4ZN4A

Crystal structure of sqt1 from chaetomium thermophilum solved by mr
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
483
structure length
409
Chain Sequence
ALENDSIAYFDGHKDSVFAIAQHPLYPNIVATGGSEGDADDAPGKGYVLDISATSLNPIFEIDGHTDSINALTFTLPRGDFLVSGGMDGRMRVYAVSVPQNGALAQFKFLAESQETEEINWFAPCPSPDHPNTIALGASDGSVWVFTLDNPVQIVQSYFLHTGPCTAGAWSPDGLLLATVSEDESLHVYDVFGVAASKSLVTDNGQTVVSLTNVDQRFAVEGGLFSVAVSPTGAVVAVGGAGGQIKIVGLPRLSQAGTILASLQIQSDNIESLAFSPSAPILAAGSTDGSIAVFDTSRSFALRRHLRGAHAEDPVVKVEFVKSPPNAAMAGWLLTSCGMDGVVRRWDLRGGTAGPGTLPHMAPSGLVKEWKGHRSGQEGGGVLGFVQGETGERIVTVGDDAVVLVFEAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-translational capturing of nascent ribosomal proteins by their dedicated chaperones.
pubmed doi rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
molecule tags Chaperone
molecule keywords sqt1
total genus 105
structure length 409
sequence length 483
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4zn4A00
3K26A 2J55H 4J73A 1JOFA 5TDHB 3SBPA 3UVNA 3JZGA 3RFHA 3IKOA 4ZOXA 1S4UX 1YFQA 3JRPA 3N0EA 5EAPA 4CC9A 1RI6A 4K3JB 4XYIA 5CYKA 3EI1A 3C9CA 4H5JA 5EMJB 1XKSA 5TEFA 1B9YA 2B5MA 4JSVC 1N6DA 4PC0A 1B9XA 4JSPC 3SJLD 1SQ9A 2OJYA 3AL8A 3PXTD 4PBYA 2AGWA 4A08A 4CZXA 3OKWA 5HQGA 3NVNA 5SXMA 2I3SA 2CE9A 2H3XA 5IJ8E 2H9MA 3SWSD 3AL9A 1U2VC 4XEIC 3RMZD 4A11A 3RSEC 4LG9A 1L0QA 3L4OD 2QXVA 3I7HA 4GQBB 3JB9L 5TF2A 3KRWB 3JPXA 2QC5A 2OVRB 4H5IA 4AEZA 1XIPA 2Z2PA 5KDOB 2H9PA 5FLXg 4CZVA 3EI4A 4JD2C 3ZWLB 1PBYB 5IJ7E 3UR4A 5EAMA 1MG2A 2OK6A 4CI8A 5HYNB 5HE2B 2YNOA 2P9IC 3DXMC 2J57G 5I5JA 4J8GA 3F3PA 1PGUA 5GMKn 4CY1A 3OKYB 5HE3B 3J81g 2H9NA 4OZUA 4GGCA 3SVWD 3BG0A 4JSNC 4ERQA 2MTAH 3I8CA 4GM3A 4PBZA 3EI1B 4CZYA 2P9SC 3KRXB 2CO0C 3DXKC 4O3TB 4JSXC 4GQ2P 2AGXA 4FAND 4GGAA 4FAVD 4E5ZA 5GXHA 4GGDA 3GFCA 3I7PA 1OMWB 3RN0D 1TYQC 4E5ZB 4J0WA 3MKQA 2H47A 3AL8B 2I0TA 2YNPA 4O45A 5AMSA 5GSAA 2XL3A 5EARA 4L3HD 5THAA 2H13A 1JMZB 4ERYA 5CYKB 3SXTD 3NVXA 4J82A 2AH0A 3C5MA 3FGBA 2CN3A 3IIWA 1K8KC 2H9LA 1GG2B 4LG8A 3JZHA 1U4CA 4BH6A 5CXBB 4CY3A 3I7LA 3UKUC 4O1QD 4U1EI 4X61B 2CE8A 1NR0A 2B5LA 3SFZA 2BCJB 5A2Qg 3PXWD 3SHFA 3EI4B 3FM0A 3EI3B 2XL2A 3MKSB 4J79A 3SBRA 2PBIB 2BBKH 3JROA 4PSWB 5FA5B 5HE1B 5FKRA 3UVMA 5JWZA 3SLED 3NVQA 3L4MD 3I2NA 5CXBA 2P9UC 4CI2A 4BUJC 4O9DA 2HJ4A 3OL2B 2XYIA 4QT8A 2GC4A 2HKRA 2P9NC 5EMLB 4IMMA 3K27A 2G9AA 5GXIA 3RN1D 4CI1A 4CI3A 2GC7A 4HDJA 4JT6C 2AGZA 3IJCA 4L9OA 3I8EA 4XYHA 3V7DB 4A0BB 4A0AA 2AGYA 3RLMD 3E0CA 2OIZA 4ZOVA 2P9KC 1OLZA 3F3FA 4X3EA 3B7FA 4PXWA 2OK4A 3N0DA 3ORVD 2I0SA 4PNKB 1SQJA 5C2VB 4A09A 1N6FA 3RRMC 3U4YA 4A2LA 4MK0B 4FWWA 3PSLA 2CO0A 3GREA 3V5WB 2AGLA 1R5MA 1VYHC 4Y7RA 5H17A 1P22A 3I7NA 3P4FA 4A11B 3BWSA 2Z2OA 3V9FA 4IA9A 2CN2A 2YBAA 1N6EA 3PVWB 2HXCA 2W18A 5FXYA 4FB1D 3RFGA 1Q47A 2Z2NA 1PEVA 4CY5A 2IWKA 4FHLA 2P9LC 4A0AB 4A0BA 3SN6B 2O9KA 4A08B 3OKYA 3IIYA 5K19A 2Q7QA 3DM0A 2PM9B 2AQ5A 2HESX 5B4WA 4A09B 5AFU3 4J8BA 1QNIA 1NEXB 3SBQA 2IUPA 2B4EA 4J87A 3HFQA 4BL0A 5H1MA 4X63B 3OL2A 3IJ0A 4N14A 3DSMA 1SHYB 1XHMA 4GZ8A 2YMUA 2IUQA 4G56B 5C2WB 3MXXA 2H6QA 4JT5C 1PI6A 4ESGA 2I0RA 4ZN4A 4Z8LA 2I3TA 4GM8A 5EM2A 4AOWA 4I79A 3EI3A 4FA1D 4E54A 3UKRC 5EALA 4A2MA 2HKMA 4J86A 3I7OA 2J56H 2H6KA 3W15A 5K1CC 4KFMB 3SMRA 5EMKB 3BG1A 4ZOYA 2HJBA 4FA5D 3OKTA 5IT9g 3VA6A 3A0FA 2IURA 1A0RB 5C9ZB 3MMYA 2IUVA 4E54B 3OW8A 5FKSA 5H14A 3JZNA 5FQDA 3PXSD 2P9PC 2EBSA 4QQEA 3EMHA 2HYEA 2OVQB 3DWLC 1TBGA 2UZYB 3CFSB 4U7AA 4FA9D 3UVOA 3EG6A 4J81A 2G99A 4OWRA 3I89A 2GNQA 4UI9R 2AH1A 2PM6B 5FKTA 1K32A 2UZXB 5I5MA 3UVLA 4X60B 4EWRA 4GM9A 3I7KA 5FKQA 4PSXB 5IC7A 3EI2B 2PM7B 4GMBA 5CXCA 3MZKA 3PE7A 2CNXA 1MDAH 4L3GD 4ES0A 1GOTB 2YNNA 3FRXA 4D0KA 3UVKA 1GP2B 2IWFA 1JJUB 5AJAA 4J84A 4NSXA 4LGNA 4A7JA 4L1QD 5TEEA 3J80g 4R7AB 2XU7A 3C75H 2IAAA 3CIKB 1FWXA 4GQ1A 4K3ID 3EI2A 3AFCA 3ODTA 5IGOA 3C99A 4CY2A 3PSCB 4YVDA 5EMMB 3EWEA 3PVUB 4QL1A 4JXMA 4ERZA 4TZ4A 3VGZA 2TRCB 2H6NA 2H68A 4ZOZA 4O3UB 5IGQA 4J78A 3JAMg 1GXRA 3EU7A 4J0XA 2H14A 5CXCB 3IJ1A 2OVPB 4J77A 3AH8B 2PM9A 1MG3A 5EM2B 4FA4D 3MZLA 5I5IA 3OTTA 3CFVA 3F3GA 1ERJA 2B5NA 5HE0B 3ULEC 4D6VA 3SCYA 1JMXB 2YB8B 3VH0A 4Y5RD 4QRJA
chains in the Genus database with same CATH superfamily
4AN0A 2JKXA 3K26A 2J55H 4J73A 1JOFA 5TDHB 3SBPA 3UVNA 3JZGA 3RFHA 3K71A 5FFOA 2HU7A 3IKOA 4ZOXA 4WK0A 1S4UX 3VI3A 1YFQA 3JRPA 3N0EA 5EAPA 4CC9A 1RI6A 2XZGA 4K3JB 4XYIA 5CYKA 4MMYA 5FFGA 3EI1A 3C9CA 4H5JA 5EMJB 1XKSA 2VDMA 1H2ZA 5TEFA 1B9YA 2B5MA 3QHYB 4AN1A 3IULA 4JSVC 1N6DA 4PC0A 1B9XA 4IRZA 4JSPC 3SJLD 1SQ9A 2OJYA 3AL8A 3PXTD 4PBYA 4BCBA 2AGWA 1UOOA 4A08A 4CZXA 3OKWA 5HQGA 3V4VA 1UOPA 3NVNA 5SXMA 2I3SA 4BCCA 2CE9A 2H3XA 5IJ8E 2H9MA 3SWSD 1K3IA 3AL9A 1U2VC 5E6UA 4XEIC 3RMZD 4A11A 5C86A 3RSEC 4LG9A 1L0QA 3L4OD 2QXVA 3I7HA 4GQBB 3KCIA 3FCSA 3O4JA 4G55A 5E6RA 3JB9L 5TF2A 3KRWB 3NIFA 3JPXA 2QC5A 2OVRB 4H5IA 3EQ9A 4AEZA 1XIPA 2VDKA 2Z2PA 5KDOB 2VZ1A 2H9PA 5FLXg 4G1MA 4CZVA 3EI4A 4JD2C 4O02A 1PBYB 3ZWLB 5IJ7E 1UTCA 3UR4A 1U8CA 5EAMA 1MG2A 2OK6A 4CI8A 2QR5A 5HYNB 5HE2B 2YNOA 2P9IC 3DXMC 2J57G 5I5JA 4J8GA 3F3PA 1PGUA 5GMKn 3ZE0A 4CY1A 4UM8A 3OKYB 5HE3B 4BP8A 3J81g 2H9NA 4OZUA 4GGCA 3K6SA 3SVWD 1O6FA 3BG0A 4JSNC 4ERQA 4DNWA 2MTAH 3I8CA 4GM3A 4PBZA 3EI1B 3NIDA 4CZYA 2P9SC 3KRXB 2CO0C 3DXKC 4O3TB 4JSXC 4GQ2P 2AGXA 2QZPA 4FAND 4GGAA 4FAVD 3OF7A 2VZ3A 4E5ZA 5GXHA 1JTDB 3GFCA 4GGDA 3I7PA 1OMWB 3RN0D 1TYQC 4E5ZB 2XDWA 4J0WA 3MKQA 2H47A 3AL8B 2I0TA 4DNUA 2YNPA 4O45A 5AMSA 5GSAA 2XL3A 5EARA 4RE6A 4L3HD 5THAA 2H13A 1JMZB 4Z7NA 1I2MB 5C92A 4ERYA 5CYKB 3SXTD 4NC4A 3NVXA 4J82A 2AH0A 3C5MA 3FGBA 2CN3A 3IIWA 3MUOA 1K8KC 1GG2B 2H9LA 4LG8A 3JZHA 1U4CA 4BH6A 5CXBB 3IUMA 4CY3A 3I7LA 3UKUC 4O1QD 4U1EI 4X61B 2CE8A 1NR0A 2B5LA 3SFZA 2BCJB 5A2Qg 3PXWD 3SHFA 3EI4B 3FM0A 3EI3B 2XL2A 3MKSB 4J79A 3SBRA 2PBIB 2BBKH 3JROA 1O6GA 1E5TA 4DNVA 4PSWB 5FA5B 5HE1B 5FKRA 3UVMA 5JWZA 3SLED 3NVQA 3L4MD 3I2NA 2P9UC 5CXBA 4CI2A 4BUJC 4O9DA 2HJ4A 3OL2B 1T2XA 2XYIA 4QT8A 2GC4A 2HKRA 2P9NC 5EMLB 4IMMA 3K27A 5HDBA 2G9AA 5GXIA 3RN1D 4CI1A 5M61A 4CI3A 1VZ2A 2GC7A 4HDJA 4O2WA 4NBMA 4JT6C 2AGZA 3IJCA 4L9OA 2EICA 3I8EA 4XYHA 3V7DB 5E6SA 4A0BB 4A0AA 2AGYA 3RLMD 2VDOA 3E0CA 2OIZA 3VI4A 2EIDA 4Z7OA 4ZOVA 2P9KC 1OLZA 3F3FA 3T3MA 2VC2A 4X3EA 3B7FA 4PXWA 2OK4A 3ORVD 3N0DA 2I0SA 2BKLA 4PNKB 1SQJA 5C2VB 4A09A 1N6FA 4MMZA 3RRMC 3U4YA 4A2LA 4MK0B 4FWWA 3PSLA 4JHNA 2CO0A 3GREA 3V5WB 2AGLA 1R5MA 3IJEA 1VYHC 4Y7RA 5H17A 1P22A 3I7NA 1BPOA 3EQ8A 3P4FA 3IUQA 4A11B 3BWSA 2Z2OA 3V9FA 4AMZA 3GC3B 4IA9A 1GOHA 2CN2A 2YBAA 1N6EA 2XE4A 3PVWB 2HXCA 2W18A 5FXYA 4FB1D 3RFGA 1Q47A 2Z2NA 1PEVA 3K72A 4CY5A 2IWKA 4FHLA 2P9LC 4A0AB 4A0BA 1QFMA 3FCUA 3SN6B 2O9KA 4A08B 3OKYA 4NENA 3IIYA 5K19A 2Q7QA 3DM0A 2PM9B 2VDPA 2AQ5A 3O4HA 2HESX 5B4WA 4A09B 5AFU3 4J8BA 1QNIA 1NEXB 3SBQA 1VE7A 2IUPA 2WQ8A 2B4EA 4J87A 3HFQA 4BL0A 5H1MA 4X63B 3OL2A 3IJ0A 4N14A 3O4GA 3DSMA 1SHYB 3V4PA 1XHMA 4GZ8A 2YMUA 2IUQA 4G56B 1GOFA 5C2WB 3MXXA 2H6QA 4JT5C 1PI6A 4ESGA 2I0RA 4ZN4A 4Z8LA 2I3TA 4GM8A 5EM2A 4AOWA 4I79A 3EI3A 4Z7QA 4FA1D 4E54A 1A12A 3UKRC 5EALA 4A2MA 1L5GA 4WK4A 2HKMA 4J86A 3I7OA 4L1MA 2J56H 2H6KA 3EQ7A 2HU5A 5K1CC 3W15A 4RE5A 5M5RA 4KFMB 3SMRA 5EMKB 3ZDYA 3BG1A 4ZOYA 2HJBA 3ZDZA 4FA5D 3ZDXA 3OKTA 5IT9g 3VA6A 2EIEA 3QI0A 3A0FA 2IURA 1A0RB 1UOQA 5C9ZB 3MMYA 2IUVA 4E54B 3MVDK 3OW8A 5FKSA 5H14A 3JZNA 4NAAA 5M5VA 5FQDA 3PXSD 3IVMA 2P9PC 3ZE1A 4D9SA 2EBSA 4QQEA 1VE6A 3EMHA 4WK2A 2OVQB 2HYEA 3DWLC 1TBGA 2UZYB 3CFSB 4U7AA 4FA9D 3UVOA 5M5UA 1E8MA 3EG6A 4J81A 2G99A 4G1EA 3O4IA 4OWRA 3I89A 4UM9A 2GNQA 2VDLA 4UI9R 2AH1A 2PM6B 5FKTA 1K32A 2UZXB 5I5MA 5M5TA 3UVLA 4X60B 4EWRA 4GM9A 3I7KA 5FKQA 4PSXB 5IC7A 3EI2B 3MUNA 2PM7B 4GMBA 1C9IA 5CXCA 3MZKA 3PE7A 1YR2A 2CNXA 1C9LA 4JHPC 1H2YA 1MDAH 4L3GD 4ES0A 1H2WA 1GOTB 2YNNA 3FRXA 4MMXA 4D0KA 3UVKA 1GP2B 2IWFA 4AX4A 1JJUB 5AJAA 4J84A 4AMYA 4NSXA 2VDRA 4LGNA 4A7JA 4L1QD 5TEEA 3J80g 4R7AB 1E8NA 2XU7A 3C75H 2IAAA 3CIKB 1FWXA 4GQ1A 5M5SA 2VDNA 3T3PA 4K3ID 3EI2A 3AFCA 1JV2A 4BP9A 3ODTA 1VZ3A 3NIGA 3GD1I 5IGOA 3C99A 4CY2A 3PSCB 4YVDA 5EMMB 2EIBA 3DDUA 3EWEA 3PVUB 4QL1A 1TYEA 4JXMA 1H2XA 2VDQA 4BCDA 1QFSA 4ERZA 4TZ4A 3VGZA 2TRCB 2H6NA 2H68A 4ZOZA 4O3UB 5IGQA 4J78A 3JAMg 1GXRA 3EU7A 4J0XA 2H14A 2HU8A 3IJ1A 3IUJA 5CXCB 3IUNA 2OVPB 3IURA 4J77A 3AH8B 2PM9A 1MG3A 5EM2B 4FA4D 3MZLA 4WJKA 5I5IA 3OTTA 3CFVA 4QAMA 3F3GA 1ERJA 2B5NA 5HE0B 3ULEC 4D6VA 1GOGA 3SCYA 1JMXB 2YB8B 1M1XA 3VH0A 4Y5RD 3ZE2A 4QRJA
chains in the Genus database with same CATH topology
3K26A 2J55H 4J73A 1JOFA 5TDHB 3SBPA 3UVNA 3JZGA 3RFHA 3IKOA 4ZOXA 1S4UX 1YFQA 3JRPA 3N0EA 5EAPA 4CC9A 1RI6A 4K3JB 4XYIA 5CYKA 3EI1A 3C9CA 4H5JA 5EMJB 1XKSA 5TEFA 1B9YA 2B5MA 4JSVC 1N6DA 4PC0A 1B9XA 4JSPC 3SJLD 1SQ9A 2OJYA 3AL8A 3PXTD 4PBYA 2AGWA 4A08A 4CZXA 3OKWA 5HQGA 3NVNA 5SXMA 2I3SA 2CE9A 2H3XA 5IJ8E 2H9MA 3SWSD 3AL9A 1U2VC 4XEIC 3RMZD 4A11A 3RSEC 4LG9A 1L0QA 3L4OD 2QXVA 3I7HA 4GQBB 3JB9L 5TF2A 3KRWB 3JPXA 2QC5A 2OVRB 4H5IA 4AEZA 1XIPA 2Z2PA 5KDOB 2H9PA 5FLXg 4CZVA 3EI4A 4JD2C 3ZWLB 1PBYB 5IJ7E 3UR4A 5EAMA 1MG2A 2OK6A 4CI8A 5HYNB 5HE2B 2YNOA 2P9IC 3DXMC 2J57G 5I5JA 4J8GA 3F3PA 1PGUA 5GMKn 4CY1A 3OKYB 5HE3B 3J81g 2H9NA 4OZUA 4GGCA 3SVWD 3BG0A 4JSNC 4ERQA 2MTAH 3I8CA 4GM3A 4PBZA 3EI1B 4CZYA 2P9SC 3KRXB 2CO0C 3DXKC 4O3TB 4JSXC 4GQ2P 2AGXA 4FAND 4GGAA 4FAVD 4E5ZA 5GXHA 4GGDA 3GFCA 3I7PA 1OMWB 3RN0D 1TYQC 4E5ZB 4J0WA 3MKQA 2H47A 3AL8B 2I0TA 2YNPA 4O45A 5AMSA 5GSAA 2XL3A 5EARA 4L3HD 5THAA 2H13A 1JMZB 4ERYA 5CYKB 3SXTD 3NVXA 4J82A 2AH0A 3C5MA 3FGBA 2CN3A 3IIWA 1K8KC 2H9LA 1GG2B 4LG8A 3JZHA 1U4CA 4BH6A 5CXBB 4CY3A 3I7LA 3UKUC 4O1QD 4U1EI 4X61B 2CE8A 1NR0A 2B5LA 3SFZA 2BCJB 5A2Qg 3PXWD 3SHFA 3EI4B 3FM0A 3EI3B 2XL2A 3MKSB 4J79A 3SBRA 2PBIB 2BBKH 3JROA 4PSWB 5FA5B 5HE1B 5FKRA 3UVMA 5JWZA 3SLED 3NVQA 3L4MD 3I2NA 5CXBA 2P9UC 4CI2A 4BUJC 4O9DA 2HJ4A 3OL2B 2XYIA 4QT8A 2GC4A 2HKRA 2P9NC 5EMLB 4IMMA 3K27A 2G9AA 5GXIA 3RN1D 4CI1A 4CI3A 2GC7A 4HDJA 4JT6C 2AGZA 3IJCA 4L9OA 3I8EA 4XYHA 3V7DB 4A0BB 4A0AA 2AGYA 3RLMD 3E0CA 2OIZA 4ZOVA 2P9KC 1OLZA 3F3FA 4X3EA 3B7FA 4PXWA 2OK4A 3N0DA 3ORVD 2I0SA 4PNKB 1SQJA 5C2VB 4A09A 1N6FA 3RRMC 3U4YA 4A2LA 4MK0B 4FWWA 3PSLA 2CO0A 3GREA 3V5WB 2AGLA 1R5MA 1VYHC 4Y7RA 5H17A 1P22A 3I7NA 3P4FA 4A11B 3BWSA 2Z2OA 3V9FA 4IA9A 2CN2A 2YBAA 1N6EA 3PVWB 2HXCA 2W18A 5FXYA 4FB1D 3RFGA 1Q47A 2Z2NA 1PEVA 4CY5A 2IWKA 4FHLA 2P9LC 4A0AB 4A0BA 3SN6B 2O9KA 4A08B 3OKYA 3IIYA 5K19A 2Q7QA 3DM0A 2PM9B 2AQ5A 2HESX 5B4WA 4A09B 5AFU3 4J8BA 1QNIA 1NEXB 3SBQA 2IUPA 2B4EA 4J87A 3HFQA 4BL0A 5H1MA 4X63B 3OL2A 3IJ0A 4N14A 3DSMA 1SHYB 1XHMA 4GZ8A 2YMUA 2IUQA 4G56B 5C2WB 3MXXA 2H6QA 4JT5C 1PI6A 4ESGA 2I0RA 4ZN4A 4Z8LA 2I3TA 4GM8A 5EM2A 4AOWA 4I79A 3EI3A 4FA1D 4E54A 3UKRC 5EALA 4A2MA 2HKMA 4J86A 3I7OA 2J56H 2H6KA 3W15A 5K1CC 4KFMB 3SMRA 5EMKB 3BG1A 4ZOYA 2HJBA 4FA5D 3OKTA 5IT9g 3VA6A 3A0FA 2IURA 1A0RB 5C9ZB 3MMYA 2IUVA 4E54B 3OW8A 5FKSA 5H14A 3JZNA 5FQDA 3PXSD 2P9PC 2EBSA 4QQEA 3EMHA 2HYEA 2OVQB 3DWLC 1TBGA 2UZYB 3CFSB 4U7AA 4FA9D 3UVOA 3EG6A 4J81A 2G99A 4OWRA 3I89A 2GNQA 4UI9R 2AH1A 2PM6B 5FKTA 1K32A 2UZXB 5I5MA 3UVLA 4X60B 4EWRA 4GM9A 3I7KA 5FKQA 4PSXB 5IC7A 3EI2B 2PM7B 4GMBA 5CXCA 3MZKA 3PE7A 2CNXA 1MDAH 4L3GD 4ES0A 1GOTB 2YNNA 3FRXA 4D0KA 3UVKA 1GP2B 2IWFA 1JJUB 5AJAA 4J84A 4NSXA 4LGNA 4A7JA 4L1QD 5TEEA 3J80g 4R7AB 2XU7A 3C75H 2IAAA 3CIKB 1FWXA 4GQ1A 4K3ID 3EI2A 3AFCA 3ODTA 5IGOA 3C99A 4CY2A 3PSCB 4YVDA 5EMMB 3EWEA 3PVUB 4QL1A 4JXMA 4ERZA 4TZ4A 3VGZA 2TRCB 2H6NA 2H68A 4ZOZA 4O3UB 5IGQA 4J78A 3JAMg 1GXRA 3EU7A 4J0XA 2H14A 5CXCB 3IJ1A 2OVPB 4J77A 3AH8B 2PM9A 1MG3A 5EM2B 4FA4D 3MZLA 5I5IA 3OTTA 3CFVA 3F3GA 1ERJA 2B5NA 5HE0B 3ULEC 4D6VA 3SCYA 1JMXB 2YB8B 3VH0A 4Y5RD 4QRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K26 A;  2J55 H;  4J73 A;  1JOF A;  5TDH B;  3SBP A;  3UVN A;  3JZG A;  3RFH A;  3IKO A;  4ZOX A;  1S4U X;  1YFQ A;  3JRP A;  3N0E A;  5EAP A;  4CC9 A;  1RI6 A;  4K3J B;  4XYI A;  5CYK A;  3EI1 A;  3C9C A;  4H5J A;  5EMJ B;  1XKS A;  5TEF A;  1B9Y A;  2B5M A;  4JSV C;  1N6D A;  4PC0 A;  1B9X A;  4JSP C;  3SJL D;  1SQ9 A;  2OJY A;  3AL8 A;  3PXT D;  4PBY A;  2AGW A;  4A08 A;  4CZX A;  3OKW A;  5HQG A;  3NVN A;  5SXM A;  2I3S A;  2CE9 A;  2H3X A;  5IJ8 E;  2H9M A;  3SWS D;  3AL9 A;  1U2V C;  4XEI C;  3RMZ D;  4A11 A;  3RSE C;  4LG9 A;  1L0Q A;  3L4O D;  2QXV A;  3I7H A;  4GQB B;  3JB9 L;  5TF2 A;  3KRW B;  3JPX A;  2QC5 A;  2OVR B;  4H5I A;  4AEZ A;  1XIP A;  2Z2P A;  5KDO B;  2H9P A;  5FLX g;  4CZV A;  3EI4 A;  4JD2 C;  3ZWL B;  1PBY B;  5IJ7 E;  3UR4 A;  5EAM A;  1MG2 A;  2OK6 A;  4CI8 A;  5HYN B;  5HE2 B;  2YNO A;  2P9I C;  3DXM C;  2J57 G;  5I5J A;  4J8G A;  3F3P A;  1PGU A;  5GMK n;  4CY1 A;  3OKY B;  5HE3 B;  3J81 g;  2H9N A;  4OZU A;  4GGC A;  3SVW D;  3BG0 A;  4JSN C;  4ERQ A;  2MTA H;  3I8C A;  4GM3 A;  4PBZ A;  3EI1 B;  4CZY A;  2P9S C;  3KRX B;  2CO0 C;  3DXK C;  4O3T B;  4JSX C;  4GQ2 P;  2AGX A;  4FAN D;  4GGA A;  4FAV D;  4E5Z A;  5GXH A;  4GGD A;  3GFC A;  3I7P A;  1OMW B;  3RN0 D;  1TYQ C;  4E5Z B;  4J0W A;  3MKQ A;  2H47 A;  3AL8 B;  2I0T A;  2YNP A;  4O45 A;  5AMS A;  5GSA A;  2XL3 A;  5EAR A;  4L3H D;  5THA A;  2H13 A;  1JMZ B;  4ERY A;  5CYK B;  3SXT D;  3NVX A;  4J82 A;  2AH0 A;  3C5M A;  3FGB A;  2CN3 A;  3IIW A;  1K8K C;  2H9L A;  1GG2 B;  4LG8 A;  3JZH A;  1U4C A;  4BH6 A;  5CXB B;  4CY3 A;  3I7L A;  3UKU C;  4O1Q D;  4U1E I;  4X61 B;  2CE8 A;  1NR0 A;  2B5L A;  3SFZ A;  2BCJ B;  5A2Q g;  3PXW D;  3SHF A;  3EI4 B;  3FM0 A;  3EI3 B;  2XL2 A;  3MKS B;  4J79 A;  3SBR A;  2PBI B;  2BBK H;  3JRO A;  4PSW B;  5FA5 B;  5HE1 B;  5FKR A;  3UVM A;  5JWZ A;  3SLE D;  3NVQ A;  3L4M D;  3I2N A;  5CXB A;  2P9U C;  4CI2 A;  4BUJ C;  4O9D A;  2HJ4 A;  3OL2 B;  2XYI A;  4QT8 A;  2GC4 A;  2HKR A;  2P9N C;  5EML B;  4IMM A;  3K27 A;  2G9A A;  5GXI A;  3RN1 D;  4CI1 A;  4CI3 A;  2GC7 A;  4HDJ A;  4JT6 C;  2AGZ A;  3IJC A;  4L9O A;  3I8E A;  4XYH A;  3V7D B;  4A0B B;  4A0A A;  2AGY A;  3RLM D;  3E0C A;  2OIZ A;  4ZOV A;  2P9K C;  1OLZ A;  3F3F A;  4X3E A;  3B7F A;  4PXW A;  2OK4 A;  3N0D A;  3ORV D;  2I0S A;  4PNK B;  1SQJ A;  5C2V B;  4A09 A;  1N6F A;  3RRM C;  3U4Y A;  4A2L A;  4MK0 B;  4FWW A;  3PSL A;  2CO0 A;  3GRE A;  3V5W B;  2AGL A;  1R5M A;  1VYH C;  4Y7R A;  5H17 A;  1P22 A;  3I7N A;  3P4F A;  4A11 B;  3BWS A;  2Z2O A;  3V9F A;  4IA9 A;  2CN2 A;  2YBA A;  1N6E A;  3PVW B;  2HXC A;  2W18 A;  5FXY A;  4FB1 D;  3RFG A;  1Q47 A;  2Z2N A;  1PEV A;  4CY5 A;  2IWK A;  4FHL A;  2P9L C;  4A0A B;  4A0B A;  3SN6 B;  2O9K A;  4A08 B;  3OKY A;  3IIY A;  5K19 A;  2Q7Q A;  3DM0 A;  2PM9 B;  2AQ5 A;  2HES X;  5B4W A;  4A09 B;  5AFU 3;  4J8B A;  1QNI A;  1NEX B;  3SBQ A;  2IUP A;  2B4E A;  4J87 A;  3HFQ A;  4BL0 A;  5H1M A;  4X63 B;  3OL2 A;  3IJ0 A;  4N14 A;  3DSM A;  1SHY B;  1XHM A;  4GZ8 A;  2YMU A;  2IUQ A;  4G56 B;  5C2W B;  3MXX A;  2H6Q A;  4JT5 C;  1PI6 A;  4ESG A;  2I0R A;  4ZN4 A;  4Z8L A;  2I3T A;  4GM8 A;  5EM2 A;  4AOW A;  4I79 A;  3EI3 A;  4FA1 D;  4E54 A;  3UKR C;  5EAL A;  4A2M A;  2HKM A;  4J86 A;  3I7O A;  2J56 H;  2H6K A;  3W15 A;  5K1C C;  4KFM B;  3SMR A;  5EMK B;  3BG1 A;  4ZOY A;  2HJB A;  4FA5 D;  3OKT A;  5IT9 g;  3VA6 A;  3A0F A;  2IUR A;  1A0R B;  5C9Z B;  3MMY A;  2IUV A;  4E54 B;  3OW8 A;  5FKS A;  5H14 A;  3JZN A;  5FQD A;  3PXS D;  2P9P C;  2EBS A;  4QQE A;  3EMH A;  2HYE A;  2OVQ B;  3DWL C;  1TBG A;  2UZY B;  3CFS B;  4U7A A;  4FA9 D;  3UVO A;  3EG6 A;  4J81 A;  2G99 A;  4OWR A;  3I89 A;  2GNQ A;  4UI9 R;  2AH1 A;  2PM6 B;  5FKT A;  1K32 A;  2UZX B;  5I5M A;  3UVL A;  4X60 B;  4EWR A;  4GM9 A;  3I7K A;  5FKQ A;  4PSX B;  5IC7 A;  3EI2 B;  2PM7 B;  4GMB A;  5CXC A;  3MZK A;  3PE7 A;  2CNX A;  1MDA H;  4L3G D;  4ES0 A;  1GOT B;  2YNN A;  3FRX A;  4D0K A;  3UVK A;  1GP2 B;  2IWF A;  1JJU B;  5AJA A;  4J84 A;  4NSX A;  4LGN A;  4A7J A;  4L1Q D;  5TEE A;  3J80 g;  4R7A B;  2XU7 A;  3C75 H;  2IAA A;  3CIK B;  1FWX A;  4GQ1 A;  4K3I D;  3EI2 A;  3AFC A;  3ODT A;  5IGO A;  3C99 A;  4CY2 A;  3PSC B;  4YVD A;  5EMM B;  3EWE A;  3PVU B;  4QL1 A;  4JXM A;  4ERZ A;  4TZ4 A;  3VGZ A;  2TRC B;  2H6N A;  2H68 A;  4ZOZ A;  4O3U B;  5IGQ A;  4J78 A;  3JAM g;  1GXR A;  3EU7 A;  4J0X A;  2H14 A;  5CXC B;  3IJ1 A;  2OVP B;  4J77 A;  3AH8 B;  2PM9 A;  1MG3 A;  5EM2 B;  4FA4 D;  3MZL A;  5I5I A;  3OTT A;  3CFV A;  3F3G A;  1ERJ A;  2B5N A;  5HE0 B;  3ULE C;  4D6V A;  3SCY A;  1JMX B;  2YB8 B;  3VH0 A;  4Y5R D;  4QRJ A; 
#chains in the Genus database with same CATH topology
 4AN0 A;  2JKX A;  3K26 A;  2J55 H;  4J73 A;  1JOF A;  5TDH B;  3SBP A;  3UVN A;  3JZG A;  3RFH A;  3K71 A;  5FFO A;  2HU7 A;  3IKO A;  4ZOX A;  4WK0 A;  1S4U X;  3VI3 A;  1YFQ A;  3JRP A;  3N0E A;  5EAP A;  4CC9 A;  1RI6 A;  2XZG A;  4K3J B;  4XYI A;  5CYK A;  4MMY A;  5FFG A;  3EI1 A;  3C9C A;  4H5J A;  5EMJ B;  1XKS A;  2VDM A;  1H2Z A;  5TEF A;  1B9Y A;  2B5M A;  3QHY B;  4AN1 A;  3IUL A;  4JSV C;  1N6D A;  4PC0 A;  1B9X A;  4IRZ A;  4JSP C;  3SJL D;  1SQ9 A;  2OJY A;  3AL8 A;  3PXT D;  4PBY A;  4BCB A;  2AGW A;  1UOO A;  4A08 A;  4CZX A;  3OKW A;  5HQG A;  3V4V A;  1UOP A;  3NVN A;  5SXM A;  2I3S A;  4BCC A;  2CE9 A;  2H3X A;  5IJ8 E;  2H9M A;  3SWS D;  1K3I A;  3AL9 A;  1U2V C;  5E6U A;  4XEI C;  3RMZ D;  4A11 A;  5C86 A;  3RSE C;  4LG9 A;  1L0Q A;  3L4O D;  2QXV A;  3I7H A;  4GQB B;  3KCI A;  3FCS A;  3O4J A;  4G55 A;  5E6R A;  3JB9 L;  5TF2 A;  3KRW B;  3NIF A;  3JPX A;  2QC5 A;  2OVR B;  4H5I A;  3EQ9 A;  4AEZ A;  1XIP A;  2VDK A;  2Z2P A;  5KDO B;  2VZ1 A;  2H9P A;  5FLX g;  4G1M A;  4CZV A;  3EI4 A;  4JD2 C;  4O02 A;  1PBY B;  3ZWL B;  5IJ7 E;  1UTC A;  3UR4 A;  1U8C A;  5EAM A;  1MG2 A;  2OK6 A;  4CI8 A;  2QR5 A;  5HYN B;  5HE2 B;  2YNO A;  2P9I C;  3DXM C;  2J57 G;  5I5J A;  4J8G A;  3F3P A;  1PGU A;  5GMK n;  3ZE0 A;  4CY1 A;  4UM8 A;  3OKY B;  5HE3 B;  4BP8 A;  3J81 g;  2H9N A;  4OZU A;  4GGC A;  3K6S A;  3SVW D;  1O6F A;  3BG0 A;  4JSN C;  4ERQ A;  4DNW A;  2MTA H;  3I8C A;  4GM3 A;  4PBZ A;  3EI1 B;  3NID A;  4CZY A;  2P9S C;  3KRX B;  2CO0 C;  3DXK C;  4O3T B;  4JSX C;  4GQ2 P;  2AGX A;  2QZP A;  4FAN D;  4GGA A;  4FAV D;  3OF7 A;  2VZ3 A;  4E5Z A;  5GXH A;  1JTD B;  3GFC A;  4GGD A;  3I7P A;  1OMW B;  3RN0 D;  1TYQ C;  4E5Z B;  2XDW A;  4J0W A;  3MKQ A;  2H47 A;  3AL8 B;  2I0T A;  4DNU A;  2YNP A;  4O45 A;  5AMS A;  5GSA A;  2XL3 A;  5EAR A;  4RE6 A;  4L3H D;  5THA A;  2H13 A;  1JMZ B;  4Z7N A;  1I2M B;  5C92 A;  4ERY A;  5CYK B;  3SXT D;  4NC4 A;  3NVX A;  4J82 A;  2AH0 A;  3C5M A;  3FGB A;  2CN3 A;  3IIW A;  3MUO A;  1K8K C;  1GG2 B;  2H9L A;  4LG8 A;  3JZH A;  1U4C A;  4BH6 A;  5CXB B;  3IUM A;  4CY3 A;  3I7L A;  3UKU C;  4O1Q D;  4U1E I;  4X61 B;  2CE8 A;  1NR0 A;  2B5L A;  3SFZ A;  2BCJ B;  5A2Q g;  3PXW D;  3SHF A;  3EI4 B;  3FM0 A;  3EI3 B;  2XL2 A;  3MKS B;  4J79 A;  3SBR A;  2PBI B;  2BBK H;  3JRO A;  1O6G A;  1E5T A;  4DNV A;  4PSW B;  5FA5 B;  5HE1 B;  5FKR A;  3UVM A;  5JWZ A;  3SLE D;  3NVQ A;  3L4M D;  3I2N A;  2P9U C;  5CXB A;  4CI2 A;  4BUJ C;  4O9D A;  2HJ4 A;  3OL2 B;  1T2X A;  2XYI A;  4QT8 A;  2GC4 A;  2HKR A;  2P9N C;  5EML B;  4IMM A;  3K27 A;  5HDB A;  2G9A A;  5GXI A;  3RN1 D;  4CI1 A;  5M61 A;  4CI3 A;  1VZ2 A;  2GC7 A;  4HDJ A;  4O2W A;  4NBM A;  4JT6 C;  2AGZ A;  3IJC A;  4L9O A;  2EIC A;  3I8E A;  4XYH A;  3V7D B;  5E6S A;  4A0B B;  4A0A A;  2AGY A;  3RLM D;  2VDO A;  3E0C A;  2OIZ A;  3VI4 A;  2EID A;  4Z7O A;  4ZOV A;  2P9K C;  1OLZ A;  3F3F A;  3T3M A;  2VC2 A;  4X3E A;  3B7F A;  4PXW A;  2OK4 A;  3ORV D;  3N0D A;  2I0S A;  2BKL A;  4PNK B;  1SQJ A;  5C2V B;  4A09 A;  1N6F A;  4MMZ A;  3RRM C;  3U4Y A;  4A2L A;  4MK0 B;  4FWW A;  3PSL A;  4JHN A;  2CO0 A;  3GRE A;  3V5W B;  2AGL A;  1R5M A;  3IJE A;  1VYH C;  4Y7R A;  5H17 A;  1P22 A;  3I7N A;  1BPO A;  3EQ8 A;  3P4F A;  3IUQ A;  4A11 B;  3BWS A;  2Z2O A;  3V9F A;  4AMZ A;  3GC3 B;  4IA9 A;  1GOH A;  2CN2 A;  2YBA A;  1N6E A;  2XE4 A;  3PVW B;  2HXC A;  2W18 A;  5FXY A;  4FB1 D;  3RFG A;  1Q47 A;  2Z2N A;  1PEV A;  3K72 A;  4CY5 A;  2IWK A;  4FHL A;  2P9L C;  4A0A B;  4A0B A;  1QFM A;  3FCU A;  3SN6 B;  2O9K A;  4A08 B;  3OKY A;  4NEN A;  3IIY A;  5K19 A;  2Q7Q A;  3DM0 A;  2PM9 B;  2VDP A;  2AQ5 A;  3O4H A;  2HES X;  5B4W A;  4A09 B;  5AFU 3;  4J8B A;  1QNI A;  1NEX B;  3SBQ A;  1VE7 A;  2IUP A;  2WQ8 A;  2B4E A;  4J87 A;  3HFQ A;  4BL0 A;  5H1M A;  4X63 B;  3OL2 A;  3IJ0 A;  4N14 A;  3O4G A;  3DSM A;  1SHY B;  3V4P A;  1XHM A;  4GZ8 A;  2YMU A;  2IUQ A;  4G56 B;  1GOF A;  5C2W B;  3MXX A;  2H6Q A;  4JT5 C;  1PI6 A;  4ESG A;  2I0R A;  4ZN4 A;  4Z8L A;  2I3T A;  4GM8 A;  5EM2 A;  4AOW A;  4I79 A;  3EI3 A;  4Z7Q A;  4FA1 D;  4E54 A;  1A12 A;  3UKR C;  5EAL A;  4A2M A;  1L5G A;  4WK4 A;  2HKM A;  4J86 A;  3I7O A;  4L1M A;  2J56 H;  2H6K A;  3EQ7 A;  2HU5 A;  5K1C C;  3W15 A;  4RE5 A;  5M5R A;  4KFM B;  3SMR A;  5EMK B;  3ZDY A;  3BG1 A;  4ZOY A;  2HJB A;  3ZDZ A;  4FA5 D;  3ZDX A;  3OKT A;  5IT9 g;  3VA6 A;  2EIE A;  3QI0 A;  3A0F A;  2IUR A;  1A0R B;  1UOQ A;  5C9Z B;  3MMY A;  2IUV A;  4E54 B;  3MVD K;  3OW8 A;  5FKS A;  5H14 A;  3JZN A;  4NAA A;  5M5V A;  5FQD A;  3PXS D;  3IVM A;  2P9P C;  3ZE1 A;  4D9S A;  2EBS A;  4QQE A;  1VE6 A;  3EMH A;  4WK2 A;  2OVQ B;  2HYE A;  3DWL C;  1TBG A;  2UZY B;  3CFS B;  4U7A A;  4FA9 D;  3UVO A;  5M5U A;  1E8M A;  3EG6 A;  4J81 A;  2G99 A;  4G1E A;  3O4I A;  4OWR A;  3I89 A;  4UM9 A;  2GNQ A;  2VDL A;  4UI9 R;  2AH1 A;  2PM6 B;  5FKT A;  1K32 A;  2UZX B;  5I5M A;  5M5T A;  3UVL A;  4X60 B;  4EWR A;  4GM9 A;  3I7K A;  5FKQ A;  4PSX B;  5IC7 A;  3EI2 B;  3MUN A;  2PM7 B;  4GMB A;  1C9I A;  5CXC A;  3MZK A;  3PE7 A;  1YR2 A;  2CNX A;  1C9L A;  4JHP C;  1H2Y A;  1MDA H;  4L3G D;  4ES0 A;  1H2W A;  1GOT B;  2YNN A;  3FRX A;  4MMX A;  4D0K A;  3UVK A;  1GP2 B;  2IWF A;  4AX4 A;  1JJU B;  5AJA A;  4J84 A;  4AMY A;  4NSX A;  2VDR A;  4LGN A;  4A7J A;  4L1Q D;  5TEE A;  3J80 g;  4R7A B;  1E8N A;  2XU7 A;  3C75 H;  2IAA A;  3CIK B;  1FWX A;  4GQ1 A;  5M5S A;  2VDN A;  3T3P A;  4K3I D;  3EI2 A;  3AFC A;  1JV2 A;  4BP9 A;  3ODT A;  1VZ3 A;  3NIG A;  3GD1 I;  5IGO A;  3C99 A;  4CY2 A;  3PSC B;  4YVD A;  5EMM B;  2EIB A;  3DDU A;  3EWE A;  3PVU B;  4QL1 A;  1TYE A;  4JXM A;  1H2X A;  2VDQ A;  4BCD A;  1QFS A;  4ERZ A;  4TZ4 A;  3VGZ A;  2TRC B;  2H6N A;  2H68 A;  4ZOZ A;  4O3U B;  5IGQ A;  4J78 A;  3JAM g;  1GXR A;  3EU7 A;  4J0X A;  2H14 A;  2HU8 A;  3IJ1 A;  3IUJ A;  5CXC B;  3IUN A;  2OVP B;  3IUR A;  4J77 A;  3AH8 B;  2PM9 A;  1MG3 A;  5EM2 B;  4FA4 D;  3MZL A;  4WJK A;  5I5I A;  3OTT A;  3CFV A;  4QAM A;  3F3G A;  1ERJ A;  2B5N A;  5HE0 B;  3ULE C;  4D6V A;  1GOG A;  3SCY A;  1JMX B;  2YB8 B;  1M1X A;  3VH0 A;  4Y5R D;  3ZE2 A;  4QRJ A; 
#chains in the Genus database with same CATH homology
 3K26 A;  2J55 H;  4J73 A;  1JOF A;  5TDH B;  3SBP A;  3UVN A;  3JZG A;  3RFH A;  3IKO A;  4ZOX A;  1S4U X;  1YFQ A;  3JRP A;  3N0E A;  5EAP A;  4CC9 A;  1RI6 A;  4K3J B;  4XYI A;  5CYK A;  3EI1 A;  3C9C A;  4H5J A;  5EMJ B;  1XKS A;  5TEF A;  1B9Y A;  2B5M A;  4JSV C;  1N6D A;  4PC0 A;  1B9X A;  4JSP C;  3SJL D;  1SQ9 A;  2OJY A;  3AL8 A;  3PXT D;  4PBY A;  2AGW A;  4A08 A;  4CZX A;  3OKW A;  5HQG A;  3NVN A;  5SXM A;  2I3S A;  2CE9 A;  2H3X A;  5IJ8 E;  2H9M A;  3SWS D;  3AL9 A;  1U2V C;  4XEI C;  3RMZ D;  4A11 A;  3RSE C;  4LG9 A;  1L0Q A;  3L4O D;  2QXV A;  3I7H A;  4GQB B;  3JB9 L;  5TF2 A;  3KRW B;  3JPX A;  2QC5 A;  2OVR B;  4H5I A;  4AEZ A;  1XIP A;  2Z2P A;  5KDO B;  2H9P A;  5FLX g;  4CZV A;  3EI4 A;  4JD2 C;  3ZWL B;  1PBY B;  5IJ7 E;  3UR4 A;  5EAM A;  1MG2 A;  2OK6 A;  4CI8 A;  5HYN B;  5HE2 B;  2YNO A;  2P9I C;  3DXM C;  2J57 G;  5I5J A;  4J8G A;  3F3P A;  1PGU A;  5GMK n;  4CY1 A;  3OKY B;  5HE3 B;  3J81 g;  2H9N A;  4OZU A;  4GGC A;  3SVW D;  3BG0 A;  4JSN C;  4ERQ A;  2MTA H;  3I8C A;  4GM3 A;  4PBZ A;  3EI1 B;  4CZY A;  2P9S C;  3KRX B;  2CO0 C;  3DXK C;  4O3T B;  4JSX C;  4GQ2 P;  2AGX A;  4FAN D;  4GGA A;  4FAV D;  4E5Z A;  5GXH A;  4GGD A;  3GFC A;  3I7P A;  1OMW B;  3RN0 D;  1TYQ C;  4E5Z B;  4J0W A;  3MKQ A;  2H47 A;  3AL8 B;  2I0T A;  2YNP A;  4O45 A;  5AMS A;  5GSA A;  2XL3 A;  5EAR A;  4L3H D;  5THA A;  2H13 A;  1JMZ B;  4ERY A;  5CYK B;  3SXT D;  3NVX A;  4J82 A;  2AH0 A;  3C5M A;  3FGB A;  2CN3 A;  3IIW A;  1K8K C;  2H9L A;  1GG2 B;  4LG8 A;  3JZH A;  1U4C A;  4BH6 A;  5CXB B;  4CY3 A;  3I7L A;  3UKU C;  4O1Q D;  4U1E I;  4X61 B;  2CE8 A;  1NR0 A;  2B5L A;  3SFZ A;  2BCJ B;  5A2Q g;  3PXW D;  3SHF A;  3EI4 B;  3FM0 A;  3EI3 B;  2XL2 A;  3MKS B;  4J79 A;  3SBR A;  2PBI B;  2BBK H;  3JRO A;  4PSW B;  5FA5 B;  5HE1 B;  5FKR A;  3UVM A;  5JWZ A;  3SLE D;  3NVQ A;  3L4M D;  3I2N A;  5CXB A;  2P9U C;  4CI2 A;  4BUJ C;  4O9D A;  2HJ4 A;  3OL2 B;  2XYI A;  4QT8 A;  2GC4 A;  2HKR A;  2P9N C;  5EML B;  4IMM A;  3K27 A;  2G9A A;  5GXI A;  3RN1 D;  4CI1 A;  4CI3 A;  2GC7 A;  4HDJ A;  4JT6 C;  2AGZ A;  3IJC A;  4L9O A;  3I8E A;  4XYH A;  3V7D B;  4A0B B;  4A0A A;  2AGY A;  3RLM D;  3E0C A;  2OIZ A;  4ZOV A;  2P9K C;  1OLZ A;  3F3F A;  4X3E A;  3B7F A;  4PXW A;  2OK4 A;  3N0D A;  3ORV D;  2I0S A;  4PNK B;  1SQJ A;  5C2V B;  4A09 A;  1N6F A;  3RRM C;  3U4Y A;  4A2L A;  4MK0 B;  4FWW A;  3PSL A;  2CO0 A;  3GRE A;  3V5W B;  2AGL A;  1R5M A;  1VYH C;  4Y7R A;  5H17 A;  1P22 A;  3I7N A;  3P4F A;  4A11 B;  3BWS A;  2Z2O A;  3V9F A;  4IA9 A;  2CN2 A;  2YBA A;  1N6E A;  3PVW B;  2HXC A;  2W18 A;  5FXY A;  4FB1 D;  3RFG A;  1Q47 A;  2Z2N A;  1PEV A;  4CY5 A;  2IWK A;  4FHL A;  2P9L C;  4A0A B;  4A0B A;  3SN6 B;  2O9K A;  4A08 B;  3OKY A;  3IIY A;  5K19 A;  2Q7Q A;  3DM0 A;  2PM9 B;  2AQ5 A;  2HES X;  5B4W A;  4A09 B;  5AFU 3;  4J8B A;  1QNI A;  1NEX B;  3SBQ A;  2IUP A;  2B4E A;  4J87 A;  3HFQ A;  4BL0 A;  5H1M A;  4X63 B;  3OL2 A;  3IJ0 A;  4N14 A;  3DSM A;  1SHY B;  1XHM A;  4GZ8 A;  2YMU A;  2IUQ A;  4G56 B;  5C2W B;  3MXX A;  2H6Q A;  4JT5 C;  1PI6 A;  4ESG A;  2I0R A;  4ZN4 A;  4Z8L A;  2I3T A;  4GM8 A;  5EM2 A;  4AOW A;  4I79 A;  3EI3 A;  4FA1 D;  4E54 A;  3UKR C;  5EAL A;  4A2M A;  2HKM A;  4J86 A;  3I7O A;  2J56 H;  2H6K A;  3W15 A;  5K1C C;  4KFM B;  3SMR A;  5EMK B;  3BG1 A;  4ZOY A;  2HJB A;  4FA5 D;  3OKT A;  5IT9 g;  3VA6 A;  3A0F A;  2IUR A;  1A0R B;  5C9Z B;  3MMY A;  2IUV A;  4E54 B;  3OW8 A;  5FKS A;  5H14 A;  3JZN A;  5FQD A;  3PXS D;  2P9P C;  2EBS A;  4QQE A;  3EMH A;  2HYE A;  2OVQ B;  3DWL C;  1TBG A;  2UZY B;  3CFS B;  4U7A A;  4FA9 D;  3UVO A;  3EG6 A;  4J81 A;  2G99 A;  4OWR A;  3I89 A;  2GNQ A;  4UI9 R;  2AH1 A;  2PM6 B;  5FKT A;  1K32 A;  2UZX B;  5I5M A;  3UVL A;  4X60 B;  4EWR A;  4GM9 A;  3I7K A;  5FKQ A;  4PSX B;  5IC7 A;  3EI2 B;  2PM7 B;  4GMB A;  5CXC A;  3MZK A;  3PE7 A;  2CNX A;  1MDA H;  4L3G D;  4ES0 A;  1GOT B;  2YNN A;  3FRX A;  4D0K A;  3UVK A;  1GP2 B;  2IWF A;  1JJU B;  5AJA A;  4J84 A;  4NSX A;  4LGN A;  4A7J A;  4L1Q D;  5TEE A;  3J80 g;  4R7A B;  2XU7 A;  3C75 H;  2IAA A;  3CIK B;  1FWX A;  4GQ1 A;  4K3I D;  3EI2 A;  3AFC A;  3ODT A;  5IGO A;  3C99 A;  4CY2 A;  3PSC B;  4YVD A;  5EMM B;  3EWE A;  3PVU B;  4QL1 A;  4JXM A;  4ERZ A;  4TZ4 A;  3VGZ A;  2TRC B;  2H6N A;  2H68 A;  4ZOZ A;  4O3U B;  5IGQ A;  4J78 A;  3JAM g;  1GXR A;  3EU7 A;  4J0X A;  2H14 A;  5CXC B;  3IJ1 A;  2OVP B;  4J77 A;  3AH8 B;  2PM9 A;  1MG3 A;  5EM2 B;  4FA4 D;  3MZL A;  5I5I A;  3OTT A;  3CFV A;  3F3G A;  1ERJ A;  2B5N A;  5HE0 B;  3ULE C;  4D6V A;  3SCY A;  1JMX B;  2YB8 B;  3VH0 A;  4Y5R D;  4QRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...