRWB 3OKWA 4J8GA 2AGLA 1JJUB 3C75H 2I0RA 4R7AB 3CIKB 5AMSA 2H9LA 1TBGA 2XL2A 4A08B 4AEZA 3N0DA 4GGDA 5CXCB 3SBRA 2IUVA 4GGCA 3SBQA 1QNIA 4A0AA 2H47A 2EBSA 2OK6A 3V9FA 2CN2A 3AH8B 5K19A 4OWRA 5I5IA 2HJBA 5HE3B 5IGQA 5FKSA 3IJ1A 3GFCA 5CYKB 5CYKA 3VH0A 3RFGA 2B5NA 5EAMA 2HKRA 2AH0A 1VYHC 3PE7A 5CXBB 5CXBA 4A2MA 1GG2B 4ZOXA 3FRXA 2PM6B 4GQ2P 5JWZA 2O9KA 3RMZD 3L4OD 4I79A 1P22A 2H13A 4J82A 2P9NC 3JPXA 1MDAH 4FWWA 4GMBA 2UZXB 4L3HD 4FHLA 3OL2A 2AQ5A 5GXHA 2CE9A 3ULEC 1PGUA 4GQ1A 4XYIA 2HESX 4JSNC 4PXWA 2CO0A 3RN1D 1K32A 3IJCA 3PXTD
chains in the Genus database with same CATH superfamily
3OW8A 5HE1B 4PC0A 2VC2A 1A0RB 1C9LA 3JROA 4O3TB 3EQ9A 2PM7B 2J57G 2PM9A 3GREA 1TYQC 3I7NA 3I8CA 3EI4A 3T3PA 3UKRC 1SQJA 3JZNA 3JAMg 1SHYB 2Z2OA 3IUQA 3QHYB 4ZOVA 1B9XA 4HDJA 4WK2A 3EQ8A 3I2NA 4G55A 4J81A 4LG8A 4O2WA 4L1MA 3DSMA 4Z7OA 3BG1A 5M5TA 3IUMA 1GOGA 4PBZA 5H14A 5THAA 5IT9g 4X60B 2P9PC 4X3EA 4AN0A 5A2Qg 5HE2B 5FKTA 5AFU3 3PSLA 2YNPA 4NC4A 2VDQA 4XEIC 2QZPA 1H2ZA 2Z2NA 4FB1D 5FFGA 3I7KA 4E5ZA 4Z7NA 1O6GA 2B5MA 4D6VA 2OVPB 5KDOB 4ERQA 3VGZA 3CFVA 4K3JB 1NR0A 3K6SA 3QI0A 2H6KA 2IWFA 3ZE1A 4Z8LA 3CFSB 1ERJA 4ZOZA 1BPOA 3MKQA 1M1XA 4QAMA 1N6FA 5C86A 1K3IA 3K27A 4PSXB 1I2MB 2CNXA 3I7HA 5IJ7E 2B4EA 4BUJC 5GSAA 3O4IA 4L9OA 4A08A 3GD1I 4J84A 1JV2A 3AL9A 3L4MD 3V4PA 5CXCA 4PSWB 4CY2A 4QL1A 3IJEA 4MK0B 3VI4A 3NIGA 2Q7QA 2J55H 3IUNA 2I3SA 5FQDA 2H14A 4GM8A 3RN0D 1FWXA 2VDRA 1Q47A 5H17A 4G1EA 3JZHA 4ERYA 2HU5A 3I7LA 4CC9A 4ERZA 4BP9A 4IA9A 2H9MA 1K8KC 3F3PA 5FKQA 3IULA 3V5WB 2PBIB 1VZ3A 3C99A 4IMMA 3BWSA 5HDBA 5EMKB 5B4WA 1B9YA 5M5UA 5FXYA 3IKOA 3EWEA 2GC4A 5M61A 4NAAA 4JHNA 3ZE2A 4GQBB 2OVQB 3IJ0A 2XYIA 2HJ4A 3PVUB 3MXXA 4WK4A 1VZ2A 3EI3B 1XHMA 3NIDA 1O6FA 2YMUA 1U8CA 2OK4A 3EG6A 4GM9A 2AGZA 3W15A 3PVWB 3VA6A 3SXTD 4J86A 4MMYA 5I5MA 2WQ8A 4NBMA 2OVRB 5IC7A 5K1CC 2VDPA 2BBKH 3SLED 4ZOYA 2H3XA 4LGNA 3ZDYA 3DWLC 4N14A 4FAVD 4IRZA 4JHPC 4RE5A 4UI9R 4NSXA 3FCSA 5I5JA 1E5TA 4JSVC 3HFQA 3I8EA 4CI8A 3MUOA 3O4HA 4O3UB 4OZUA 3KRXB 5IJ8E 1PEVA 5TEFA 3ZDXA 4A09B 4A09A 4BL0A 3UVOA 2EICA 1C9IA 1H2XA 4G1MA 5C2VB 5E6RA 4J87A 3AFCA 5TF2A 2IUPA 4JSXC 4E54B 4E54A 4JT6C 2JKXA 1R5MA 1PBYB 1L0QA 1N6DA 3EI1B 3EI1A 4A11B 2HXCA 3RFHA 1U2VC 3NIFA 4DNUA 1S4UX 3OF7A 4O1QD 2GNQA 2IURA 2B5LA 2W18A 3DXMC 1GXRA 3NVQA 4U7AA 1UTCA 4RE6A 2AGYA 2TRCB 3ZWLB 5HQGA 1RI6A 5TEEA 3UVNA 4QQEA 4AX4A 2P9KC 3AL8B 5E6UA 2XE4A 4H5JA 3P4FA 2J56H 4Y5RD 4ZN4A 5FLXg 2XL3A 5FA5B 2G99A 4K3ID 5C9ZB 3OKTA 3O4JA 1VE6A 3SVWD 5GMKn 3OKYB 3OKYA 3SBPA 1N6EA 1UOQA 4BCBA 1UOPA 5EMJB 4GM3A 3V4VA 4AN1A 3A0FA 4EWRA 4L1QD 3UVMA 3IIWA 1YFQA 4O9DA 4FA4D 1JMXB 2H9PA 1OLZA 4O45A 4AOWA 4FA1D 3UR4A 3FM0A 3UKUC 3SN6B 2UZYB 3FCUA 2AGXA 3I7PA 3IIYA 5IGOA 4BCCA 3PXWD 2P9UC 2H9NA 3FGBA 3MZLA 4D0KA 4LG9A 3C9CA 5EARA 3GC3B 2QXVA 4QRJA 4GGAA 5M5SA 4J77A 2CE8A 4A0AB 4J0XA 4J79A 2AGWA 4CI2A 4JSPC 3J81g 5H1MA 3I89A 4PBYA 2EIBA 4J8BA 2H6QA 4YVDA 3SCYA 3SHFA 4FA5D 4J73A 1XKSA 4CY5A 3DXKC 5FKRA 2GC7A 1E8NA 1XIPA 3BG0A 3EI3A 3IUJA 3RRMC 5EALA 4A2LA 4GZ8A 5C2WB 4FA9D 3RLMD 3SFZA 4WJKA 3E0CA 4DNVA 2P9LC 4A7JA 2Z2PA 1MG3A 4Y7RA 2HU7A 1GP2B 4CZXA 1JTDB 3JRPA 2P9IC 3IVMA 3DM0A 3I7OA 3K72A 2MTAH 1NEXB 2VZ3A 3DDUA 4U1EI 1T2XA 4PNKB 4UM9A 3IURA 2YNOA 3UVLA 4FAND 2I0SA 3MMYA 3PXSD 4X63B 2CN3A 1TYEA 3OL2B 4MMZA 3EI2B 1JMZB 3EI2A 1OMWB 4H5IA 1U4CA 4MMXA 5TDHB 2QR5A 4TZ4A 2IAAA 4WK0A 2HKMA 2IUQA 2XDWA 3K26A 3C5MA 4CZVA 3ODTA 2HYEA 3U4YA 2P9SC 4AMZA 4J0WA 2QC5A 2VZ1A 5HE0B 4J78A 5EM2A 5EMMB 3O4GA 3VI3A 2CO0C 3OTTA 4A11A 5EM2B 3MKSB 4L3GD 4G56B 4CI3A 5AJAA 3V7DB 2PM9B 3K71A 3EI4B 4BH6A 2YB8B 4CZYA 2AH1A 3F3FA 2XU7A 4A0BB 3EU7A 4A0BA 1H2YA 3JZGA 2G9AA 1H2WA 3F3GA 3MZKA 1UOOA 3MUNA 4CI1A 4JT5C 3AL8A 2YNNA 1JOFA 2H68A 1GOTB 2I3TA 3PSCB 4KFMB 3N0EA 4JXMA 3J80g 4UM8A 3SJLD 2VDKA 2YBAA 4ESGA 2IWKA 2OJYA 4X61B 2BCJB 2OIZA 5FFOA 4CY1A 4E5ZB 5GXIA 4NENA 1VE7A 1PI6A 4XYHA 3RSEC 2EIEA 3NVNA 5C92A 2BKLA 3ZE0A 5HYNB 3SWSD 3JB9L 3UVKA 3EQ7A 5SXMA 3B7FA 3SMRA 3NVXA 4QT8A 2EIDA 4JD2C 4CY3A 2I0TA 4ES0A 2H6NA 5EAPA 3EMHA 3ORVD 4DNWA 4Z7QA 1SQ9A 5EMLB 4D9SA 1MG2A 3KRWB 3OKWA 1L5GA 4J8GA 2AGLA 1JJUB 3C75H 2I0RA 4R7AB 3CIKB 5AMSA 2H9LA 1TBGA 2XL2A 4A08B 2HU8A 4AEZA 3N0DA 4GGDA 5CXCB 3SBRA 2IUVA 4GGCA 3SBQA 1QNIA 3ZDZA 1QFMA 2XZGA 4A0AA 2H47A 2EBSA 2OK6A 2VDMA 3V9FA 2CN2A 3AH8B 1GOHA 5K19A 4OWRA 5I5IA 2HJBA 2VDOA 5HE3B 4BCDA 5IGQA 5FKSA 5E6SA 3MVDK 3IJ1A 3GFCA 5CYKB 1A12A 5CYKA 3VH0A 3RFGA 2B5NA 5EAMA 2HKRA 2AH0A 1VYHC 3PE7A 5CXBB 5CXBA 4A2MA 1GG2B 4ZOXA 3FRXA 2PM6B 4GQ2P 5JWZA 2O9KA 3RMZD 3L4OD 4I79A 1P22A 2H13A 4J82A 4AMYA 3T3MA 2P9NC 3JPXA 1QFSA 5M5RA 1MDAH 4FWWA 5M5VA 2VDNA 2UZXB 3KCIA 4GMBA 1E8MA 4FHLA 4L3HD 3OL2A 2AQ5A 1YR2A 5GXHA 2CE9A 3ULEC 4BP8A 1GOFA 1PGUA 4GQ1A 4XYIA 2HESX 4JSNC 4PXWA 2CO0A 3RN1D 1K32A 3IJCA 3PXTD 4O02A 2VDLA
chains in the Genus database with same CATH topology
3OW8A 5HE1B 4PC0A 1A0RB 3JROA 4O3TB 2PM7B 2J57G 2PM9A 3GREA 1TYQC 3I7NA 3I8CA 3EI4A 3UKRC 1SQJA 3JZNA 3JAMg 1SHYB 2Z2OA 4ZOVA 1B9XA 4HDJA 3I2NA 4J81A 4LG8A 3DSMA 3BG1A 5THAA 4PBZA 5H14A 5IT9g 4X60B 2P9PC 4X3EA 5A2Qg 5HE2B 5FKTA 5AFU3 3PSLA 2YNPA 4XEIC 4FB1D 2Z2NA 3I7KA 4E5ZA 2B5MA 4D6VA 2OVPB 5KDOB 4ERQA 3VGZA 3CFVA 4K3JB 1NR0A 2H6KA 2IWFA 4Z8LA 3CFSB 1ERJA 4ZOZA 3MKQA 1N6FA 3K27A 4PSXB 2CNXA 3I7HA 5IJ7E 2B4EA 4BUJC 5GSAA 4L9OA 4A08A 4J84A 3AL9A 3L4MD 5CXCA 4PSWB 4CY2A 4QL1A 4MK0B 2Q7QA 2J55H 5FQDA 2I3SA 2H14A 4GM8A 3RN0D 1FWXA 1Q47A 5H17A 3JZHA 4ERYA 3I7LA 4CC9A 4ERZA 4IA9A 2H9MA 1K8KC 3F3PA 5FKQA 3V5WB 2PBIB 3C99A 4IMMA 3BWSA 5EMKB 5B4WA 1B9YA 5FXYA 3IKOA 3EWEA 2GC4A 4GQBB 2OVQB 3IJ0A 2XYIA 2HJ4A 3PVUB 3MXXA 3EI3B 1XHMA 2YMUA 3EG6A 2OK4A 4GM9A 2AGZA 3W15A 3PVWB 3VA6A 3SXTD 4J86A 5I5MA 2OVRB 5IC7A 5K1CC 3SLED 2BBKH 4ZOYA 2H3XA 4LGNA 3DWLC 4N14A 4FAVD 4UI9R 4NSXA 5I5JA 4JSVC 3HFQA 3I8EA 4CI8A 5IJ8E 4O3UB 4OZUA 3KRXB 1PEVA 5TEFA 4A09B 4A09A 4BL0A 3UVOA 5C2VB 4J87A 3AFCA 5TF2A 2IUPA 4JSXC 4E54B 4E54A 4JT6C 1PBYB 1L0QA 1R5MA 1N6DA 3EI1B 3EI1A 4A11B 2HXCA 3RFHA 1U2VC 1S4UX 4O1QD 2GNQA 2IURA 2B5LA 2W18A 3DXMC 1GXRA 3NVQA 4U7AA 2AGYA 2TRCB 3ZWLB 5HQGA 1RI6A 5TEEA 3UVNA 4QQEA 2P9KC 3AL8B 4H5JA 3P4FA 2J56H 4Y5RD 4ZN4A 5FLXg 2XL3A 5FA5B 2G99A 4K3ID 5C9ZB 3OKTA 3SVWD 5GMKn 3OKYB 3OKYA 3SBPA 1N6EA 5EMJB 4GM3A 4EWRA 3A0FA 4L1QD 3UVMA 3IIWA 1YFQA 4O9DA 4FA4D 1JMXB 2H9PA 1OLZA 4O45A 4AOWA 4FA1D 3UR4A 3FM0A 3UKUC 3SN6B 2UZYB 2AGXA 3I7PA 3IIYA 5IGOA 3PXWD 2P9UC 2H9NA 3FGBA 3MZLA 4D0KA 4LG9A 3C9CA 5EARA 2QXVA 4QRJA 4GGAA 4A0AB 4J77A 2CE8A 4J0XA 4J79A 2AGWA 4CI2A 4JSPC 3J81g 5H1MA 3I89A 4PBYA 4J8BA 2H6QA 4YVDA 3SCYA 3SHFA 4FA5D 4J73A 1XKSA 4CY5A 3DXKC 5FKRA 2GC7A 1XIPA 3BG0A 3EI3A 3RRMC 5EALA 4A2LA 4GZ8A 5C2WB 4FA9D 3RLMD 3SFZA 3E0CA 2P9LC 4A7JA 2Z2PA 1MG3A 4Y7RA 1GP2B 4CZXA 3JRPA 2P9IC 3DM0A 3I7OA 2MTAH 1NEXB 4U1EI 4PNKB 2YNOA 3UVLA 4FAND 2I0SA 3MMYA 3PXSD 4X63B 2CN3A 3OL2B 3EI2B 1JMZB 3EI2A 1OMWB 4H5IA 1U4CA 5TDHB 4TZ4A 2IAAA 2HKMA 2IUQA 3K26A 3C5MA 4CZVA 3ODTA 2HYEA 3U4YA 2P9SC 4J0WA 2QC5A 5HE0B 5EMMB 4J78A 5EM2A 5EM2B 2CO0C 3OTTA 4A11A 3MKSB 4L3GD 4G56B 4CI3A 5AJAA 3V7DB 2PM9B 3EI4B 4BH6A 2YB8B 4CZYA 2AH1A 3F3FA 2XU7A 4A0BB 3EU7A 4A0BA 3JZGA 2G9AA 3F3GA 3MZKA 4CI1A 4JT5C 3AL8A 2YNNA 1JOFA 2H68A 1GOTB 3PSCB 2I3TA 4KFMB 3N0EA 4JXMA 3J80g 3SJLD 2YBAA 4ESGA 2IWKA 2OJYA 4X61B 2BCJB 2OIZA 4CY1A 5GXIA 4E5ZB 1PI6A 4XYHA 3RSEC 3NVNA 5HYNB 3SWSD 3JB9L 3UVKA 5SXMA 3B7FA 3SMRA 3NVXA 4QT8A 4JD2C 4CY3A 2I0TA 4ES0A 2H6NA 5EAPA 3EMHA 3ORVD 1SQ9A 5EMLB 1MG2A 3KRWB 3OKWA 4J8GA 2AGLA 1JJUB 3C75H 2I0RA 4R7AB 3CIKB 5AMSA 2H9LA 1TBGA 2XL2A 4A08B 4AEZA 3N0DA 4GGDA 5CXCB 3SBRA 2IUVA 4GGCA 3SBQA 1QNIA 4A0AA 2H47A 2EBSA 2OK6A 3V9FA 2CN2A 3AH8B 5K19A 4OWRA 5I5IA 2HJBA 5HE3B 5IGQA 5FKSA 3IJ1A 3GFCA 5CYKB 5CYKA 3VH0A 3RFGA 2B5NA 5EAMA 2HKRA 2AH0A 1VYHC 3PE7A 5CXBB 5CXBA 4A2MA 1GG2B 4ZOXA 3FRXA 2PM6B 4GQ2P 5JWZA 2O9KA 3RMZD 3L4OD 4I79A 1P22A 2H13A 4J82A 2P9NC 3JPXA 1MDAH 4FWWA 4GMBA 2UZXB 4L3HD 4FHLA 3OL2A 2AQ5A 5GXHA 2CE9A 3ULEC 1PGUA 4GQ1A 4XYIA 2HESX 4JSNC 4PXWA 2CO0A 3RN1D 1K32A 3IJCA 3PXTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW8 A;  5HE1 B;  4PC0 A;  1A0R B;  3JRO A;  4O3T B;  2PM7 B;  2J57 G;  2PM9 A;  3GRE A;  1TYQ C;  3I7N A;  3I8C A;  3EI4 A;  3UKR C;  1SQJ A;  3JZN A;  3JAM g;  1SHY B;  2Z2O A;  4ZOV A;  1B9X A;  4HDJ A;  3I2N A;  4J81 A;  4LG8 A;  3DSM A;  3BG1 A;  5THA A;  4PBZ A;  5H14 A;  5IT9 g;  4X60 B;  2P9P C;  4X3E A;  5A2Q g;  5HE2 B;  5FKT A;  5AFU 3;  3PSL A;  2YNP A;  4XEI C;  4FB1 D;  2Z2N A;  3I7K A;  4E5Z A;  2B5M A;  4D6V A;  2OVP B;  5KDO B;  4ERQ A;  3VGZ A;  3CFV A;  4K3J B;  1NR0 A;  2H6K A;  2IWF A;  4Z8L A;  3CFS B;  1ERJ A;  4ZOZ A;  3MKQ A;  1N6F A;  3K27 A;  4PSX B;  2CNX A;  3I7H A;  5IJ7 E;  2B4E A;  4BUJ C;  5GSA A;  4L9O A;  4A08 A;  4J84 A;  3AL9 A;  3L4M D;  5CXC A;  4PSW B;  4CY2 A;  4QL1 A;  4MK0 B;  2Q7Q A;  2J55 H;  5FQD A;  2I3S A;  2H14 A;  4GM8 A;  3RN0 D;  1FWX A;  1Q47 A;  5H17 A;  3JZH A;  4ERY A;  3I7L A;  4CC9 A;  4ERZ A;  4IA9 A;  2H9M A;  1K8K C;  3F3P A;  5FKQ A;  3V5W B;  2PBI B;  3C99 A;  4IMM A;  3BWS A;  5EMK B;  5B4W A;  1B9Y A;  5FXY A;  3IKO A;  3EWE A;  2GC4 A;  4GQB B;  2OVQ B;  3IJ0 A;  2XYI A;  2HJ4 A;  3PVU B;  3MXX A;  3EI3 B;  1XHM A;  2YMU A;  3EG6 A;  2OK4 A;  4GM9 A;  2AGZ A;  3W15 A;  3PVW B;  3VA6 A;  3SXT D;  4J86 A;  5I5M A;  2OVR B;  5IC7 A;  5K1C C;  3SLE D;  2BBK H;  4ZOY A;  2H3X A;  4LGN A;  3DWL C;  4N14 A;  4FAV D;  4UI9 R;  4NSX A;  5I5J A;  4JSV C;  3HFQ A;  3I8E A;  4CI8 A;  5IJ8 E;  4O3U B;  4OZU A;  3KRX B;  1PEV A;  5TEF A;  4A09 B;  4A09 A;  4BL0 A;  3UVO A;  5C2V B;  4J87 A;  3AFC A;  5TF2 A;  2IUP A;  4JSX C;  4E54 B;  4E54 A;  4JT6 C;  1PBY B;  1L0Q A;  1R5M A;  1N6D A;  3EI1 B;  3EI1 A;  4A11 B;  2HXC A;  3RFH A;  1U2V C;  1S4U X;  4O1Q D;  2GNQ A;  2IUR A;  2B5L A;  2W18 A;  3DXM C;  1GXR A;  3NVQ A;  4U7A A;  2AGY A;  2TRC B;  3ZWL B;  5HQG A;  1RI6 A;  5TEE A;  3UVN A;  4QQE A;  2P9K C;  3AL8 B;  4H5J A;  3P4F A;  2J56 H;  4Y5R D;  4ZN4 A;  5FLX g;  2XL3 A;  5FA5 B;  2G99 A;  4K3I D;  5C9Z B;  3OKT A;  3SVW D;  5GMK n;  3OKY B;  3OKY A;  3SBP A;  1N6E A;  5EMJ B;  4GM3 A;  4EWR A;  3A0F A;  4L1Q D;  3UVM A;  3IIW A;  1YFQ A;  4O9D A;  4FA4 D;  1JMX B;  2H9P A;  1OLZ A;  4O45 A;  4AOW A;  4FA1 D;  3UR4 A;  3FM0 A;  3UKU C;  3SN6 B;  2UZY B;  2AGX A;  3I7P A;  3IIY A;  5IGO A;  3PXW D;  2P9U C;  2H9N A;  3FGB A;  3MZL A;  4D0K A;  4LG9 A;  3C9C A;  5EAR A;  2QXV A;  4QRJ A;  4GGA A;  4A0A B;  4J77 A;  2CE8 A;  4J0X A;  4J79 A;  2AGW A;  4CI2 A;  4JSP C;  3J81 g;  5H1M A;  3I89 A;  4PBY A;  4J8B A;  2H6Q A;  4YVD A;  3SCY A;  3SHF A;  4FA5 D;  4J73 A;  1XKS A;  4CY5 A;  3DXK C;  5FKR A;  2GC7 A;  1XIP A;  3BG0 A;  3EI3 A;  3RRM C;  5EAL A;  4A2L A;  4GZ8 A;  5C2W B;  4FA9 D;  3RLM D;  3SFZ A;  3E0C A;  2P9L C;  4A7J A;  2Z2P A;  1MG3 A;  4Y7R A;  1GP2 B;  4CZX A;  3JRP A;  2P9I C;  3DM0 A;  3I7O A;  2MTA H;  1NEX B;  4U1E I;  4PNK B;  2YNO A;  3UVL A;  4FAN D;  2I0S A;  3MMY A;  3PXS D;  4X63 B;  2CN3 A;  3OL2 B;  3EI2 B;  1JMZ B;  3EI2 A;  1OMW B;  4H5I A;  1U4C A;  5TDH B;  4TZ4 A;  2IAA A;  2HKM A;  2IUQ A;  3K26 A;  3C5M A;  4CZV A;  3ODT A;  2HYE A;  3U4Y A;  2P9S C;  4J0W A;  2QC5 A;  5HE0 B;  5EMM B;  4J78 A;  5EM2 A;  5EM2 B;  2CO0 C;  3OTT A;  4A11 A;  3MKS B;  4L3G D;  4G56 B;  4CI3 A;  5AJA A;  3V7D B;  2PM9 B;  3EI4 B;  4BH6 A;  2YB8 B;  4CZY A;  2AH1 A;  3F3F A;  2XU7 A;  4A0B B;  3EU7 A;  4A0B A;  3JZG A;  2G9A A;  3F3G A;  3MZK A;  4CI1 A;  4JT5 C;  3AL8 A;  2YNN A;  1JOF A;  2H68 A;  1GOT B;  3PSC B;  2I3T A;  4KFM B;  3N0E A;  4JXM A;  3J80 g;  3SJL D;  2YBA A;  4ESG A;  2IWK A;  2OJY A;  4X61 B;  2BCJ B;  2OIZ A;  4CY1 A;  5GXI A;  4E5Z B;  1PI6 A;  4XYH A;  3RSE C;  3NVN A;  5HYN B;  3SWS D;  3JB9 L;  3UVK A;  5SXM A;  3B7F A;  3SMR A;  3NVX A;  4QT8 A;  4JD2 C;  4CY3 A;  2I0T A;  4ES0 A;  2H6N A;  5EAP A;  3EMH A;  3ORV D;  1SQ9 A;  5EML B;  1MG2 A;  3KRW B;  3OKW A;  4J8G A;  2AGL A;  1JJU B;  3C75 H;  2I0R A;  4R7A B;  3CIK B;  5AMS A;  2H9L A;  1TBG A;  2XL2 A;  4A08 B;  4AEZ A;  3N0D A;  4GGD A;  5CXC B;  3SBR A;  2IUV A;  4GGC A;  3SBQ A;  1QNI A;  4A0A A;  2H47 A;  2EBS A;  2OK6 A;  3V9F A;  2CN2 A;  3AH8 B;  5K19 A;  4OWR A;  5I5I A;  2HJB A;  5HE3 B;  5IGQ A;  5FKS A;  3IJ1 A;  3GFC A;  5CYK B;  5CYK A;  3VH0 A;  3RFG A;  2B5N A;  5EAM A;  2HKR A;  2AH0 A;  1VYH C;  3PE7 A;  5CXB B;  5CXB A;  4A2M A;  1GG2 B;  4ZOX A;  3FRX A;  2PM6 B;  4GQ2 P;  5JWZ A;  2O9K A;  3RMZ D;  3L4O D;  4I79 A;  1P22 A;  2H13 A;  4J82 A;  2P9N C;  3JPX A;  1MDA H;  4FWW A;  4GMB A;  2UZX B;  4L3H D;  4FHL A;  3OL2 A;  2AQ5 A;  5GXH A;  2CE9 A;  3ULE C;  1PGU A;  4GQ1 A;  4XYI A;  2HES X;  4JSN C;  4PXW A;  2CO0 A;  3RN1 D;  1K32 A;  3IJC A;  3PXT D; 
#chains in the Genus database with same CATH topology
 3OW8 A;  5HE1 B;  4PC0 A;  2VC2 A;  1A0R B;  1C9L A;  3JRO A;  4O3T B;  3EQ9 A;  2PM7 B;  2J57 G;  2PM9 A;  3GRE A;  1TYQ C;  3I7N A;  3I8C A;  3EI4 A;  3T3P A;  3UKR C;  1SQJ A;  3JZN A;  3JAM g;  1SHY B;  2Z2O A;  3IUQ A;  3QHY B;  4ZOV A;  1B9X A;  4HDJ A;  4WK2 A;  3EQ8 A;  3I2N A;  4G55 A;  4J81 A;  4LG8 A;  4O2W A;  4L1M A;  3DSM A;  4Z7O A;  3BG1 A;  5M5T A;  3IUM A;  1GOG A;  4PBZ A;  5H14 A;  5THA A;  5IT9 g;  4X60 B;  2P9P C;  4X3E A;  4AN0 A;  5A2Q g;  5HE2 B;  5FKT A;  5AFU 3;  3PSL A;  2YNP A;  4NC4 A;  2VDQ A;  4XEI C;  2QZP A;  1H2Z A;  2Z2N A;  4FB1 D;  5FFG A;  3I7K A;  4E5Z A;  4Z7N A;  1O6G A;  2B5M A;  4D6V A;  2OVP B;  5KDO B;  4ERQ A;  3VGZ A;  3CFV A;  4K3J B;  1NR0 A;  3K6S A;  3QI0 A;  2H6K A;  2IWF A;  3ZE1 A;  4Z8L A;  3CFS B;  1ERJ A;  4ZOZ A;  1BPO A;  3MKQ A;  1M1X A;  4QAM A;  1N6F A;  5C86 A;  1K3I A;  3K27 A;  4PSX B;  1I2M B;  2CNX A;  3I7H A;  5IJ7 E;  2B4E A;  4BUJ C;  5GSA A;  3O4I A;  4L9O A;  4A08 A;  3GD1 I;  4J84 A;  1JV2 A;  3AL9 A;  3L4M D;  3V4P A;  5CXC A;  4PSW B;  4CY2 A;  4QL1 A;  3IJE A;  4MK0 B;  3VI4 A;  3NIG A;  2Q7Q A;  2J55 H;  3IUN A;  2I3S A;  5FQD A;  2H14 A;  4GM8 A;  3RN0 D;  1FWX A;  2VDR A;  1Q47 A;  5H17 A;  4G1E A;  3JZH A;  4ERY A;  2HU5 A;  3I7L A;  4CC9 A;  4ERZ A;  4BP9 A;  4IA9 A;  2H9M A;  1K8K C;  3F3P A;  5FKQ A;  3IUL A;  3V5W B;  2PBI B;  1VZ3 A;  3C99 A;  4IMM A;  3BWS A;  5HDB A;  5EMK B;  5B4W A;  1B9Y A;  5M5U A;  5FXY A;  3IKO A;  3EWE A;  2GC4 A;  5M61 A;  4NAA A;  4JHN A;  3ZE2 A;  4GQB B;  2OVQ B;  3IJ0 A;  2XYI A;  2HJ4 A;  3PVU B;  3MXX A;  4WK4 A;  1VZ2 A;  3EI3 B;  1XHM A;  3NID A;  1O6F A;  2YMU A;  1U8C A;  2OK4 A;  3EG6 A;  4GM9 A;  2AGZ A;  3W15 A;  3PVW B;  3VA6 A;  3SXT D;  4J86 A;  4MMY A;  5I5M A;  2WQ8 A;  4NBM A;  2OVR B;  5IC7 A;  5K1C C;  2VDP A;  2BBK H;  3SLE D;  4ZOY A;  2H3X A;  4LGN A;  3ZDY A;  3DWL C;  4N14 A;  4FAV D;  4IRZ A;  4JHP C;  4RE5 A;  4UI9 R;  4NSX A;  3FCS A;  5I5J A;  1E5T A;  4JSV C;  3HFQ A;  3I8E A;  4CI8 A;  3MUO A;  3O4H A;  4O3U B;  4OZU A;  3KRX B;  5IJ8 E;  1PEV A;  5TEF A;  3ZDX A;  4A09 B;  4A09 A;  4BL0 A;  3UVO A;  2EIC A;  1C9I A;  1H2X A;  4G1M A;  5C2V B;  5E6R A;  4J87 A;  3AFC A;  5TF2 A;  2IUP A;  4JSX C;  4E54 B;  4E54 A;  4JT6 C;  2JKX A;  1R5M A;  1PBY B;  1L0Q A;  1N6D A;  3EI1 B;  3EI1 A;  4A11 B;  2HXC A;  3RFH A;  1U2V C;  3NIF A;  4DNU A;  1S4U X;  3OF7 A;  4O1Q D;  2GNQ A;  2IUR A;  2B5L A;  2W18 A;  3DXM C;  1GXR A;  3NVQ A;  4U7A A;  1UTC A;  4RE6 A;  2AGY A;  2TRC B;  3ZWL B;  5HQG A;  1RI6 A;  5TEE A;  3UVN A;  4QQE A;  4AX4 A;  2P9K C;  3AL8 B;  5E6U A;  2XE4 A;  4H5J A;  3P4F A;  2J56 H;  4Y5R D;  4ZN4 A;  5FLX g;  2XL3 A;  5FA5 B;  2G99 A;  4K3I D;  5C9Z B;  3OKT A;  3O4J A;  1VE6 A;  3SVW D;  5GMK n;  3OKY B;  3OKY A;  3SBP A;  1N6E A;  1UOQ A;  4BCB A;  1UOP A;  5EMJ B;  4GM3 A;  3V4V A;  4AN1 A;  3A0F A;  4EWR A;  4L1Q D;  3UVM A;  3IIW A;  1YFQ A;  4O9D A;  4FA4 D;  1JMX B;  2H9P A;  1OLZ A;  4O45 A;  4AOW A;  4FA1 D;  3UR4 A;  3FM0 A;  3UKU C;  3SN6 B;  2UZY B;  3FCU A;  2AGX A;  3I7P A;  3IIY A;  5IGO A;  4BCC A;  3PXW D;  2P9U C;  2H9N A;  3FGB A;  3MZL A;  4D0K A;  4LG9 A;  3C9C A;  5EAR A;  3GC3 B;  2QXV A;  4QRJ A;  4GGA A;  5M5S A;  4J77 A;  2CE8 A;  4A0A B;  4J0X A;  4J79 A;  2AGW A;  4CI2 A;  4JSP C;  3J81 g;  5H1M A;  3I89 A;  4PBY A;  2EIB A;  4J8B A;  2H6Q A;  4YVD A;  3SCY A;  3SHF A;  4FA5 D;  4J73 A;  1XKS A;  4CY5 A;  3DXK C;  5FKR A;  2GC7 A;  1E8N A;  1XIP A;  3BG0 A;  3EI3 A;  3IUJ A;  3RRM C;  5EAL A;  4A2L A;  4GZ8 A;  5C2W B;  4FA9 D;  3RLM D;  3SFZ A;  4WJK A;  3E0C A;  4DNV A;  2P9L C;  4A7J A;  2Z2P A;  1MG3 A;  4Y7R A;  2HU7 A;  1GP2 B;  4CZX A;  1JTD B;  3JRP A;  2P9I C;  3IVM A;  3DM0 A;  3I7O A;  3K72 A;  2MTA H;  1NEX B;  2VZ3 A;  3DDU A;  4U1E I;  1T2X A;  4PNK B;  4UM9 A;  3IUR A;  2YNO A;  3UVL A;  4FAN D;  2I0S A;  3MMY A;  3PXS D;  4X63 B;  2CN3 A;  1TYE A;  3OL2 B;  4MMZ A;  3EI2 B;  1JMZ B;  3EI2 A;  1OMW B;  4H5I A;  1U4C A;  4MMX A;  5TDH B;  2QR5 A;  4TZ4 A;  2IAA A;  4WK0 A;  2HKM A;  2IUQ A;  2XDW A;  3K26 A;  3C5M A;  4CZV A;  3ODT A;  2HYE A;  3U4Y A;  2P9S C;  4AMZ A;  4J0W A;  2QC5 A;  2VZ1 A;  5HE0 B;  4J78 A;  5EM2 A;  5EMM B;  3O4G A;  3VI3 A;  2CO0 C;  3OTT A;  4A11 A;  5EM2 B;  3MKS B;  4L3G D;  4G56 B;  4CI3 A;  5AJA A;  3V7D B;  2PM9 B;  3K71 A;  3EI4 B;  4BH6 A;  2YB8 B;  4CZY A;  2AH1 A;  3F3F A;  2XU7 A;  4A0B B;  3EU7 A;  4A0B A;  1H2Y A;  3JZG A;  2G9A A;  1H2W A;  3F3G A;  3MZK A;  1UOO A;  3MUN A;  4CI1 A;  4JT5 C;  3AL8 A;  2YNN A;  1JOF A;  2H68 A;  1GOT B;  2I3T A;  3PSC B;  4KFM B;  3N0E A;  4JXM A;  3J80 g;  4UM8 A;  3SJL D;  2VDK A;  2YBA A;  4ESG A;  2IWK A;  2OJY A;  4X61 B;  2BCJ B;  2OIZ A;  5FFO A;  4CY1 A;  4E5Z B;  5GXI A;  4NEN A;  1VE7 A;  1PI6 A;  4XYH A;  3RSE C;  2EIE A;  3NVN A;  5C92 A;  2BKL A;  3ZE0 A;  5HYN B;  3SWS D;  3JB9 L;  3UVK A;  3EQ7 A;  5SXM A;  3B7F A;  3SMR A;  3NVX A;  4QT8 A;  2EID A;  4JD2 C;  4CY3 A;  2I0T A;  4ES0 A;  2H6N A;  5EAP A;  3EMH A;  3ORV D;  4DNW A;  4Z7Q A;  1SQ9 A;  5EML B;  4D9S A;  1MG2 A;  3KRW B;  3OKW A;  1L5G A;  4J8G A;  2AGL A;  1JJU B;  3C75 H;  2I0R A;  4R7A B;  3CIK B;  5AMS A;  2H9L A;  1TBG A;  2XL2 A;  4A08 B;  2HU8 A;  4AEZ A;  3N0D A;  4GGD A;  5CXC B;  3SBR A;  2IUV A;  4GGC A;  3SBQ A;  1QNI A;  3ZDZ A;  1QFM A;  2XZG A;  4A0A A;  2H47 A;  2EBS A;  2OK6 A;  2VDM A;  3V9F A;  2CN2 A;  3AH8 B;  1GOH A;  5K19 A;  4OWR A;  5I5I A;  2HJB A;  2VDO A;  5HE3 B;  4BCD A;  5IGQ A;  5FKS A;  5E6S A;  3MVD K;  3IJ1 A;  3GFC A;  5CYK B;  1A12 A;  5CYK A;  3VH0 A;  3RFG A;  2B5N A;  5EAM A;  2HKR A;  2AH0 A;  1VYH C;  3PE7 A;  5CXB B;  5CXB A;  4A2M A;  1GG2 B;  4ZOX A;  3FRX A;  2PM6 B;  4GQ2 P;  5JWZ A;  2O9K A;  3RMZ D;  3L4O D;  4I79 A;  1P22 A;  2H13 A;  4J82 A;  4AMY A;  3T3M A;  2P9N C;  3JPX A;  1QFS A;  5M5R A;  1MDA H;  4FWW A;  5M5V A;  2VDN A;  2UZX B;  3KCI A;  4GMB A;  1E8M A;  4FHL A;  4L3H D;  3OL2 A;  2AQ5 A;  1YR2 A;  5GXH A;  2CE9 A;  3ULE C;  4BP8 A;  1GOF A;  1PGU A;  4GQ1 A;  4XYI A;  2HES X;  4JSN C;  4PXW A;  2CO0 A;  3RN1 D;  1K32 A;  3IJC A;  3PXT D;  4O02 A;  2VDL A; 
#chains in the Genus database with same CATH homology
 3OW8 A;  5HE1 B;  4PC0 A;  1A0R B;  3JRO A;  4O3T B;  2PM7 B;  2J57 G;  2PM9 A;  3GRE A;  1TYQ C;  3I7N A;  3I8C A;  3EI4 A;  3UKR C;  1SQJ A;  3JZN A;  3JAM g;  1SHY B;  2Z2O A;  4ZOV A;  1B9X A;  4HDJ A;  3I2N A;  4J81 A;  4LG8 A;  3DSM A;  3BG1 A;  5THA A;  4PBZ A;  5H14 A;  5IT9 g;  4X60 B;  2P9P C;  4X3E A;  5A2Q g;  5HE2 B;  5FKT A;  5AFU 3;  3PSL A;  2YNP A;  4XEI C;  4FB1 D;  2Z2N A;  3I7K A;  4E5Z A;  2B5M A;  4D6V A;  2OVP B;  5KDO B;  4ERQ A;  3VGZ A;  3CFV A;  4K3J B;  1NR0 A;  2H6K A;  2IWF A;  4Z8L A;  3CFS B;  1ERJ A;  4ZOZ A;  3MKQ A;  1N6F A;  3K27 A;  4PSX B;  2CNX A;  3I7H A;  5IJ7 E;  2B4E A;  4BUJ C;  5GSA A;  4L9O A;  4A08 A;  4J84 A;  3AL9 A;  3L4M D;  5CXC A;  4PSW B;  4CY2 A;  4QL1 A;  4MK0 B;  2Q7Q A;  2J55 H;  5FQD A;  2I3S A;  2H14 A;  4GM8 A;  3RN0 D;  1FWX A;  1Q47 A;  5H17 A;  3JZH A;  4ERY A;  3I7L A;  4CC9 A;  4ERZ A;  4IA9 A;  2H9M A;  1K8K C;  3F3P A;  5FKQ A;  3V5W B;  2PBI B;  3C99 A;  4IMM A;  3BWS A;  5EMK B;  5B4W A;  1B9Y A;  5FXY A;  3IKO A;  3EWE A;  2GC4 A;  4GQB B;  2OVQ B;  3IJ0 A;  2XYI A;  2HJ4 A;  3PVU B;  3MXX A;  3EI3 B;  1XHM A;  2YMU A;  3EG6 A;  2OK4 A;  4GM9 A;  2AGZ A;  3W15 A;  3PVW B;  3VA6 A;  3SXT D;  4J86 A;  5I5M A;  2OVR B;  5IC7 A;  5K1C C;  3SLE D;  2BBK H;  4ZOY A;  2H3X A;  4LGN A;  3DWL C;  4N14 A;  4FAV D;  4UI9 R;  4NSX A;  5I5J A;  4JSV C;  3HFQ A;  3I8E A;  4CI8 A;  5IJ8 E;  4O3U B;  4OZU A;  3KRX B;  1PEV A;  5TEF A;  4A09 B;  4A09 A;  4BL0 A;  3UVO A;  5C2V B;  4J87 A;  3AFC A;  5TF2 A;  2IUP A;  4JSX C;  4E54 B;  4E54 A;  4JT6 C;  1PBY B;  1L0Q A;  1R5M A;  1N6D A;  3EI1 B;  3EI1 A;  4A11 B;  2HXC A;  3RFH A;  1U2V C;  1S4U X;  4O1Q D;  2GNQ A;  2IUR A;  2B5L A;  2W18 A;  3DXM C;  1GXR A;  3NVQ A;  4U7A A;  2AGY A;  2TRC B;  3ZWL B;  5HQG A;  1RI6 A;  5TEE A;  3UVN A;  4QQE A;  2P9K C;  3AL8 B;  4H5J A;  3P4F A;  2J56 H;  4Y5R D;  4ZN4 A;  5FLX g;  2XL3 A;  5FA5 B;  2G99 A;  4K3I D;  5C9Z B;  3OKT A;  3SVW D;  5GMK n;  3OKY B;  3OKY A;  3SBP A;  1N6E A;  5EMJ B;  4GM3 A;  4EWR A;  3A0F A;  4L1Q D;  3UVM A;  3IIW A;  1YFQ A;  4O9D A;  4FA4 D;  1JMX B;  2H9P A;  1OLZ A;  4O45 A;  4AOW A;  4FA1 D;  3UR4 A;  3FM0 A;  3UKU C;  3SN6 B;  2UZY B;  2AGX A;  3I7P A;  3IIY A;  5IGO A;  3PXW D;  2P9U C;  2H9N A;  3FGB A;  3MZL A;  4D0K A;  4LG9 A;  3C9C A;  5EAR A;  2QXV A;  4QRJ A;  4GGA A;  4A0A B;  4J77 A;  2CE8 A;  4J0X A;  4J79 A;  2AGW A;  4CI2 A;  4JSP C;  3J81 g;  5H1M A;  3I89 A;  4PBY A;  4J8B A;  2H6Q A;  4YVD A;  3SCY A;  3SHF A;  4FA5 D;  4J73 A;  1XKS A;  4CY5 A;  3DXK C;  5FKR A;  2GC7 A;  1XIP A;  3BG0 A;  3EI3 A;  3RRM C;  5EAL A;  4A2L A;  4GZ8 A;  5C2W B;  4FA9 D;  3RLM D;  3SFZ A;  3E0C A;  2P9L C;  4A7J A;  2Z2P A;  1MG3 A;  4Y7R A;  1GP2 B;  4CZX A;  3JRP A;  2P9I C;  3DM0 A;  3I7O A;  2MTA H;  1NEX B;  4U1E I;  4PNK B;  2YNO A;  3UVL A;  4FAN D;  2I0S A;  3MMY A;  3PXS D;  4X63 B;  2CN3 A;  3OL2 B;  3EI2 B;  1JMZ B;  3EI2 A;  1OMW B;  4H5I A;  1U4C A;  5TDH B;  4TZ4 A;  2IAA A;  2HKM A;  2IUQ A;  3K26 A;  3C5M A;  4CZV A;  3ODT A;  2HYE A;  3U4Y A;  2P9S C;  4J0W A;  2QC5 A;  5HE0 B;  5EMM B;  4J78 A;  5EM2 A;  5EM2 B;  2CO0 C;  3OTT A;  4A11 A;  3MKS B;  4L3G D;  4G56 B;  4CI3 A;  5AJA A;  3V7D B;  2PM9 B;  3EI4 B;  4BH6 A;  2YB8 B;  4CZY A;  2AH1 A;  3F3F A;  2XU7 A;  4A0B B;  3EU7 A;  4A0B A;  3JZG A;  2G9A A;  3F3G A;  3MZK A;  4CI1 A;  4JT5 C;  3AL8 A;  2YNN A;  1JOF A;  2H68 A;  1GOT B;  3PSC B;  2I3T A;  4KFM B;  3N0E A;  4JXM A;  3J80 g;  3SJL D;  2YBA A;  4ESG A;  2IWK A;  2OJY A;  4X61 B;  2BCJ B;  2OIZ A;  4CY1 A;  5GXI A;  4E5Z B;  1PI6 A;  4XYH A;  3RSE C;  3NVN A;  5HYN B;  3SWS D;  3JB9 L;  3UVK A;  5SXM A;  3B7F A;  3SMR A;  3NVX A;  4QT8 A;  4JD2 C;  4CY3 A;  2I0T A;  4ES0 A;  2H6N A;  5EAP A;  3EMH A;  3ORV D;  1SQ9 A;  5EML B;  1MG2 A;  3KRW B;  3OKW A;  4J8G A;  2AGL A;  1JJU B;  3C75 H;  2I0R A;  4R7A B;  3CIK B;  5AMS A;  2H9L A;  1TBG A;  2XL2 A;  4A08 B;  4AEZ A;  3N0D A;  4GGD A;  5CXC B;  3SBR A;  2IUV A;  4GGC A;  3SBQ A;  1QNI A;  4A0A A;  2H47 A;  2EBS A;  2OK6 A;  3V9F A;  2CN2 A;  3AH8 B;  5K19 A;  4OWR A;  5I5I A;  2HJB A;  5HE3 B;  5IGQ A;  5FKS A;  3IJ1 A;  3GFC A;  5CYK B;  5CYK A;  3VH0 A;  3RFG A;  2B5N A;  5EAM A;  2HKR A;  2AH0 A;  1VYH C;  3PE7 A;  5CXB B;  5CXB A;  4A2M A;  1GG2 B;  4ZOX A;  3FRX A;  2PM6 B;  4GQ2 P;  5JWZ A;  2O9K A;  3RMZ D;  3L4O D;  4I79 A;  1P22 A;  2H13 A;  4J82 A;  2P9N C;  3JPX A;  1MDA H;  4FWW A;  4GMB A;  2UZX B;  4L3H D;  4FHL A;  3OL2 A;  2AQ5 A;  5GXH A;  2CE9 A;  3ULE C;  1PGU A;  4GQ1 A;  4XYI A;  2HES X;  4JSN C;  4PXW A;  2CO0 A;  3RN1 D;  1K32 A;  3IJC A;  3PXT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...