4ZN4A

Crystal structure of sqt1 from chaetomium thermophilum solved by mr
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
483
structure length
409
Chain Sequence
ALENDSIAYFDGHKDSVFAIAQHPLYPNIVATGGSEGDADDAPGKGYVLDISATSLNPIFEIDGHTDSINALTFTLPRGDFLVSGGMDGRMRVYAVSVPQNGALAQFKFLAESQETEEINWFAPCPSPDHPNTIALGASDGSVWVFTLDNPVQIVQSYFLHTGPCTAGAWSPDGLLLATVSEDESLHVYDVFGVAASKSLVTDNGQTVVSLTNVDQRFAVEGGLFSVAVSPTGAVVAVGGAGGQIKIVGLPRLSQAGTILASLQIQSDNIESLAFSPSAPILAAGSTDGSIAVFDTSRSFALRRHLRGAHAEDPVVKVEFVKSPPNAAMAGWLLTSCGMDGVVRRWDLRGGTAGPGTLPHMAPSGLVKEWKGHRSGQEGGGVLGFVQGETGERIVTVGDDAVVLVFEAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-translational capturing of nascent ribosomal proteins by their dedicated chaperones.
pubmed doi rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
molecule tags Chaperone
molecule keywords sqt1
total genus 105
structure length 409
sequence length 483
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4zn4A00
4CZVA 1U2VC 4A0BB 1ERJA 4O1QD 3C9CA 4UI9R 5IGOA 2AGZA 1NEXB 2CE8A 4GZ8A 4JSVC 5B4WA 4CY1A 5FKSA 3PXSD 3IIYA 3ODTA 3IJ0A 4J0XA 3V5WB 3MKQA 3RMZD 2J55H 5EMKB 1PBYB 3RSEC 4EWRA 4BL0A 3SMRA 4A0AB 5KDOB 2H9NA 3UKUC 2PBIB 1PEVA 1U4CA 3U4YA 1XHMA 5CYKA 4JSNC 3I89A 1MG2A 2HYEA 4N14A 3V9FA 5AFU3 4PSWB 3JZNA 4ERQA 2W18A 3JRPA 5EALA 5HQGA 2I0RA 5FXYA 2IUVA 4Z8LA 4JXMA 4FWWA 4PC0A 5GXHA 2J57G 4J84A 3OKYA 3EI1A 2IUQA 1OLZA 2GNQA 4GM3A 3PXTD 4FA4D 4NSXA 3P4FA 3BG1A 4CI1A 1R5MA 2IAAA 5HE1B 5HE2B 2P9IC 1QNIA 4GMBA 4PXWA 2B4EA 2MTAH 4A09A 2YNPA 3C75H 4LG8A 3C99A 1XIPA 3V7DB 3E0CA 1GXRA 4XYHA 3PSLA 5I5MA 5EMJB 5IJ8E 3BG0A 3JZGA 3VH0A 5CYKB 4CC9A 1L0QA 2QC5A 2AGWA 3N0EA 4Y7RA 5HYNB 2G9AA 4MK0B 4CZYA 3OTTA 3DXMC 4YVDA 5GMKn 5AJAA 3OL2B 3AFCA 2HJ4A 3K27A 4QL1A 4QT8A 2AH0A 2CNXA 4J0WA 3NVNA 2GC7A 3RFGA 2H3XA 3CFVA 3RN1D 3K26A 4O9DA 3RN0D 1S4UX 3EI1B 3HFQA 3IIWA 2AGLA 4LGNA 5H14A 2O9KA 2P9LC 2YB8B 5TF2A 2P9KC 4G56B 2H14A 3IKOA 3UKRC 3PVWB 3RRMC 1RI6A 4A11B 3FGBA 3JPXA 3GREA 3DXKC 3MZKA 4A09B 3A0FA 4R7AB 3L4MD 4A2MA 5CXCA 4TZ4A 5IC7A 4Y5RD 5IGQA 5IT9g 4X3EA 1TBGA 3SLED 4D6VA 4X60B 2BBKH 4J79A 4ZOZA 4L1QD 5TEEA 3SXTD 3IJCA 2I0TA 1XKSA 5EAMA 2CE9A 3ZWLB 2OK6A 4J8GA 3I7NA 2H6NA 3OW8A 1NR0A 2TRCB 4J82A 2YBAA 3EI3A 1JJUB 5EAPA 2Z2NA 2IUPA 4CI3A 2CO0A 1SQJA 1SQ9A 5C2WB 4FHLA 1FWXA 4E54A 2B5LA 1GOTB 3CIKB 2OVQB 3DM0A 3EG6A 4GM8A 1B9YA 3UVNA 2HKRA 3UVLA 3ULEC 5EM2B 3EWEA 1MDAH 3N0DA 4JT5C 4LG9A 2Z2PA 4GGDA 3JROA 5EMMB 3F3GA 3SJLD 3SWSD 3F3PA 3EI3B 3I8CA 5GXIA 1JMZB 2UZXB 5FKRA 2G99A 2IWKA 2OK4A 4K3ID 2YNNA 2XU7A 4GQ2P 2B5NA 4X63B 3EI4A 1K8KC 4OWRA 1Q47A 2UZYB 4L3GD 2P9UC 1OMWB 4O3UB 2YNOA 2AH1A 5C9ZB 5HE0B 4IMMA 4XEIC 3RLMD 4AEZA 1A0RB 3NVXA 3I7PA 4X61B 3MKSB 2QXVA 5FA5B 2AGXA 3EI4B 3AH8B 4IA9A 3AL8B 2I3TA 2XYIA 4J8BA 3CFSB 3I7LA 3UR4A 5I5JA 5IJ7E 2PM6B 5FKTA 5H17A 2HJBA 3SBQA 4L3HD 4CY2A 3I8EA 4O3TB 2HKMA 3EI2A 5HE3B 4GQBB 4O45A 3PE7A 4E5ZB 4CI8A 2CN3A 4U1EI 4GGAA 5EM2A 3JB9L 4BH6A 5TEFA 5CXCB 2AGYA 3MZLA 3I7HA 3SVWD 1N6DA 4KFMB 5GSAA 5AMSA 4CY5A 2OVPB 4PBYA 2PM9B 4JD2C 4PSXB 4E5ZA 3VGZA 4OZUA 4XYIA 3L4OD 2H6KA 4H5IA 3VA6A 1N6FA 4QRJA 2H47A 4K3JB 2EBSA 3SCYA 2I0SA 4PNKB 3J81g 5THAA 3AL9A 2XL3A 5K19A 2J56H 3MMYA 4GGCA 5FQDA 3SN6B 4FAND 5FKQA 4BUJC 2H6QA 3F3FA 5EMLB 2OIZA 4FA9D 3UVKA 3OKTA 3DSMA 1JMXB 3JAMg 3FRXA 3EMHA 5FLXg 3IJ1A 4A2LA 4A08A 5K1CC 3PSCB 4FA1D 3W15A 1MG3A 5TDHB 1PGUA 1YFQA 4FB1D 2IWFA 2P9NC 3J80g 2I3SA 2HESX 2HXCA 1B9XA 3I7KA 2YMUA 3BWSA 4A08B 3SBRA 4CZXA 1PI6A 4AOWA 5JWZA 3I7OA 5SXMA 3OKYB 1VYHC 4J81A 3OKWA 3SFZA 4ESGA 4FA5D 2BCJB 4J78A 4GQ1A 4ERYA 4A11A 2OVRB 3KRWB 4GM9A 4A0BA 3EI2B 2Q7QA 5CXBA 4J77A 2IURA 3KRXB 4L9OA 5H1MA 4FAVD 2GC4A 3NVQA 1TYQC 3PVUB 1N6EA 3UVOA 3I2NA 1JOFA 5EARA 3OL2A 3B7FA 3SBPA 4ES0A 2PM9A 5A2Qg 2XL2A 2B5MA 4I79A 4CI2A 4U7AA 2CN2A 4PBZA 4JSPC 3MXXA 4D0KA 4CY3A 2H9LA 3C5MA 4J86A 4E54B 5C2VB 3GFCA 3UVMA 1GP2B 2H13A 2Z2OA 2AQ5A 3JZHA 3ORVD 3DWLC 3EU7A 4J73A 4JT6C 4ZOXA 4A0AA 4QQEA 3RFHA 4A7JA 4ZN4A 1GG2B 1P22A 2H9PA 2P9SC 4J87A 2CO0C 4ZOVA 1K32A 2OJYA 3AL8A 2H68A 4HDJA 4H5JA 1SHYB 2P9PC 4ERZA 2H9MA 2PM7B 3SHFA 3PXWD 3FM0A 5CXBB 4JSXC 5I5IA 4ZOYA
chains in the Genus database with same CATH superfamily
4CZVA 1U2VC 5FFOA 4A0BB 1ERJA 2VDNA 5HDBA 4O1QD 3C9CA 1BPOA 4UI9R 5IGOA 2XZGA 2AGZA 1NEXB 2CE8A 4GZ8A 4JSVC 4MMZA 5B4WA 4CY1A 4AN1A 5FKSA 3PXSD 3IIYA 3V4PA 3ODTA 5E6UA 3IJ0A 4J0XA 3V5WB 3MKQA 4BP8A 2HU5A 3RMZD 2J55H 5EMKB 1O6GA 1PBYB 3RSEC 3EQ8A 4EWRA 4BL0A 3NIDA 3SMRA 5M5SA 4A0AB 5KDOB 4RE5A 2H9NA 3UKUC 5M5UA 2PBIB 1PEVA 1U4CA 3U4YA 1XHMA 5CYKA 4JSNC 1E5TA 3I89A 4MMYA 1QFSA 1MG2A 3ZDYA 4D9SA 2HYEA 4N14A 3V9FA 5AFU3 4PSWB 3JZNA 4ERQA 4JHNA 2W18A 3JRPA 5EALA 5HQGA 1UOQA 2I0RA 5FXYA 1VE6A 2IUVA 4Z8LA 4JXMA 3QI0A 4FWWA 4PC0A 5GXHA 3IUNA 2VDKA 2J57G 4J84A 3OKYA 3EI1A 2IUQA 3EQ7A 1OLZA 2GNQA 4GM3A 2HU8A 3PXTD 1T2XA 4FA4D 4NSXA 2VDRA 3P4FA 3BG1A 4CI1A 3MVDK 1R5MA 5C92A 2IAAA 5HE1B 5HE2B 2P9IC 1O6FA 1QNIA 4GMBA 4PXWA 5E6SA 2B4EA 2MTAH 4A09A 2YNPA 3C75H 4LG8A 3C99A 1XIPA 2EICA 3V7DB 3E0CA 1GXRA 4RE6A 4XYHA 4NC4A 3PSLA 5I5MA 5EMJB 5IJ8E 1H2YA 3BG0A 1GOFA 3JZGA 3VH0A 5CYKB 3O4IA 4CC9A 1L0QA 2QC5A 2AGWA 3N0EA 4Y7RA 5HYNB 2G9AA 3KCIA 4MK0B 4CZYA 3OTTA 2QR5A 3DXMC 4YVDA 5GMKn 5AJAA 1U8CA 2VDPA 3OL2B 3AFCA 2HJ4A 3K27A 4QL1A 2AH0A 4QT8A 2CNXA 3NVNA 2GC7A 4J0WA 3RFGA 2H3XA 3CFVA 3RN1D 3K26A 4O9DA 3RN0D 1S4UX 1JTDB 3NIGA 3HFQA 4G1MA 3EI1B 3IIWA 2AGLA 4WK4A 4LGNA 5H14A 2O9KA 2P9LC 1QFMA 2YB8B 5TF2A 4Z7QA 2P9KC 4G56B 2H14A 3IKOA 3UKRC 3PVWB 3RRMC 1RI6A 4A11B 3FGBA 3JPXA 3GREA 3K71A 3DXKC 3MZKA 4A09B 3A0FA 4R7AB 3L4MD 4A2MA 5CXCA 4TZ4A 5IC7A 4Y5RD 5IGQA 5IT9g 4X3EA 1TBGA 3SLED 4D6VA 2BBKH 4J79A 4X60B 4ZOZA 4L1QD 1UTCA 5TEEA 3SXTD 3IJCA 1L5GA 2I0TA 1XKSA 5EAMA 2CE9A 3ZWLB 2OK6A 4J8GA 3I7NA 2H6NA 3OW8A 1NR0A 2TRCB 4J82A 2YBAA 3EI3A 1JJUB 5EAPA 4AMYA 2Z2NA 2IUPA 4CI3A 2CO0A 1SQJA 1SQ9A 5C2WB 4FHLA 4UM9A 1FWXA 4E54A 4DNUA 2B5LA 1GOTB 2VDMA 3CIKB 2XE4A 2OVQB 1UOPA 3DM0A 3EG6A 4GM8A 1B9YA 3UVNA 2HKRA 3UVLA 2VZ1A 3ULEC 5EM2B 3O4JA 3EWEA 1MDAH 3N0DA 1H2XA 4JT5C 4LG9A 2Z2PA 4GGDA 3JROA 4BCCA 5EMMB 3F3GA 3SJLD 3SWSD 1I2MB 3F3PA 3EI3B 4O2WA 3I8CA 5GXIA 1JMZB 2UZXB 1H2ZA 5FKRA 2G99A 3K6SA 2IWKA 1C9LA 1H2WA 2OK4A 4K3ID 2YNNA 2XU7A 4GQ2P 2B5NA 1TYEA 2VDQA 4X63B 3EI4A 1K8KC 3IUMA 4OWRA 1Q47A 2UZYB 4L3GD 2P9UC 2BKLA 1OMWB 5M5RA 4O3UB 2YNOA 2AH1A 3GD1I 4IRZA 5C9ZB 5HE0B 4IMMA 4XEIC 3RLMD 4AEZA 1A0RB 3NVXA 3I7PA 4X61B 3MKSB 4DNVA 2HU7A 2QXVA 5FA5B 1VE7A 2EIDA 3FCUA 2AGXA 3EI4B 3AH8B 4IA9A 3AL8B 1E8MA 2I3TA 2JKXA 2XYIA 4UM8A 4J8BA 3CFSB 3I7LA 3UR4A 5I5JA 5IJ7E 2PM6B 5FKTA 5H17A 2HJBA 4BCDA 3VI4A 1GOGA 3SBQA 4JHPC 3K72A 4L3HD 4QAMA 4CY2A 5M5VA 3I8EA 4O3TB 2HKMA 3EI2A 5HE3B 4GQBB 4O45A 3PE7A 4E5ZB 4CI8A 2CN3A 3ZE1A 4U1EI 4GGAA 4DNWA 5EM2A 3JB9L 1E8NA 5TEFA 5CXCB 4BH6A 2AGYA 3MZLA 3T3MA 3I7HA 1YR2A 3O4HA 3SVWD 1N6DA 2WQ8A 2VZ3A 4G55A 3VI3A 4KFMB 4NAAA 5GSAA 5AMSA 4CY5A 2OVPB 4PBYA 2PM9B 4JD2C 3IVMA 4PSXB 4E5ZA 3IULA 3VGZA 4OZUA 4XYIA 4WK2A 3L4OD 2H6KA 4L1MA 4H5IA 1VZ3A 1N6FA 3VA6A 4QRJA 2H47A 4K3JB 3V4VA 2EBSA 3SCYA 2I0SA 4PNKB 3J81g 5THAA 4AMZA 3AL9A 2XL3A 5K19A 4NBMA 2VDOA 2J56H 3MMYA 4GGCA 5FQDA 3SN6B 4FAND 5FKQA 4BUJC 5M5TA 2H6QA 3F3FA 5EMLB 2OIZA 4FA9D 3UVKA 3OKTA 2VC2A 3MUNA 1M1XA 3DSMA 1JMXB 3JAMg 3FRXA 3EMHA 5FLXg 3IJ1A 4A2LA 4A08A 5K1CC 3PSCB 4FA1D 3W15A 1MG3A 5TDHB 1A12A 1PGUA 1YFQA 4FB1D 4WJKA 2IWFA 2P9NC 2VDLA 3FCSA 3J80g 2I3SA 2HESX 3GC3B 2HXCA 1B9XA 5FFGA 3I7KA 2YMUA 3BWSA 3IJEA 4Z7NA 4A08B 5M61A 3SBRA 4CZXA 4MMXA 1PI6A 4AOWA 5JWZA 3I7OA 3IURA 5SXMA 3OKYB 1VYHC 4J81A 4G1EA 5E6RA 3OKWA 3SFZA 4ESGA 4FA5D 2BCJB 3IUQA 4J78A 4GQ1A 4ERYA 4A11A 2OVRB 4NENA 3KRWB 4GM9A 4A0BA 3EI2B 2Q7QA 4J77A 5CXBA 2IURA 3KRXB 4L9OA 5H1MA 4FAVD 2GC4A 3NVQA 1TYQC 3PVUB 4AN0A 1N6EA 3UVOA 3I2NA 1JOFA 1VZ2A 5EARA 3OL2A 3B7FA 3SBPA 4ES0A 2PM9A 2EIEA 4AX4A 2XL2A 5A2Qg 3IUJA 3T3PA 3MUOA 2B5MA 4WK0A 4I79A 1K3IA 3OF7A 4U7AA 2XDWA 4CI2A 2CN2A 4PBZA 4JSPC 3MXXA 4D0KA 4CY3A 4BP9A 2H9LA 3C5MA 4J86A 3O4GA 4E54B 5C2VB 3ZDXA 3GFCA 3UVMA 1GP2B 2H13A 2Z2OA 2AQ5A 3ORVD 3JZHA 3DWLC 3EQ9A 2EIBA 3EU7A 3ZE0A 4J73A 5C86A 1GOHA 4JT6C 4ZOXA 4A0AA 4QQEA 3RFHA 4A7JA 4ZN4A 1GG2B 1P22A 2H9PA 2P9SC 3DDUA 2CO0C 4J87A 4ZOVA 1UOOA 3QHYB 1K32A 2OJYA 3AL8A 1JV2A 2H68A 4HDJA 4H5JA 3NIFA 1SHYB 2P9PC 4O02A 4ERZA 2H9MA 2PM7B 3SHFA 3PXWD 3ZDZA 4Z7OA 3FM0A 4BCBA 3ZE2A 5CXBB 4JSXC 5I5IA 1C9IA 2QZPA 4ZOYA
chains in the Genus database with same CATH topology
4CZVA 1U2VC 4A0BB 1ERJA 4O1QD 3C9CA 4UI9R 5IGOA 2AGZA 1NEXB 2CE8A 4GZ8A 4JSVC 5B4WA 4CY1A 5FKSA 3PXSD 3IIYA 3ODTA 3IJ0A 4J0XA 3V5WB 3MKQA 3RMZD 2J55H 5EMKB 1PBYB 3RSEC 4EWRA 4BL0A 3SMRA 4A0AB 5KDOB 2H9NA 3UKUC 2PBIB 1PEVA 1U4CA 3U4YA 1XHMA 5CYKA 4JSNC 3I89A 1MG2A 2HYEA 4N14A 3V9FA 5AFU3 4PSWB 3JZNA 4ERQA 2W18A 3JRPA 5EALA 5HQGA 2I0RA 5FXYA 2IUVA 4Z8LA 4JXMA 4FWWA 4PC0A 5GXHA 2J57G 4J84A 3OKYA 3EI1A 2IUQA 1OLZA 2GNQA 4GM3A 3PXTD 4FA4D 4NSXA 3P4FA 3BG1A 4CI1A 1R5MA 2IAAA 5HE1B 5HE2B 2P9IC 1QNIA 4GMBA 4PXWA 2B4EA 2MTAH 4A09A 2YNPA 3C75H 4LG8A 3C99A 1XIPA 3V7DB 3E0CA 1GXRA 4XYHA 3PSLA 5I5MA 5EMJB 5IJ8E 3BG0A 3JZGA 3VH0A 5CYKB 4CC9A 1L0QA 2QC5A 2AGWA 3N0EA 4Y7RA 5HYNB 2G9AA 4MK0B 4CZYA 3OTTA 3DXMC 4YVDA 5GMKn 5AJAA 3OL2B 3AFCA 2HJ4A 3K27A 4QL1A 4QT8A 2AH0A 2CNXA 4J0WA 3NVNA 2GC7A 3RFGA 2H3XA 3CFVA 3RN1D 3K26A 4O9DA 3RN0D 1S4UX 3EI1B 3HFQA 3IIWA 2AGLA 4LGNA 5H14A 2O9KA 2P9LC 2YB8B 5TF2A 2P9KC 4G56B 2H14A 3IKOA 3UKRC 3PVWB 3RRMC 1RI6A 4A11B 3FGBA 3JPXA 3GREA 3DXKC 3MZKA 4A09B 3A0FA 4R7AB 3L4MD 4A2MA 5CXCA 4TZ4A 5IC7A 4Y5RD 5IGQA 5IT9g 4X3EA 1TBGA 3SLED 4D6VA 4X60B 2BBKH 4J79A 4ZOZA 4L1QD 5TEEA 3SXTD 3IJCA 2I0TA 1XKSA 5EAMA 2CE9A 3ZWLB 2OK6A 4J8GA 3I7NA 2H6NA 3OW8A 1NR0A 2TRCB 4J82A 2YBAA 3EI3A 1JJUB 5EAPA 2Z2NA 2IUPA 4CI3A 2CO0A 1SQJA 1SQ9A 5C2WB 4FHLA 1FWXA 4E54A 2B5LA 1GOTB 3CIKB 2OVQB 3DM0A 3EG6A 4GM8A 1B9YA 3UVNA 2HKRA 3UVLA 3ULEC 5EM2B 3EWEA 1MDAH 3N0DA 4JT5C 4LG9A 2Z2PA 4GGDA 3JROA 5EMMB 3F3GA 3SJLD 3SWSD 3F3PA 3EI3B 3I8CA 5GXIA 1JMZB 2UZXB 5FKRA 2G99A 2IWKA 2OK4A 4K3ID 2YNNA 2XU7A 4GQ2P 2B5NA 4X63B 3EI4A 1K8KC 4OWRA 1Q47A 2UZYB 4L3GD 2P9UC 1OMWB 4O3UB 2YNOA 2AH1A 5C9ZB 5HE0B 4IMMA 4XEIC 3RLMD 4AEZA 1A0RB 3NVXA 3I7PA 4X61B 3MKSB 2QXVA 5FA5B 2AGXA 3EI4B 3AH8B 4IA9A 3AL8B 2I3TA 2XYIA 4J8BA 3CFSB 3I7LA 3UR4A 5I5JA 5IJ7E 2PM6B 5FKTA 5H17A 2HJBA 3SBQA 4L3HD 4CY2A 3I8EA 4O3TB 2HKMA 3EI2A 5HE3B 4GQBB 4O45A 3PE7A 4E5ZB 4CI8A 2CN3A 4U1EI 4GGAA 5EM2A 3JB9L 4BH6A 5TEFA 5CXCB 2AGYA 3MZLA 3I7HA 3SVWD 1N6DA 4KFMB 5GSAA 5AMSA 4CY5A 2OVPB 4PBYA 2PM9B 4JD2C 4PSXB 4E5ZA 3VGZA 4OZUA 4XYIA 3L4OD 2H6KA 4H5IA 3VA6A 1N6FA 4QRJA 2H47A 4K3JB 2EBSA 3SCYA 2I0SA 4PNKB 3J81g 5THAA 3AL9A 2XL3A 5K19A 2J56H 3MMYA 4GGCA 5FQDA 3SN6B 4FAND 5FKQA 4BUJC 2H6QA 3F3FA 5EMLB 2OIZA 4FA9D 3UVKA 3OKTA 3DSMA 1JMXB 3JAMg 3FRXA 3EMHA 5FLXg 3IJ1A 4A2LA 4A08A 5K1CC 3PSCB 4FA1D 3W15A 1MG3A 5TDHB 1PGUA 1YFQA 4FB1D 2IWFA 2P9NC 3J80g 2I3SA 2HESX 2HXCA 1B9XA 3I7KA 2YMUA 3BWSA 4A08B 3SBRA 4CZXA 1PI6A 4AOWA 5JWZA 3I7OA 5SXMA 3OKYB 1VYHC 4J81A 3OKWA 3SFZA 4ESGA 4FA5D 2BCJB 4J78A 4GQ1A 4ERYA 4A11A 2OVRB 3KRWB 4GM9A 4A0BA 3EI2B 2Q7QA 5CXBA 4J77A 2IURA 3KRXB 4L9OA 5H1MA 4FAVD 2GC4A 3NVQA 1TYQC 3PVUB 1N6EA 3UVOA 3I2NA 1JOFA 5EARA 3OL2A 3B7FA 3SBPA 4ES0A 2PM9A 5A2Qg 2XL2A 2B5MA 4I79A 4CI2A 4U7AA 2CN2A 4PBZA 4JSPC 3MXXA 4D0KA 4CY3A 2H9LA 3C5MA 4J86A 4E54B 5C2VB 3GFCA 3UVMA 1GP2B 2H13A 2Z2OA 2AQ5A 3JZHA 3ORVD 3DWLC 3EU7A 4J73A 4JT6C 4ZOXA 4A0AA 4QQEA 3RFHA 4A7JA 4ZN4A 1GG2B 1P22A 2H9PA 2P9SC 4J87A 2CO0C 4ZOVA 1K32A 2OJYA 3AL8A 2H68A 4HDJA 4H5JA 1SHYB 2P9PC 4ERZA 2H9MA 2PM7B 3SHFA 3PXWD 3FM0A 5CXBB 4JSXC 5I5IA 4ZOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZV A;  1U2V C;  4A0B B;  1ERJ A;  4O1Q D;  3C9C A;  4UI9 R;  5IGO A;  2AGZ A;  1NEX B;  2CE8 A;  4GZ8 A;  4JSV C;  5B4W A;  4CY1 A;  5FKS A;  3PXS D;  3IIY A;  3ODT A;  3IJ0 A;  4J0X A;  3V5W B;  3MKQ A;  3RMZ D;  2J55 H;  5EMK B;  1PBY B;  3RSE C;  4EWR A;  4BL0 A;  3SMR A;  4A0A B;  5KDO B;  2H9N A;  3UKU C;  2PBI B;  1PEV A;  1U4C A;  3U4Y A;  1XHM A;  5CYK A;  4JSN C;  3I89 A;  1MG2 A;  2HYE A;  4N14 A;  3V9F A;  5AFU 3;  4PSW B;  3JZN A;  4ERQ A;  2W18 A;  3JRP A;  5EAL A;  5HQG A;  2I0R A;  5FXY A;  2IUV A;  4Z8L A;  4JXM A;  4FWW A;  4PC0 A;  5GXH A;  2J57 G;  4J84 A;  3OKY A;  3EI1 A;  2IUQ A;  1OLZ A;  2GNQ A;  4GM3 A;  3PXT D;  4FA4 D;  4NSX A;  3P4F A;  3BG1 A;  4CI1 A;  1R5M A;  2IAA A;  5HE1 B;  5HE2 B;  2P9I C;  1QNI A;  4GMB A;  4PXW A;  2B4E A;  2MTA H;  4A09 A;  2YNP A;  3C75 H;  4LG8 A;  3C99 A;  1XIP A;  3V7D B;  3E0C A;  1GXR A;  4XYH A;  3PSL A;  5I5M A;  5EMJ B;  5IJ8 E;  3BG0 A;  3JZG A;  3VH0 A;  5CYK B;  4CC9 A;  1L0Q A;  2QC5 A;  2AGW A;  3N0E A;  4Y7R A;  5HYN B;  2G9A A;  4MK0 B;  4CZY A;  3OTT A;  3DXM C;  4YVD A;  5GMK n;  5AJA A;  3OL2 B;  3AFC A;  2HJ4 A;  3K27 A;  4QL1 A;  4QT8 A;  2AH0 A;  2CNX A;  4J0W A;  3NVN A;  2GC7 A;  3RFG A;  2H3X A;  3CFV A;  3RN1 D;  3K26 A;  4O9D A;  3RN0 D;  1S4U X;  3EI1 B;  3HFQ A;  3IIW A;  2AGL A;  4LGN A;  5H14 A;  2O9K A;  2P9L C;  2YB8 B;  5TF2 A;  2P9K C;  4G56 B;  2H14 A;  3IKO A;  3UKR C;  3PVW B;  3RRM C;  1RI6 A;  4A11 B;  3FGB A;  3JPX A;  3GRE A;  3DXK C;  3MZK A;  4A09 B;  3A0F A;  4R7A B;  3L4M D;  4A2M A;  5CXC A;  4TZ4 A;  5IC7 A;  4Y5R D;  5IGQ A;  5IT9 g;  4X3E A;  1TBG A;  3SLE D;  4D6V A;  4X60 B;  2BBK H;  4J79 A;  4ZOZ A;  4L1Q D;  5TEE A;  3SXT D;  3IJC A;  2I0T A;  1XKS A;  5EAM A;  2CE9 A;  3ZWL B;  2OK6 A;  4J8G A;  3I7N A;  2H6N A;  3OW8 A;  1NR0 A;  2TRC B;  4J82 A;  2YBA A;  3EI3 A;  1JJU B;  5EAP A;  2Z2N A;  2IUP A;  4CI3 A;  2CO0 A;  1SQJ A;  1SQ9 A;  5C2W B;  4FHL A;  1FWX A;  4E54 A;  2B5L A;  1GOT B;  3CIK B;  2OVQ B;  3DM0 A;  3EG6 A;  4GM8 A;  1B9Y A;  3UVN A;  2HKR A;  3UVL A;  3ULE C;  5EM2 B;  3EWE A;  1MDA H;  3N0D A;  4JT5 C;  4LG9 A;  2Z2P A;  4GGD A;  3JRO A;  5EMM B;  3F3G A;  3SJL D;  3SWS D;  3F3P A;  3EI3 B;  3I8C A;  5GXI A;  1JMZ B;  2UZX B;  5FKR A;  2G99 A;  2IWK A;  2OK4 A;  4K3I D;  2YNN A;  2XU7 A;  4GQ2 P;  2B5N A;  4X63 B;  3EI4 A;  1K8K C;  4OWR A;  1Q47 A;  2UZY B;  4L3G D;  2P9U C;  1OMW B;  4O3U B;  2YNO A;  2AH1 A;  5C9Z B;  5HE0 B;  4IMM A;  4XEI C;  3RLM D;  4AEZ A;  1A0R B;  3NVX A;  3I7P A;  4X61 B;  3MKS B;  2QXV A;  5FA5 B;  2AGX A;  3EI4 B;  3AH8 B;  4IA9 A;  3AL8 B;  2I3T A;  2XYI A;  4J8B A;  3CFS B;  3I7L A;  3UR4 A;  5I5J A;  5IJ7 E;  2PM6 B;  5FKT A;  5H17 A;  2HJB A;  3SBQ A;  4L3H D;  4CY2 A;  3I8E A;  4O3T B;  2HKM A;  3EI2 A;  5HE3 B;  4GQB B;  4O45 A;  3PE7 A;  4E5Z B;  4CI8 A;  2CN3 A;  4U1E I;  4GGA A;  5EM2 A;  3JB9 L;  4BH6 A;  5TEF A;  5CXC B;  2AGY A;  3MZL A;  3I7H A;  3SVW D;  1N6D A;  4KFM B;  5GSA A;  5AMS A;  4CY5 A;  2OVP B;  4PBY A;  2PM9 B;  4JD2 C;  4PSX B;  4E5Z A;  3VGZ A;  4OZU A;  4XYI A;  3L4O D;  2H6K A;  4H5I A;  3VA6 A;  1N6F A;  4QRJ A;  2H47 A;  4K3J B;  2EBS A;  3SCY A;  2I0S A;  4PNK B;  3J81 g;  5THA A;  3AL9 A;  2XL3 A;  5K19 A;  2J56 H;  3MMY A;  4GGC A;  5FQD A;  3SN6 B;  4FAN D;  5FKQ A;  4BUJ C;  2H6Q A;  3F3F A;  5EML B;  2OIZ A;  4FA9 D;  3UVK A;  3OKT A;  3DSM A;  1JMX B;  3JAM g;  3FRX A;  3EMH A;  5FLX g;  3IJ1 A;  4A2L A;  4A08 A;  5K1C C;  3PSC B;  4FA1 D;  3W15 A;  1MG3 A;  5TDH B;  1PGU A;  1YFQ A;  4FB1 D;  2IWF A;  2P9N C;  3J80 g;  2I3S A;  2HES X;  2HXC A;  1B9X A;  3I7K A;  2YMU A;  3BWS A;  4A08 B;  3SBR A;  4CZX A;  1PI6 A;  4AOW A;  5JWZ A;  3I7O A;  5SXM A;  3OKY B;  1VYH C;  4J81 A;  3OKW A;  3SFZ A;  4ESG A;  4FA5 D;  2BCJ B;  4J78 A;  4GQ1 A;  4ERY A;  4A11 A;  2OVR B;  3KRW B;  4GM9 A;  4A0B A;  3EI2 B;  2Q7Q A;  5CXB A;  4J77 A;  2IUR A;  3KRX B;  4L9O A;  5H1M A;  4FAV D;  2GC4 A;  3NVQ A;  1TYQ C;  3PVU B;  1N6E A;  3UVO A;  3I2N A;  1JOF A;  5EAR A;  3OL2 A;  3B7F A;  3SBP A;  4ES0 A;  2PM9 A;  5A2Q g;  2XL2 A;  2B5M A;  4I79 A;  4CI2 A;  4U7A A;  2CN2 A;  4PBZ A;  4JSP C;  3MXX A;  4D0K A;  4CY3 A;  2H9L A;  3C5M A;  4J86 A;  4E54 B;  5C2V B;  3GFC A;  3UVM A;  1GP2 B;  2H13 A;  2Z2O A;  2AQ5 A;  3JZH A;  3ORV D;  3DWL C;  3EU7 A;  4J73 A;  4JT6 C;  4ZOX A;  4A0A A;  4QQE A;  3RFH A;  4A7J A;  4ZN4 A;  1GG2 B;  1P22 A;  2H9P A;  2P9S C;  4J87 A;  2CO0 C;  4ZOV A;  1K32 A;  2OJY A;  3AL8 A;  2H68 A;  4HDJ A;  4H5J A;  1SHY B;  2P9P C;  4ERZ A;  2H9M A;  2PM7 B;  3SHF A;  3PXW D;  3FM0 A;  5CXB B;  4JSX C;  5I5I A;  4ZOY A; 
#chains in the Genus database with same CATH topology
 4CZV A;  1U2V C;  5FFO A;  4A0B B;  1ERJ A;  2VDN A;  5HDB A;  4O1Q D;  3C9C A;  1BPO A;  4UI9 R;  5IGO A;  2XZG A;  2AGZ A;  1NEX B;  2CE8 A;  4GZ8 A;  4JSV C;  4MMZ A;  5B4W A;  4CY1 A;  4AN1 A;  5FKS A;  3PXS D;  3IIY A;  3V4P A;  3ODT A;  5E6U A;  3IJ0 A;  4J0X A;  3V5W B;  3MKQ A;  4BP8 A;  2HU5 A;  3RMZ D;  2J55 H;  5EMK B;  1O6G A;  1PBY B;  3RSE C;  3EQ8 A;  4EWR A;  4BL0 A;  3NID A;  3SMR A;  5M5S A;  4A0A B;  5KDO B;  4RE5 A;  2H9N A;  3UKU C;  5M5U A;  2PBI B;  1PEV A;  1U4C A;  3U4Y A;  1XHM A;  5CYK A;  4JSN C;  1E5T A;  3I89 A;  4MMY A;  1QFS A;  1MG2 A;  3ZDY A;  4D9S A;  2HYE A;  4N14 A;  3V9F A;  5AFU 3;  4PSW B;  3JZN A;  4ERQ A;  4JHN A;  2W18 A;  3JRP A;  5EAL A;  5HQG A;  1UOQ A;  2I0R A;  5FXY A;  1VE6 A;  2IUV A;  4Z8L A;  4JXM A;  3QI0 A;  4FWW A;  4PC0 A;  5GXH A;  3IUN A;  2VDK A;  2J57 G;  4J84 A;  3OKY A;  3EI1 A;  2IUQ A;  3EQ7 A;  1OLZ A;  2GNQ A;  4GM3 A;  2HU8 A;  3PXT D;  1T2X A;  4FA4 D;  4NSX A;  2VDR A;  3P4F A;  3BG1 A;  4CI1 A;  3MVD K;  1R5M A;  5C92 A;  2IAA A;  5HE1 B;  5HE2 B;  2P9I C;  1O6F A;  1QNI A;  4GMB A;  4PXW A;  5E6S A;  2B4E A;  2MTA H;  4A09 A;  2YNP A;  3C75 H;  4LG8 A;  3C99 A;  1XIP A;  2EIC A;  3V7D B;  3E0C A;  1GXR A;  4RE6 A;  4XYH A;  4NC4 A;  3PSL A;  5I5M A;  5EMJ B;  5IJ8 E;  1H2Y A;  3BG0 A;  1GOF A;  3JZG A;  3VH0 A;  5CYK B;  3O4I A;  4CC9 A;  1L0Q A;  2QC5 A;  2AGW A;  3N0E A;  4Y7R A;  5HYN B;  2G9A A;  3KCI A;  4MK0 B;  4CZY A;  3OTT A;  2QR5 A;  3DXM C;  4YVD A;  5GMK n;  5AJA A;  1U8C A;  2VDP A;  3OL2 B;  3AFC A;  2HJ4 A;  3K27 A;  4QL1 A;  2AH0 A;  4QT8 A;  2CNX A;  3NVN A;  2GC7 A;  4J0W A;  3RFG A;  2H3X A;  3CFV A;  3RN1 D;  3K26 A;  4O9D A;  3RN0 D;  1S4U X;  1JTD B;  3NIG A;  3HFQ A;  4G1M A;  3EI1 B;  3IIW A;  2AGL A;  4WK4 A;  4LGN A;  5H14 A;  2O9K A;  2P9L C;  1QFM A;  2YB8 B;  5TF2 A;  4Z7Q A;  2P9K C;  4G56 B;  2H14 A;  3IKO A;  3UKR C;  3PVW B;  3RRM C;  1RI6 A;  4A11 B;  3FGB A;  3JPX A;  3GRE A;  3K71 A;  3DXK C;  3MZK A;  4A09 B;  3A0F A;  4R7A B;  3L4M D;  4A2M A;  5CXC A;  4TZ4 A;  5IC7 A;  4Y5R D;  5IGQ A;  5IT9 g;  4X3E A;  1TBG A;  3SLE D;  4D6V A;  2BBK H;  4J79 A;  4X60 B;  4ZOZ A;  4L1Q D;  1UTC A;  5TEE A;  3SXT D;  3IJC A;  1L5G A;  2I0T A;  1XKS A;  5EAM A;  2CE9 A;  3ZWL B;  2OK6 A;  4J8G A;  3I7N A;  2H6N A;  3OW8 A;  1NR0 A;  2TRC B;  4J82 A;  2YBA A;  3EI3 A;  1JJU B;  5EAP A;  4AMY A;  2Z2N A;  2IUP A;  4CI3 A;  2CO0 A;  1SQJ A;  1SQ9 A;  5C2W B;  4FHL A;  4UM9 A;  1FWX A;  4E54 A;  4DNU A;  2B5L A;  1GOT B;  2VDM A;  3CIK B;  2XE4 A;  2OVQ B;  1UOP A;  3DM0 A;  3EG6 A;  4GM8 A;  1B9Y A;  3UVN A;  2HKR A;  3UVL A;  2VZ1 A;  3ULE C;  5EM2 B;  3O4J A;  3EWE A;  1MDA H;  3N0D A;  1H2X A;  4JT5 C;  4LG9 A;  2Z2P A;  4GGD A;  3JRO A;  4BCC A;  5EMM B;  3F3G A;  3SJL D;  3SWS D;  1I2M B;  3F3P A;  3EI3 B;  4O2W A;  3I8C A;  5GXI A;  1JMZ B;  2UZX B;  1H2Z A;  5FKR A;  2G99 A;  3K6S A;  2IWK A;  1C9L A;  1H2W A;  2OK4 A;  4K3I D;  2YNN A;  2XU7 A;  4GQ2 P;  2B5N A;  1TYE A;  2VDQ A;  4X63 B;  3EI4 A;  1K8K C;  3IUM A;  4OWR A;  1Q47 A;  2UZY B;  4L3G D;  2P9U C;  2BKL A;  1OMW B;  5M5R A;  4O3U B;  2YNO A;  2AH1 A;  3GD1 I;  4IRZ A;  5C9Z B;  5HE0 B;  4IMM A;  4XEI C;  3RLM D;  4AEZ A;  1A0R B;  3NVX A;  3I7P A;  4X61 B;  3MKS B;  4DNV A;  2HU7 A;  2QXV A;  5FA5 B;  1VE7 A;  2EID A;  3FCU A;  2AGX A;  3EI4 B;  3AH8 B;  4IA9 A;  3AL8 B;  1E8M A;  2I3T A;  2JKX A;  2XYI A;  4UM8 A;  4J8B A;  3CFS B;  3I7L A;  3UR4 A;  5I5J A;  5IJ7 E;  2PM6 B;  5FKT A;  5H17 A;  2HJB A;  4BCD A;  3VI4 A;  1GOG A;  3SBQ A;  4JHP C;  3K72 A;  4L3H D;  4QAM A;  4CY2 A;  5M5V A;  3I8E A;  4O3T B;  2HKM A;  3EI2 A;  5HE3 B;  4GQB B;  4O45 A;  3PE7 A;  4E5Z B;  4CI8 A;  2CN3 A;  3ZE1 A;  4U1E I;  4GGA A;  4DNW A;  5EM2 A;  3JB9 L;  1E8N A;  5TEF A;  5CXC B;  4BH6 A;  2AGY A;  3MZL A;  3T3M A;  3I7H A;  1YR2 A;  3O4H A;  3SVW D;  1N6D A;  2WQ8 A;  2VZ3 A;  4G55 A;  3VI3 A;  4KFM B;  4NAA A;  5GSA A;  5AMS A;  4CY5 A;  2OVP B;  4PBY A;  2PM9 B;  4JD2 C;  3IVM A;  4PSX B;  4E5Z A;  3IUL A;  3VGZ A;  4OZU A;  4XYI A;  4WK2 A;  3L4O D;  2H6K A;  4L1M A;  4H5I A;  1VZ3 A;  1N6F A;  3VA6 A;  4QRJ A;  2H47 A;  4K3J B;  3V4V A;  2EBS A;  3SCY A;  2I0S A;  4PNK B;  3J81 g;  5THA A;  4AMZ A;  3AL9 A;  2XL3 A;  5K19 A;  4NBM A;  2VDO A;  2J56 H;  3MMY A;  4GGC A;  5FQD A;  3SN6 B;  4FAN D;  5FKQ A;  4BUJ C;  5M5T A;  2H6Q A;  3F3F A;  5EML B;  2OIZ A;  4FA9 D;  3UVK A;  3OKT A;  2VC2 A;  3MUN A;  1M1X A;  3DSM A;  1JMX B;  3JAM g;  3FRX A;  3EMH A;  5FLX g;  3IJ1 A;  4A2L A;  4A08 A;  5K1C C;  3PSC B;  4FA1 D;  3W15 A;  1MG3 A;  5TDH B;  1A12 A;  1PGU A;  1YFQ A;  4FB1 D;  4WJK A;  2IWF A;  2P9N C;  2VDL A;  3FCS A;  3J80 g;  2I3S A;  2HES X;  3GC3 B;  2HXC A;  1B9X A;  5FFG A;  3I7K A;  2YMU A;  3BWS A;  3IJE A;  4Z7N A;  4A08 B;  5M61 A;  3SBR A;  4CZX A;  4MMX A;  1PI6 A;  4AOW A;  5JWZ A;  3I7O A;  3IUR A;  5SXM A;  3OKY B;  1VYH C;  4J81 A;  4G1E A;  5E6R A;  3OKW A;  3SFZ A;  4ESG A;  4FA5 D;  2BCJ B;  3IUQ A;  4J78 A;  4GQ1 A;  4ERY A;  4A11 A;  2OVR B;  4NEN A;  3KRW B;  4GM9 A;  4A0B A;  3EI2 B;  2Q7Q A;  4J77 A;  5CXB A;  2IUR A;  3KRX B;  4L9O A;  5H1M A;  4FAV D;  2GC4 A;  3NVQ A;  1TYQ C;  3PVU B;  4AN0 A;  1N6E A;  3UVO A;  3I2N A;  1JOF A;  1VZ2 A;  5EAR A;  3OL2 A;  3B7F A;  3SBP A;  4ES0 A;  2PM9 A;  2EIE A;  4AX4 A;  2XL2 A;  5A2Q g;  3IUJ A;  3T3P A;  3MUO A;  2B5M A;  4WK0 A;  4I79 A;  1K3I A;  3OF7 A;  4U7A A;  2XDW A;  4CI2 A;  2CN2 A;  4PBZ A;  4JSP C;  3MXX A;  4D0K A;  4CY3 A;  4BP9 A;  2H9L A;  3C5M A;  4J86 A;  3O4G A;  4E54 B;  5C2V B;  3ZDX A;  3GFC A;  3UVM A;  1GP2 B;  2H13 A;  2Z2O A;  2AQ5 A;  3ORV D;  3JZH A;  3DWL C;  3EQ9 A;  2EIB A;  3EU7 A;  3ZE0 A;  4J73 A;  5C86 A;  1GOH A;  4JT6 C;  4ZOX A;  4A0A A;  4QQE A;  3RFH A;  4A7J A;  4ZN4 A;  1GG2 B;  1P22 A;  2H9P A;  2P9S C;  3DDU A;  2CO0 C;  4J87 A;  4ZOV A;  1UOO A;  3QHY B;  1K32 A;  2OJY A;  3AL8 A;  1JV2 A;  2H68 A;  4HDJ A;  4H5J A;  3NIF A;  1SHY B;  2P9P C;  4O02 A;  4ERZ A;  2H9M A;  2PM7 B;  3SHF A;  3PXW D;  3ZDZ A;  4Z7O A;  3FM0 A;  4BCB A;  3ZE2 A;  5CXB B;  4JSX C;  5I5I A;  1C9I A;  2QZP A;  4ZOY A; 
#chains in the Genus database with same CATH homology
 4CZV A;  1U2V C;  4A0B B;  1ERJ A;  4O1Q D;  3C9C A;  4UI9 R;  5IGO A;  2AGZ A;  1NEX B;  2CE8 A;  4GZ8 A;  4JSV C;  5B4W A;  4CY1 A;  5FKS A;  3PXS D;  3IIY A;  3ODT A;  3IJ0 A;  4J0X A;  3V5W B;  3MKQ A;  3RMZ D;  2J55 H;  5EMK B;  1PBY B;  3RSE C;  4EWR A;  4BL0 A;  3SMR A;  4A0A B;  5KDO B;  2H9N A;  3UKU C;  2PBI B;  1PEV A;  1U4C A;  3U4Y A;  1XHM A;  5CYK A;  4JSN C;  3I89 A;  1MG2 A;  2HYE A;  4N14 A;  3V9F A;  5AFU 3;  4PSW B;  3JZN A;  4ERQ A;  2W18 A;  3JRP A;  5EAL A;  5HQG A;  2I0R A;  5FXY A;  2IUV A;  4Z8L A;  4JXM A;  4FWW A;  4PC0 A;  5GXH A;  2J57 G;  4J84 A;  3OKY A;  3EI1 A;  2IUQ A;  1OLZ A;  2GNQ A;  4GM3 A;  3PXT D;  4FA4 D;  4NSX A;  3P4F A;  3BG1 A;  4CI1 A;  1R5M A;  2IAA A;  5HE1 B;  5HE2 B;  2P9I C;  1QNI A;  4GMB A;  4PXW A;  2B4E A;  2MTA H;  4A09 A;  2YNP A;  3C75 H;  4LG8 A;  3C99 A;  1XIP A;  3V7D B;  3E0C A;  1GXR A;  4XYH A;  3PSL A;  5I5M A;  5EMJ B;  5IJ8 E;  3BG0 A;  3JZG A;  3VH0 A;  5CYK B;  4CC9 A;  1L0Q A;  2QC5 A;  2AGW A;  3N0E A;  4Y7R A;  5HYN B;  2G9A A;  4MK0 B;  4CZY A;  3OTT A;  3DXM C;  4YVD A;  5GMK n;  5AJA A;  3OL2 B;  3AFC A;  2HJ4 A;  3K27 A;  4QL1 A;  4QT8 A;  2AH0 A;  2CNX A;  4J0W A;  3NVN A;  2GC7 A;  3RFG A;  2H3X A;  3CFV A;  3RN1 D;  3K26 A;  4O9D A;  3RN0 D;  1S4U X;  3EI1 B;  3HFQ A;  3IIW A;  2AGL A;  4LGN A;  5H14 A;  2O9K A;  2P9L C;  2YB8 B;  5TF2 A;  2P9K C;  4G56 B;  2H14 A;  3IKO A;  3UKR C;  3PVW B;  3RRM C;  1RI6 A;  4A11 B;  3FGB A;  3JPX A;  3GRE A;  3DXK C;  3MZK A;  4A09 B;  3A0F A;  4R7A B;  3L4M D;  4A2M A;  5CXC A;  4TZ4 A;  5IC7 A;  4Y5R D;  5IGQ A;  5IT9 g;  4X3E A;  1TBG A;  3SLE D;  4D6V A;  4X60 B;  2BBK H;  4J79 A;  4ZOZ A;  4L1Q D;  5TEE A;  3SXT D;  3IJC A;  2I0T A;  1XKS A;  5EAM A;  2CE9 A;  3ZWL B;  2OK6 A;  4J8G A;  3I7N A;  2H6N A;  3OW8 A;  1NR0 A;  2TRC B;  4J82 A;  2YBA A;  3EI3 A;  1JJU B;  5EAP A;  2Z2N A;  2IUP A;  4CI3 A;  2CO0 A;  1SQJ A;  1SQ9 A;  5C2W B;  4FHL A;  1FWX A;  4E54 A;  2B5L A;  1GOT B;  3CIK B;  2OVQ B;  3DM0 A;  3EG6 A;  4GM8 A;  1B9Y A;  3UVN A;  2HKR A;  3UVL A;  3ULE C;  5EM2 B;  3EWE A;  1MDA H;  3N0D A;  4JT5 C;  4LG9 A;  2Z2P A;  4GGD A;  3JRO A;  5EMM B;  3F3G A;  3SJL D;  3SWS D;  3F3P A;  3EI3 B;  3I8C A;  5GXI A;  1JMZ B;  2UZX B;  5FKR A;  2G99 A;  2IWK A;  2OK4 A;  4K3I D;  2YNN A;  2XU7 A;  4GQ2 P;  2B5N A;  4X63 B;  3EI4 A;  1K8K C;  4OWR A;  1Q47 A;  2UZY B;  4L3G D;  2P9U C;  1OMW B;  4O3U B;  2YNO A;  2AH1 A;  5C9Z B;  5HE0 B;  4IMM A;  4XEI C;  3RLM D;  4AEZ A;  1A0R B;  3NVX A;  3I7P A;  4X61 B;  3MKS B;  2QXV A;  5FA5 B;  2AGX A;  3EI4 B;  3AH8 B;  4IA9 A;  3AL8 B;  2I3T A;  2XYI A;  4J8B A;  3CFS B;  3I7L A;  3UR4 A;  5I5J A;  5IJ7 E;  2PM6 B;  5FKT A;  5H17 A;  2HJB A;  3SBQ A;  4L3H D;  4CY2 A;  3I8E A;  4O3T B;  2HKM A;  3EI2 A;  5HE3 B;  4GQB B;  4O45 A;  3PE7 A;  4E5Z B;  4CI8 A;  2CN3 A;  4U1E I;  4GGA A;  5EM2 A;  3JB9 L;  4BH6 A;  5TEF A;  5CXC B;  2AGY A;  3MZL A;  3I7H A;  3SVW D;  1N6D A;  4KFM B;  5GSA A;  5AMS A;  4CY5 A;  2OVP B;  4PBY A;  2PM9 B;  4JD2 C;  4PSX B;  4E5Z A;  3VGZ A;  4OZU A;  4XYI A;  3L4O D;  2H6K A;  4H5I A;  3VA6 A;  1N6F A;  4QRJ A;  2H47 A;  4K3J B;  2EBS A;  3SCY A;  2I0S A;  4PNK B;  3J81 g;  5THA A;  3AL9 A;  2XL3 A;  5K19 A;  2J56 H;  3MMY A;  4GGC A;  5FQD A;  3SN6 B;  4FAN D;  5FKQ A;  4BUJ C;  2H6Q A;  3F3F A;  5EML B;  2OIZ A;  4FA9 D;  3UVK A;  3OKT A;  3DSM A;  1JMX B;  3JAM g;  3FRX A;  3EMH A;  5FLX g;  3IJ1 A;  4A2L A;  4A08 A;  5K1C C;  3PSC B;  4FA1 D;  3W15 A;  1MG3 A;  5TDH B;  1PGU A;  1YFQ A;  4FB1 D;  2IWF A;  2P9N C;  3J80 g;  2I3S A;  2HES X;  2HXC A;  1B9X A;  3I7K A;  2YMU A;  3BWS A;  4A08 B;  3SBR A;  4CZX A;  1PI6 A;  4AOW A;  5JWZ A;  3I7O A;  5SXM A;  3OKY B;  1VYH C;  4J81 A;  3OKW A;  3SFZ A;  4ESG A;  4FA5 D;  2BCJ B;  4J78 A;  4GQ1 A;  4ERY A;  4A11 A;  2OVR B;  3KRW B;  4GM9 A;  4A0B A;  3EI2 B;  2Q7Q A;  5CXB A;  4J77 A;  2IUR A;  3KRX B;  4L9O A;  5H1M A;  4FAV D;  2GC4 A;  3NVQ A;  1TYQ C;  3PVU B;  1N6E A;  3UVO A;  3I2N A;  1JOF A;  5EAR A;  3OL2 A;  3B7F A;  3SBP A;  4ES0 A;  2PM9 A;  5A2Q g;  2XL2 A;  2B5M A;  4I79 A;  4CI2 A;  4U7A A;  2CN2 A;  4PBZ A;  4JSP C;  3MXX A;  4D0K A;  4CY3 A;  2H9L A;  3C5M A;  4J86 A;  4E54 B;  5C2V B;  3GFC A;  3UVM A;  1GP2 B;  2H13 A;  2Z2O A;  2AQ5 A;  3JZH A;  3ORV D;  3DWL C;  3EU7 A;  4J73 A;  4JT6 C;  4ZOX A;  4A0A A;  4QQE A;  3RFH A;  4A7J A;  4ZN4 A;  1GG2 B;  1P22 A;  2H9P A;  2P9S C;  4J87 A;  2CO0 C;  4ZOV A;  1K32 A;  2OJY A;  3AL8 A;  2H68 A;  4HDJ A;  4H5J A;  1SHY B;  2P9P C;  4ERZ A;  2H9M A;  2PM7 B;  3SHF A;  3PXW D;  3FM0 A;  5CXB B;  4JSX C;  5I5I A;  4ZOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...