4J79A

Crystal structure of beta'-cop/pedvspike complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 87
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j79A01
2PM9A 2YNOA 4ZOZA 2H9LA 2H6KA 5EMMB 2YNNA 3DXMC 3JZGA 3EMHA 4HDJA 4Y5RD 3SBQA 2P9PC 3OW8A 3F3FA 5A2Qg 4L3GD 4FA4D 5EAPA 4JSVC 2I3SA 3C75H 4GQ1A 3N0EA 2B5MA 3C99A 3FM0A 4JT5C 4GGAA 3VA6A 4BL0A 3I89A 4X60B 3FGBA 1JOFA 3EG6A 3V7DB 1SQ9A 4O3UB 3OKYB 4QRJA 1NEXB 2H9NA 2XL2A 3B7FA 4O1QD 3UKRC 3OKYA 2AGWA 3MMYA 2IWKA 5I5IA 3L4OD 5TEEA 4FAVD 4LG8A 2PM6B 5IT9g 3PVUB 5CXCB 3HFQA 1XKSA 5CXCA 5B4WA 1B9XA 3AFCA 3FRXA 2OIZA 3KRWB 5TF2A 4MK0B 4E5ZB 4E5ZA 4FHLA 5I5JA 2P9SC 5HE1B 5IC7A 2AGXA 4UI9R 5EMLB 4CI2A 3IKOA 4J8BA 4J0WA 4GGDA 3PE7A 2H9PA 3C9CA 2OVQB 1PGUA 3K27A 4J82A 4YVDA 1OLZA 5GXIA 3MKSB 2HKMA 2OVRB 3KRXB 4ES0A 3RSEC 3NVQA 4Y7RA 4ZOVA 5FLXg 4GZ8A 1Q47A 4AOWA 1MG3A 4PBZA 4O45A 4CY1A 3SFZA 3IIYA 3IJ1A 5AJAA 4K3JB 5FKTA 4FB1D 5FXYA 5EMJB 2CN3A 4A7JA 4L1QD 5HYNB 3DM0A 4ZN4A 3MXXA 3F3GA 3UVOA 4D6VA 5KDOB 3I7OA 3PXSD 5K19A 2YB8B 3K26A 4A09B 2AH0A 1TYQC 1S4UX 3AL9A 2UZXB 3SBPA 3EU7A 4A0BB 4A0BA 2H13A 5H17A 1OMWB 3PSCB 2G9AA 3EI3B 4J0XA 3EI3A 3AL8B 3U4YA 3AL8A 3V9FA 3P4FA 2Z2NA 5AMSA 4CZVA 3BG1A 2AGYA 2CN2A 4G56B 2AH1A 4AEZA 3IJ0A 5EM2B 2P9KC 5TDHB 5GSAA 1K32A 5EM2A 4CI3A 2I0RA 4PC0A 1VYHC 3N0DA 3SBRA 2AGLA 3L4MD 4O9DA 3RRMC 3IIWA 3RFHA 5FKSA 2Z2PA 3ODTA 4KFMB 3UVNA 4IMMA 4GGCA 1N6DA 1B9YA 3JPXA 3A0FA 4Z8LA 3SHFA 5TEFA 3UVKA 3JB9L 2I3TA 1A0RB 3RLMD 3SCYA 4ERYA 5H1MA 5CYKB 1U4CA 2YNPA 3OKWA 4J8GA 5CYKA 5IJ7E 4BH6A 4I79A 1SHYB 3W15A 2GNQA 2IUQA 4J79A 4L3HD 4OWRA 4OZUA 4JT6C 4GM8A 2H3XA 2J56H 4A2MA 3C5MA 5GXHA 3EWEA 2YMUA 1NR0A 3SJLD 2BCJB 4QT8A 3PXTD 1GOTB 1N6FA 4O3TB 1QNIA 3PXWD 3OTTA 4CY5A 5C9ZB 2OK6A 5K1CC 2IAAA 4JXMA 3SMRA 3UR4A 1YFQA 2TRCB 4CZXA 2IWFA 5CXBB 5CXBA 3I2NA 1MDAH 2OK4A 3JAMg 4U1EI 5IGOA 5EARA 3VH0A 4JSPC 2MTAH 2CNXA 2I0TA 2W18A 4PBYA 1K8KC 2B5LA 4CC9A 3JZHA 1L0QA 4ESGA 4J77A 2CO0C 5SXMA 3UKUC 5H14A 4A11B 1PEVA 2OVPB 4JD2C 2GC4A 4ERQA 4A11A 4EWRA 1XHMA 1PBYB 2J55H 4CI1A 2IUVA 4PNKB 4A0AB 2B5NA 4A09A 1ERJA 3J80g 4GQBB 4A0AA 4QQEA 4FA5D 1RI6A 2B4EA 5GMKn 2H68A 4E54B 1P22A 4IA9A 1SQJA 2HESX 2EBSA 2UZYB 2Z2OA 2H6NA 2CE9A 1XIPA 3MZKA 2P9LC 3RFGA 3GREA 3ZWLB 4PSXB 3OKTA 5FKQA 2CO0A 4A2LA 3AH8B 4R7AB 3V5WB 5THAA 5FKRA 5C2WB 4U7AA 2IURA 4GM9A 4GQ2P 2P9UC 4J84A 3SWSD 3PVWB 3UVMA 3J81g 3VGZA 5C2VB 4ERZA 4D0KA 1FWXA 2IUPA 3E0CA 5IGQA 4N14A 5FA5B 3DWLC 3NVNA 3MZLA 4LGNA 1GXRA 2CE8A 5I5MA 3I8CA 1U2VC 1N6EA 2XL3A 2QC5A 4TZ4A 4J78A 4J73A 5JWZA 4FAND 3PSLA 2QXVA 3I7KA 4A08B 4A08A 3SXTD 3I7LA 2J57G 4L9OA 4LG9A 4BUJC 3EI1B 4X3EA 4K3ID 4NSXA 1JJUB 2OJYA 3SN6B 3EI1A 2HJ4A 5FQDA 3F3PA 5HE0B 3OL2B 2PM7B 1TBGA 2AQ5A 2HJBA 3OL2A 4J87A 2P9NC 4H5JA 1PI6A 2YBAA 5IJ8E 3IJCA 4PSWB 2I0SA 5HE2B 3RN1D 3EI4B 4X63B 2P9IC 5EMKB 3EI4A 4PXWA 5HE3B 2PBIB 2H9MA 3BG0A 4CI8A 3RMZD 2XU7A 2G99A 2AGZA 5EALA 3DXKC 3I7HA 4XEIC 2HYEA 3JRPA 3ORVD 4X61B 4XYHA 2H14A 3CFVA 3I8EA 2HXCA 4J81A 3EI2B 3MKQA 3JZNA 3JROA 3EI2A 4CY2A 1GG2B 5HQGA 4XYIA 1MG2A 3SLED 4JSNC 1JMXB 4JSXC 2O9KA 3GFCA 5AFU3 3NVXA 3BWSA 4FA1D 1R5MA 2BBKH 4FWWA 4GMBA 1JMZB 4E54A 2H47A 3I7PA 3SVWD 2HKRA 1GP2B 3CIKB 3RN0D 4GM3A 5EAMA 3I7NA 4CY3A 3ULEC 2GC7A 3DSMA 2H6QA 4QL1A 2Q7QA 3CFSB 4ZOXA 4J86A 3UVLA 4CZYA 4FA9D 2PM9B 2XYIA 4H5IA 4ZOYA
chains in the Genus database with same CATH superfamily
2PM9A 2YNOA 4ZOZA 2H9LA 2H6KA 4WK4A 5EMMB 2YNNA 3DXMC 3K71A 3JZGA 3EMHA 4HDJA 1U8CA 4Y5RD 3SBQA 2P9PC 3OW8A 3F3FA 5A2Qg 4L3GD 4FA4D 1E8MA 5EAPA 3EQ8A 4JSVC 2I3SA 3C75H 4GQ1A 3N0EA 2B5MA 3C99A 3FM0A 5M5RA 4JT5C 4GGAA 3VA6A 4BL0A 3I89A 2EIEA 4NENA 3FGBA 4X60B 3ZE0A 3MVDK 1JOFA 3EG6A 3V7DB 4MMYA 1SQ9A 4O3UB 2BKLA 3OKYB 4QRJA 1NEXB 2H9NA 2XL2A 3B7FA 4O1QD 3UKRC 5E6UA 3OKYA 2AGWA 3MMYA 2IWKA 5I5IA 3L4OD 5TEEA 4NAAA 4FAVD 4LG8A 2PM6B 5IT9g 3PVUB 5CXCB 3IUMA 3HFQA 1XKSA 5CXCA 5B4WA 1B9XA 3AFCA 3FRXA 3IURA 2OIZA 2VDMA 2VC2A 3KRWB 5M61A 5TF2A 4MK0B 1H2XA 4JHNA 4E5ZB 4E5ZA 4FHLA 5I5JA 2P9SC 3MUOA 5HE1B 4BCBA 1QFSA 2AGXA 5IC7A 1UOQA 4UI9R 4G1MA 5EMLB 4BP8A 4CI2A 3IKOA 4J8BA 4NBMA 4J0WA 4O2WA 3ZDZA 4GGDA 3PE7A 2H9PA 3C9CA 2OVQB 1PGUA 5E6SA 3K27A 4J82A 4YVDA 1OLZA 3DDUA 5GXIA 3MKSB 2HKMA 2OVRB 3KRXB 4ES0A 3RSEC 3NVQA 4Y7RA 4ZOVA 5FLXg 5M5VA 4GZ8A 1Q47A 4AOWA 1MG3A 4PBZA 3NIDA 4O45A 4CY1A 3SFZA 3IIYA 3OF7A 3IJ1A 5AJAA 4K3JB 5FKTA 4FB1D 5FXYA 5EMJB 2CN3A 4A7JA 3NIGA 4Z7NA 1GOHA 4L1QD 5HYNB 3DM0A 4RE6A 4ZN4A 3MXXA 3F3GA 3UVOA 4D6VA 5KDOB 3I7OA 3PXSD 2WQ8A 2YB8B 3K26A 5K19A 4A09B 2AH0A 2VDQA 1TYQC 1S4UX 3AL9A 4WK2A 2XZGA 3FCSA 2UZXB 3SBPA 1M1XA 3EU7A 4A0BB 4JHPC 3IULA 4A0BA 3IVMA 2H13A 5H17A 1OMWB 3PSCB 2G9AA 3EI3B 4J0XA 2VZ1A 3EI3A 3AL8B 3U4YA 4Z7OA 2EICA 3AL8A 3V9FA 3P4FA 3MUNA 2Z2NA 5AMSA 4CZVA 3BG1A 2AGYA 2CN2A 4G56B 2AH1A 4AEZA 4Z7QA 3IJ0A 1L5GA 1I2MB 5EM2B 2P9KC 5TDHB 5GSAA 1K32A 2VDKA 5EM2A 4CI3A 2I0RA 4PC0A 1VYHC 3N0DA 3SBRA 2AGLA 3L4MD 3VI3A 4O9DA 3RRMC 3O4JA 3IIWA 3RFHA 5FKSA 2Z2PA 3ODTA 4KFMB 3UVNA 1E8NA 4IMMA 4GGCA 1N6DA 3K6SA 1B9YA 3JPXA 3A0FA 4Z8LA 3SHFA 5TEFA 3UVKA 3JB9L 2I3TA 1A0RB 3RLMD 3SCYA 4ERYA 5H1MA 5CYKB 1U4CA 4MMZA 4G55A 2YNPA 3OKWA 4J8GA 5CYKA 3FCUA 4BH6A 5IJ7E 1T2XA 4I79A 1SHYB 3W15A 2GNQA 4AX4A 3IUJA 4AN1A 2IUQA 4J79A 4L3HD 3V4VA 4OWRA 4OZUA 4JT6C 1QFMA 4GM8A 1VE6A 5FFOA 2H3XA 2J56H 4A2MA 4G1EA 5E6RA 3C5MA 5GXHA 3EWEA 2HU8A 2YMUA 1NR0A 2EIBA 3SJLD 2BCJB 4QAMA 4QT8A 3PXTD 4O02A 1GOTB 4UM8A 4UM9A 2VDRA 2XE4A 1O6FA 1N6FA 3KCIA 3EQ9A 4O3TB 1QNIA 3PXWD 3NIFA 3OTTA 4CY5A 4BP9A 5C9ZB 4BCCA 2OK6A 4IRZA 5K1CC 2IAAA 4JXMA 3SMRA 3UR4A 1JV2A 1YFQA 2TRCB 4CZXA 2IWFA 5CXBB 2HU7A 3QHYB 5M5UA 5CXBA 3I2NA 1MDAH 2OK4A 3JAMg 4U1EI 5IGOA 5EARA 3VH0A 3VI4A 4JSPC 2MTAH 1UTCA 5C92A 2CNXA 3T3MA 4MMXA 2I0TA 2W18A 4PBYA 1K8KC 2B5LA 4CC9A 1GOGA 4BCDA 3JZHA 2VZ3A 1L0QA 4ESGA 4J77A 2CO0C 5SXMA 3UKUC 5H14A 4A11B 1PEVA 2OVPB 4JD2C 1E5TA 2GC4A 4ERQA 4A11A 2XDWA 4EWRA 3IUNA 4DNVA 1XHMA 1PBYB 2J55H 3V4PA 4CI1A 2IUVA 4PNKB 4A0AB 2B5NA 4A09A 1ERJA 3J80g 4GQBB 4A0AA 4QQEA 4FA5D 1RI6A 2B4EA 1H2YA 5GMKn 2H68A 3O4HA 4E54B 1P22A 4IA9A 4DNWA 1SQJA 2HESX 2EBSA 3O4GA 5M5SA 2UZYB 2Z2OA 4AMZA 2H6NA 2CE9A 1XIPA 3MZKA 2P9LC 3RFGA 3GREA 3ZWLB 4PSXB 3OKTA 1K3IA 5FKQA 2CO0A 4A2LA 3AH8B 4R7AB 3V5WB 3ZE1A 1VE7A 5THAA 5FKRA 5C2WB 4U7AA 2IURA 4NC4A 4GM9A 4GQ2P 2P9UC 4J84A 3SWSD 3PVWB 3UVMA 3J81g 3VGZA 5C2VB 4ERZA 4D0KA 1FWXA 2EIDA 4AMYA 2IUPA 3E0CA 3ZE2A 5IGQA 4N14A 5FA5B 2QR5A 3DWLC 3NVNA 3O4IA 3MZLA 5C86A 4WJKA 4LGNA 1GXRA 2CE8A 5I5MA 3EQ7A 3I8CA 1U2VC 1N6EA 2XL3A 2QC5A 4TZ4A 4J78A 4J73A 4L1MA 1UOPA 5JWZA 1O6GA 1GOFA 4FAND 1VZ2A 3PSLA 2QXVA 1TYEA 3I7KA 4A08B 2VDNA 4AN0A 3ZDXA 4A08A 1BPOA 3I7LA 2J57G 4L9OA 4LG9A 3SXTD 1YR2A 4BUJC 3EI1B 4RE5A 4X3EA 4K3ID 4NSXA 1JJUB 2OJYA 3SN6B 3EI1A 2HJ4A 5FQDA 3F3PA 5HE0B 3OL2B 2PM7B 1TBGA 2AQ5A 2HJBA 3OL2A 4J87A 2P9NC 4H5JA 1PI6A 2YBAA 5IJ8E 3IJCA 4PSWB 2I0SA 3GD1I 5HE2B 3RN1D 3EI4B 4X63B 2P9IC 5EMKB 3EI4A 4PXWA 5HE3B 2PBIB 2H9MA 3BG0A 4CI8A 3RMZD 5M5TA 2XU7A 2G99A 2AGZA 5EALA 3DXKC 3I7HA 1JTDB 4XEIC 3JRPA 2HYEA 3ORVD 2HU5A 1C9IA 4X61B 4XYHA 3GC3B 1H2ZA 2H14A 3CFVA 5FFGA 3I8EA 2HXCA 4J81A 3K72A 3EI2B 3MKQA 3JZNA 3JROA 3EI2A 4CY2A 4DNUA 1GG2B 1UOOA 5HQGA 4D9SA 4XYIA 1MG2A 1A12A 3SLED 4JSNC 1JMXB 4JSXC 2O9KA 3GFCA 5AFU3 3NVXA 3BWSA 4FA1D 1R5MA 3IUQA 2VDLA 2BBKH 4FWWA 2JKXA 2QZPA 4WK0A 5HDBA 4GMBA 1JMZB 4E54A 2H47A 3I7PA 3SVWD 2HKRA 1GP2B 3QI0A 1VZ3A 3CIKB 3RN0D 2VDPA 4GM3A 5EAMA 3I7NA 3IJEA 3ULEC 4CY3A 3ZDYA 2GC7A 3DSMA 3T3PA 1C9LA 2H6QA 4QL1A 2Q7QA 3CFSB 4ZOXA 4J86A 1H2WA 2VDOA 3UVLA 4CZYA 4FA9D 2PM9B 2XYIA 4H5IA 4ZOYA
chains in the Genus database with same CATH topology
2PM9A 2YNOA 4ZOZA 2H9LA 2H6KA 5EMMB 2YNNA 3DXMC 3JZGA 3EMHA 4HDJA 4Y5RD 3SBQA 2P9PC 3OW8A 3F3FA 5A2Qg 4L3GD 4FA4D 5EAPA 4JSVC 2I3SA 3C75H 4GQ1A 3N0EA 2B5MA 3C99A 3FM0A 4JT5C 4GGAA 3VA6A 4BL0A 3I89A 4X60B 3FGBA 1JOFA 3EG6A 3V7DB 1SQ9A 4O3UB 3OKYB 4QRJA 1NEXB 2H9NA 2XL2A 3B7FA 4O1QD 3UKRC 3OKYA 2AGWA 3MMYA 2IWKA 5I5IA 3L4OD 5TEEA 4FAVD 4LG8A 2PM6B 5IT9g 3PVUB 5CXCB 3HFQA 1XKSA 5CXCA 5B4WA 1B9XA 3AFCA 3FRXA 2OIZA 3KRWB 5TF2A 4MK0B 4E5ZB 4E5ZA 4FHLA 5I5JA 2P9SC 5HE1B 5IC7A 2AGXA 4UI9R 5EMLB 4CI2A 3IKOA 4J8BA 4J0WA 4GGDA 3PE7A 2H9PA 3C9CA 2OVQB 1PGUA 3K27A 4J82A 4YVDA 1OLZA 5GXIA 3MKSB 2HKMA 2OVRB 3KRXB 4ES0A 3RSEC 3NVQA 4Y7RA 4ZOVA 5FLXg 4GZ8A 1Q47A 4AOWA 1MG3A 4PBZA 4O45A 4CY1A 3SFZA 3IIYA 3IJ1A 5AJAA 4K3JB 5FKTA 4FB1D 5FXYA 5EMJB 2CN3A 4A7JA 4L1QD 5HYNB 3DM0A 4ZN4A 3MXXA 3F3GA 3UVOA 4D6VA 5KDOB 3I7OA 3PXSD 5K19A 2YB8B 3K26A 4A09B 2AH0A 1TYQC 1S4UX 3AL9A 2UZXB 3SBPA 3EU7A 4A0BB 4A0BA 2H13A 5H17A 1OMWB 3PSCB 2G9AA 3EI3B 4J0XA 3EI3A 3AL8B 3U4YA 3AL8A 3V9FA 3P4FA 2Z2NA 5AMSA 4CZVA 3BG1A 2AGYA 2CN2A 4G56B 2AH1A 4AEZA 3IJ0A 5EM2B 2P9KC 5TDHB 5GSAA 1K32A 5EM2A 4CI3A 2I0RA 4PC0A 1VYHC 3N0DA 3SBRA 2AGLA 3L4MD 4O9DA 3RRMC 3IIWA 3RFHA 5FKSA 2Z2PA 3ODTA 4KFMB 3UVNA 4IMMA 4GGCA 1N6DA 1B9YA 3JPXA 3A0FA 4Z8LA 3SHFA 5TEFA 3UVKA 3JB9L 2I3TA 1A0RB 3RLMD 3SCYA 4ERYA 5H1MA 5CYKB 1U4CA 2YNPA 3OKWA 4J8GA 5CYKA 5IJ7E 4BH6A 4I79A 1SHYB 3W15A 2GNQA 2IUQA 4J79A 4L3HD 4OWRA 4OZUA 4JT6C 4GM8A 2H3XA 2J56H 4A2MA 3C5MA 5GXHA 3EWEA 2YMUA 1NR0A 3SJLD 2BCJB 4QT8A 3PXTD 1GOTB 1N6FA 4O3TB 1QNIA 3PXWD 3OTTA 4CY5A 5C9ZB 2OK6A 5K1CC 2IAAA 4JXMA 3SMRA 3UR4A 1YFQA 2TRCB 4CZXA 2IWFA 5CXBB 5CXBA 3I2NA 1MDAH 2OK4A 3JAMg 4U1EI 5IGOA 5EARA 3VH0A 4JSPC 2MTAH 2CNXA 2I0TA 2W18A 4PBYA 1K8KC 2B5LA 4CC9A 3JZHA 1L0QA 4ESGA 4J77A 2CO0C 5SXMA 3UKUC 5H14A 4A11B 1PEVA 2OVPB 4JD2C 2GC4A 4ERQA 4A11A 4EWRA 1XHMA 1PBYB 2J55H 4CI1A 2IUVA 4PNKB 4A0AB 2B5NA 4A09A 1ERJA 3J80g 4GQBB 4A0AA 4QQEA 4FA5D 1RI6A 2B4EA 5GMKn 2H68A 4E54B 1P22A 4IA9A 1SQJA 2HESX 2EBSA 2UZYB 2Z2OA 2H6NA 2CE9A 1XIPA 3MZKA 2P9LC 3RFGA 3GREA 3ZWLB 4PSXB 3OKTA 5FKQA 2CO0A 4A2LA 3AH8B 4R7AB 3V5WB 5THAA 5FKRA 5C2WB 4U7AA 2IURA 4GM9A 4GQ2P 2P9UC 4J84A 3SWSD 3PVWB 3UVMA 3J81g 3VGZA 5C2VB 4ERZA 4D0KA 1FWXA 2IUPA 3E0CA 5IGQA 4N14A 5FA5B 3DWLC 3NVNA 3MZLA 4LGNA 1GXRA 2CE8A 5I5MA 3I8CA 1U2VC 1N6EA 2XL3A 2QC5A 4TZ4A 4J78A 4J73A 5JWZA 4FAND 3PSLA 2QXVA 3I7KA 4A08B 4A08A 3SXTD 3I7LA 2J57G 4L9OA 4LG9A 4BUJC 3EI1B 4X3EA 4K3ID 4NSXA 1JJUB 2OJYA 3SN6B 3EI1A 2HJ4A 5FQDA 3F3PA 5HE0B 3OL2B 2PM7B 1TBGA 2AQ5A 2HJBA 3OL2A 4J87A 2P9NC 4H5JA 1PI6A 2YBAA 5IJ8E 3IJCA 4PSWB 2I0SA 5HE2B 3RN1D 3EI4B 4X63B 2P9IC 5EMKB 3EI4A 4PXWA 5HE3B 2PBIB 2H9MA 3BG0A 4CI8A 3RMZD 2XU7A 2G99A 2AGZA 5EALA 3DXKC 3I7HA 4XEIC 2HYEA 3JRPA 3ORVD 4X61B 4XYHA 2H14A 3CFVA 3I8EA 2HXCA 4J81A 3EI2B 3MKQA 3JZNA 3JROA 3EI2A 4CY2A 1GG2B 5HQGA 4XYIA 1MG2A 3SLED 4JSNC 1JMXB 4JSXC 2O9KA 3GFCA 5AFU3 3NVXA 3BWSA 4FA1D 1R5MA 2BBKH 4FWWA 4GMBA 1JMZB 4E54A 2H47A 3I7PA 3SVWD 2HKRA 1GP2B 3CIKB 3RN0D 4GM3A 5EAMA 3I7NA 4CY3A 3ULEC 2GC7A 3DSMA 2H6QA 4QL1A 2Q7QA 3CFSB 4ZOXA 4J86A 3UVLA 4CZYA 4FA9D 2PM9B 2XYIA 4H5IA 4ZOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PM9 A;  2YNO A;  4ZOZ A;  2H9L A;  2H6K A;  5EMM B;  2YNN A;  3DXM C;  3JZG A;  3EMH A;  4HDJ A;  4Y5R D;  3SBQ A;  2P9P C;  3OW8 A;  3F3F A;  5A2Q g;  4L3G D;  4FA4 D;  5EAP A;  4JSV C;  2I3S A;  3C75 H;  4GQ1 A;  3N0E A;  2B5M A;  3C99 A;  3FM0 A;  4JT5 C;  4GGA A;  3VA6 A;  4BL0 A;  3I89 A;  4X60 B;  3FGB A;  1JOF A;  3EG6 A;  3V7D B;  1SQ9 A;  4O3U B;  3OKY B;  4QRJ A;  1NEX B;  2H9N A;  2XL2 A;  3B7F A;  4O1Q D;  3UKR C;  3OKY A;  2AGW A;  3MMY A;  2IWK A;  5I5I A;  3L4O D;  5TEE A;  4FAV D;  4LG8 A;  2PM6 B;  5IT9 g;  3PVU B;  5CXC B;  3HFQ A;  1XKS A;  5CXC A;  5B4W A;  1B9X A;  3AFC A;  3FRX A;  2OIZ A;  3KRW B;  5TF2 A;  4MK0 B;  4E5Z B;  4E5Z A;  4FHL A;  5I5J A;  2P9S C;  5HE1 B;  5IC7 A;  2AGX A;  4UI9 R;  5EML B;  4CI2 A;  3IKO A;  4J8B A;  4J0W A;  4GGD A;  3PE7 A;  2H9P A;  3C9C A;  2OVQ B;  1PGU A;  3K27 A;  4J82 A;  4YVD A;  1OLZ A;  5GXI A;  3MKS B;  2HKM A;  2OVR B;  3KRX B;  4ES0 A;  3RSE C;  3NVQ A;  4Y7R A;  4ZOV A;  5FLX g;  4GZ8 A;  1Q47 A;  4AOW A;  1MG3 A;  4PBZ A;  4O45 A;  4CY1 A;  3SFZ A;  3IIY A;  3IJ1 A;  5AJA A;  4K3J B;  5FKT A;  4FB1 D;  5FXY A;  5EMJ B;  2CN3 A;  4A7J A;  4L1Q D;  5HYN B;  3DM0 A;  4ZN4 A;  3MXX A;  3F3G A;  3UVO A;  4D6V A;  5KDO B;  3I7O A;  3PXS D;  5K19 A;  2YB8 B;  3K26 A;  4A09 B;  2AH0 A;  1TYQ C;  1S4U X;  3AL9 A;  2UZX B;  3SBP A;  3EU7 A;  4A0B B;  4A0B A;  2H13 A;  5H17 A;  1OMW B;  3PSC B;  2G9A A;  3EI3 B;  4J0X A;  3EI3 A;  3AL8 B;  3U4Y A;  3AL8 A;  3V9F A;  3P4F A;  2Z2N A;  5AMS A;  4CZV A;  3BG1 A;  2AGY A;  2CN2 A;  4G56 B;  2AH1 A;  4AEZ A;  3IJ0 A;  5EM2 B;  2P9K C;  5TDH B;  5GSA A;  1K32 A;  5EM2 A;  4CI3 A;  2I0R A;  4PC0 A;  1VYH C;  3N0D A;  3SBR A;  2AGL A;  3L4M D;  4O9D A;  3RRM C;  3IIW A;  3RFH A;  5FKS A;  2Z2P A;  3ODT A;  4KFM B;  3UVN A;  4IMM A;  4GGC A;  1N6D A;  1B9Y A;  3JPX A;  3A0F A;  4Z8L A;  3SHF A;  5TEF A;  3UVK A;  3JB9 L;  2I3T A;  1A0R B;  3RLM D;  3SCY A;  4ERY A;  5H1M A;  5CYK B;  1U4C A;  2YNP A;  3OKW A;  4J8G A;  5CYK A;  5IJ7 E;  4BH6 A;  4I79 A;  1SHY B;  3W15 A;  2GNQ A;  2IUQ A;  4J79 A;  4L3H D;  4OWR A;  4OZU A;  4JT6 C;  4GM8 A;  2H3X A;  2J56 H;  4A2M A;  3C5M A;  5GXH A;  3EWE A;  2YMU A;  1NR0 A;  3SJL D;  2BCJ B;  4QT8 A;  3PXT D;  1GOT B;  1N6F A;  4O3T B;  1QNI A;  3PXW D;  3OTT A;  4CY5 A;  5C9Z B;  2OK6 A;  5K1C C;  2IAA A;  4JXM A;  3SMR A;  3UR4 A;  1YFQ A;  2TRC B;  4CZX A;  2IWF A;  5CXB B;  5CXB A;  3I2N A;  1MDA H;  2OK4 A;  3JAM g;  4U1E I;  5IGO A;  5EAR A;  3VH0 A;  4JSP C;  2MTA H;  2CNX A;  2I0T A;  2W18 A;  4PBY A;  1K8K C;  2B5L A;  4CC9 A;  3JZH A;  1L0Q A;  4ESG A;  4J77 A;  2CO0 C;  5SXM A;  3UKU C;  5H14 A;  4A11 B;  1PEV A;  2OVP B;  4JD2 C;  2GC4 A;  4ERQ A;  4A11 A;  4EWR A;  1XHM A;  1PBY B;  2J55 H;  4CI1 A;  2IUV A;  4PNK B;  4A0A B;  2B5N A;  4A09 A;  1ERJ A;  3J80 g;  4GQB B;  4A0A A;  4QQE A;  4FA5 D;  1RI6 A;  2B4E A;  5GMK n;  2H68 A;  4E54 B;  1P22 A;  4IA9 A;  1SQJ A;  2HES X;  2EBS A;  2UZY B;  2Z2O A;  2H6N A;  2CE9 A;  1XIP A;  3MZK A;  2P9L C;  3RFG A;  3GRE A;  3ZWL B;  4PSX B;  3OKT A;  5FKQ A;  2CO0 A;  4A2L A;  3AH8 B;  4R7A B;  3V5W B;  5THA A;  5FKR A;  5C2W B;  4U7A A;  2IUR A;  4GM9 A;  4GQ2 P;  2P9U C;  4J84 A;  3SWS D;  3PVW B;  3UVM A;  3J81 g;  3VGZ A;  5C2V B;  4ERZ A;  4D0K A;  1FWX A;  2IUP A;  3E0C A;  5IGQ A;  4N14 A;  5FA5 B;  3DWL C;  3NVN A;  3MZL A;  4LGN A;  1GXR A;  2CE8 A;  5I5M A;  3I8C A;  1U2V C;  1N6E A;  2XL3 A;  2QC5 A;  4TZ4 A;  4J78 A;  4J73 A;  5JWZ A;  4FAN D;  3PSL A;  2QXV A;  3I7K A;  4A08 B;  4A08 A;  3SXT D;  3I7L A;  2J57 G;  4L9O A;  4LG9 A;  4BUJ C;  3EI1 B;  4X3E A;  4K3I D;  4NSX A;  1JJU B;  2OJY A;  3SN6 B;  3EI1 A;  2HJ4 A;  5FQD A;  3F3P A;  5HE0 B;  3OL2 B;  2PM7 B;  1TBG A;  2AQ5 A;  2HJB A;  3OL2 A;  4J87 A;  2P9N C;  4H5J A;  1PI6 A;  2YBA A;  5IJ8 E;  3IJC A;  4PSW B;  2I0S A;  5HE2 B;  3RN1 D;  3EI4 B;  4X63 B;  2P9I C;  5EMK B;  3EI4 A;  4PXW A;  5HE3 B;  2PBI B;  2H9M A;  3BG0 A;  4CI8 A;  3RMZ D;  2XU7 A;  2G99 A;  2AGZ A;  5EAL A;  3DXK C;  3I7H A;  4XEI C;  2HYE A;  3JRP A;  3ORV D;  4X61 B;  4XYH A;  2H14 A;  3CFV A;  3I8E A;  2HXC A;  4J81 A;  3EI2 B;  3MKQ A;  3JZN A;  3JRO A;  3EI2 A;  4CY2 A;  1GG2 B;  5HQG A;  4XYI A;  1MG2 A;  3SLE D;  4JSN C;  1JMX B;  4JSX C;  2O9K A;  3GFC A;  5AFU 3;  3NVX A;  3BWS A;  4FA1 D;  1R5M A;  2BBK H;  4FWW A;  4GMB A;  1JMZ B;  4E54 A;  2H47 A;  3I7P A;  3SVW D;  2HKR A;  1GP2 B;  3CIK B;  3RN0 D;  4GM3 A;  5EAM A;  3I7N A;  4CY3 A;  3ULE C;  2GC7 A;  3DSM A;  2H6Q A;  4QL1 A;  2Q7Q A;  3CFS B;  4ZOX A;  4J86 A;  3UVL A;  4CZY A;  4FA9 D;  2PM9 B;  2XYI A;  4H5I A;  4ZOY A; 
#chains in the Genus database with same CATH topology
 2PM9 A;  2YNO A;  4ZOZ A;  2H9L A;  2H6K A;  4WK4 A;  5EMM B;  2YNN A;  3DXM C;  3K71 A;  3JZG A;  3EMH A;  4HDJ A;  1U8C A;  4Y5R D;  3SBQ A;  2P9P C;  3OW8 A;  3F3F A;  5A2Q g;  4L3G D;  4FA4 D;  1E8M A;  5EAP A;  3EQ8 A;  4JSV C;  2I3S A;  3C75 H;  4GQ1 A;  3N0E A;  2B5M A;  3C99 A;  3FM0 A;  5M5R A;  4JT5 C;  4GGA A;  3VA6 A;  4BL0 A;  3I89 A;  2EIE A;  4NEN A;  3FGB A;  4X60 B;  3ZE0 A;  3MVD K;  1JOF A;  3EG6 A;  3V7D B;  4MMY A;  1SQ9 A;  4O3U B;  2BKL A;  3OKY B;  4QRJ A;  1NEX B;  2H9N A;  2XL2 A;  3B7F A;  4O1Q D;  3UKR C;  5E6U A;  3OKY A;  2AGW A;  3MMY A;  2IWK A;  5I5I A;  3L4O D;  5TEE A;  4NAA A;  4FAV D;  4LG8 A;  2PM6 B;  5IT9 g;  3PVU B;  5CXC B;  3IUM A;  3HFQ A;  1XKS A;  5CXC A;  5B4W A;  1B9X A;  3AFC A;  3FRX A;  3IUR A;  2OIZ A;  2VDM A;  2VC2 A;  3KRW B;  5M61 A;  5TF2 A;  4MK0 B;  1H2X A;  4JHN A;  4E5Z B;  4E5Z A;  4FHL A;  5I5J A;  2P9S C;  3MUO A;  5HE1 B;  4BCB A;  1QFS A;  2AGX A;  5IC7 A;  1UOQ A;  4UI9 R;  4G1M A;  5EML B;  4BP8 A;  4CI2 A;  3IKO A;  4J8B A;  4NBM A;  4J0W A;  4O2W A;  3ZDZ A;  4GGD A;  3PE7 A;  2H9P A;  3C9C A;  2OVQ B;  1PGU A;  5E6S A;  3K27 A;  4J82 A;  4YVD A;  1OLZ A;  3DDU A;  5GXI A;  3MKS B;  2HKM A;  2OVR B;  3KRX B;  4ES0 A;  3RSE C;  3NVQ A;  4Y7R A;  4ZOV A;  5FLX g;  5M5V A;  4GZ8 A;  1Q47 A;  4AOW A;  1MG3 A;  4PBZ A;  3NID A;  4O45 A;  4CY1 A;  3SFZ A;  3IIY A;  3OF7 A;  3IJ1 A;  5AJA A;  4K3J B;  5FKT A;  4FB1 D;  5FXY A;  5EMJ B;  2CN3 A;  4A7J A;  3NIG A;  4Z7N A;  1GOH A;  4L1Q D;  5HYN B;  3DM0 A;  4RE6 A;  4ZN4 A;  3MXX A;  3F3G A;  3UVO A;  4D6V A;  5KDO B;  3I7O A;  3PXS D;  2WQ8 A;  2YB8 B;  3K26 A;  5K19 A;  4A09 B;  2AH0 A;  2VDQ A;  1TYQ C;  1S4U X;  3AL9 A;  4WK2 A;  2XZG A;  3FCS A;  2UZX B;  3SBP A;  1M1X A;  3EU7 A;  4A0B B;  4JHP C;  3IUL A;  4A0B A;  3IVM A;  2H13 A;  5H17 A;  1OMW B;  3PSC B;  2G9A A;  3EI3 B;  4J0X A;  2VZ1 A;  3EI3 A;  3AL8 B;  3U4Y A;  4Z7O A;  2EIC A;  3AL8 A;  3V9F A;  3P4F A;  3MUN A;  2Z2N A;  5AMS A;  4CZV A;  3BG1 A;  2AGY A;  2CN2 A;  4G56 B;  2AH1 A;  4AEZ A;  4Z7Q A;  3IJ0 A;  1L5G A;  1I2M B;  5EM2 B;  2P9K C;  5TDH B;  5GSA A;  1K32 A;  2VDK A;  5EM2 A;  4CI3 A;  2I0R A;  4PC0 A;  1VYH C;  3N0D A;  3SBR A;  2AGL A;  3L4M D;  3VI3 A;  4O9D A;  3RRM C;  3O4J A;  3IIW A;  3RFH A;  5FKS A;  2Z2P A;  3ODT A;  4KFM B;  3UVN A;  1E8N A;  4IMM A;  4GGC A;  1N6D A;  3K6S A;  1B9Y A;  3JPX A;  3A0F A;  4Z8L A;  3SHF A;  5TEF A;  3UVK A;  3JB9 L;  2I3T A;  1A0R B;  3RLM D;  3SCY A;  4ERY A;  5H1M A;  5CYK B;  1U4C A;  4MMZ A;  4G55 A;  2YNP A;  3OKW A;  4J8G A;  5CYK A;  3FCU A;  4BH6 A;  5IJ7 E;  1T2X A;  4I79 A;  1SHY B;  3W15 A;  2GNQ A;  4AX4 A;  3IUJ A;  4AN1 A;  2IUQ A;  4J79 A;  4L3H D;  3V4V A;  4OWR A;  4OZU A;  4JT6 C;  1QFM A;  4GM8 A;  1VE6 A;  5FFO A;  2H3X A;  2J56 H;  4A2M A;  4G1E A;  5E6R A;  3C5M A;  5GXH A;  3EWE A;  2HU8 A;  2YMU A;  1NR0 A;  2EIB A;  3SJL D;  2BCJ B;  4QAM A;  4QT8 A;  3PXT D;  4O02 A;  1GOT B;  4UM8 A;  4UM9 A;  2VDR A;  2XE4 A;  1O6F A;  1N6F A;  3KCI A;  3EQ9 A;  4O3T B;  1QNI A;  3PXW D;  3NIF A;  3OTT A;  4CY5 A;  4BP9 A;  5C9Z B;  4BCC A;  2OK6 A;  4IRZ A;  5K1C C;  2IAA A;  4JXM A;  3SMR A;  3UR4 A;  1JV2 A;  1YFQ A;  2TRC B;  4CZX A;  2IWF A;  5CXB B;  2HU7 A;  3QHY B;  5M5U A;  5CXB A;  3I2N A;  1MDA H;  2OK4 A;  3JAM g;  4U1E I;  5IGO A;  5EAR A;  3VH0 A;  3VI4 A;  4JSP C;  2MTA H;  1UTC A;  5C92 A;  2CNX A;  3T3M A;  4MMX A;  2I0T A;  2W18 A;  4PBY A;  1K8K C;  2B5L A;  4CC9 A;  1GOG A;  4BCD A;  3JZH A;  2VZ3 A;  1L0Q A;  4ESG A;  4J77 A;  2CO0 C;  5SXM A;  3UKU C;  5H14 A;  4A11 B;  1PEV A;  2OVP B;  4JD2 C;  1E5T A;  2GC4 A;  4ERQ A;  4A11 A;  2XDW A;  4EWR A;  3IUN A;  4DNV A;  1XHM A;  1PBY B;  2J55 H;  3V4P A;  4CI1 A;  2IUV A;  4PNK B;  4A0A B;  2B5N A;  4A09 A;  1ERJ A;  3J80 g;  4GQB B;  4A0A A;  4QQE A;  4FA5 D;  1RI6 A;  2B4E A;  1H2Y A;  5GMK n;  2H68 A;  3O4H A;  4E54 B;  1P22 A;  4IA9 A;  4DNW A;  1SQJ A;  2HES X;  2EBS A;  3O4G A;  5M5S A;  2UZY B;  2Z2O A;  4AMZ A;  2H6N A;  2CE9 A;  1XIP A;  3MZK A;  2P9L C;  3RFG A;  3GRE A;  3ZWL B;  4PSX B;  3OKT A;  1K3I A;  5FKQ A;  2CO0 A;  4A2L A;  3AH8 B;  4R7A B;  3V5W B;  3ZE1 A;  1VE7 A;  5THA A;  5FKR A;  5C2W B;  4U7A A;  2IUR A;  4NC4 A;  4GM9 A;  4GQ2 P;  2P9U C;  4J84 A;  3SWS D;  3PVW B;  3UVM A;  3J81 g;  3VGZ A;  5C2V B;  4ERZ A;  4D0K A;  1FWX A;  2EID A;  4AMY A;  2IUP A;  3E0C A;  3ZE2 A;  5IGQ A;  4N14 A;  5FA5 B;  2QR5 A;  3DWL C;  3NVN A;  3O4I A;  3MZL A;  5C86 A;  4WJK A;  4LGN A;  1GXR A;  2CE8 A;  5I5M A;  3EQ7 A;  3I8C A;  1U2V C;  1N6E A;  2XL3 A;  2QC5 A;  4TZ4 A;  4J78 A;  4J73 A;  4L1M A;  1UOP A;  5JWZ A;  1O6G A;  1GOF A;  4FAN D;  1VZ2 A;  3PSL A;  2QXV A;  1TYE A;  3I7K A;  4A08 B;  2VDN A;  4AN0 A;  3ZDX A;  4A08 A;  1BPO A;  3I7L A;  2J57 G;  4L9O A;  4LG9 A;  3SXT D;  1YR2 A;  4BUJ C;  3EI1 B;  4RE5 A;  4X3E A;  4K3I D;  4NSX A;  1JJU B;  2OJY A;  3SN6 B;  3EI1 A;  2HJ4 A;  5FQD A;  3F3P A;  5HE0 B;  3OL2 B;  2PM7 B;  1TBG A;  2AQ5 A;  2HJB A;  3OL2 A;  4J87 A;  2P9N C;  4H5J A;  1PI6 A;  2YBA A;  5IJ8 E;  3IJC A;  4PSW B;  2I0S A;  3GD1 I;  5HE2 B;  3RN1 D;  3EI4 B;  4X63 B;  2P9I C;  5EMK B;  3EI4 A;  4PXW A;  5HE3 B;  2PBI B;  2H9M A;  3BG0 A;  4CI8 A;  3RMZ D;  5M5T A;  2XU7 A;  2G99 A;  2AGZ A;  5EAL A;  3DXK C;  3I7H A;  1JTD B;  4XEI C;  3JRP A;  2HYE A;  3ORV D;  2HU5 A;  1C9I A;  4X61 B;  4XYH A;  3GC3 B;  1H2Z A;  2H14 A;  3CFV A;  5FFG A;  3I8E A;  2HXC A;  4J81 A;  3K72 A;  3EI2 B;  3MKQ A;  3JZN A;  3JRO A;  3EI2 A;  4CY2 A;  4DNU A;  1GG2 B;  1UOO A;  5HQG A;  4D9S A;  4XYI A;  1MG2 A;  1A12 A;  3SLE D;  4JSN C;  1JMX B;  4JSX C;  2O9K A;  3GFC A;  5AFU 3;  3NVX A;  3BWS A;  4FA1 D;  1R5M A;  3IUQ A;  2VDL A;  2BBK H;  4FWW A;  2JKX A;  2QZP A;  4WK0 A;  5HDB A;  4GMB A;  1JMZ B;  4E54 A;  2H47 A;  3I7P A;  3SVW D;  2HKR A;  1GP2 B;  3QI0 A;  1VZ3 A;  3CIK B;  3RN0 D;  2VDP A;  4GM3 A;  5EAM A;  3I7N A;  3IJE A;  3ULE C;  4CY3 A;  3ZDY A;  2GC7 A;  3DSM A;  3T3P A;  1C9L A;  2H6Q A;  4QL1 A;  2Q7Q A;  3CFS B;  4ZOX A;  4J86 A;  1H2W A;  2VDO A;  3UVL A;  4CZY A;  4FA9 D;  2PM9 B;  2XYI A;  4H5I A;  4ZOY A; 
#chains in the Genus database with same CATH homology
 2PM9 A;  2YNO A;  4ZOZ A;  2H9L A;  2H6K A;  5EMM B;  2YNN A;  3DXM C;  3JZG A;  3EMH A;  4HDJ A;  4Y5R D;  3SBQ A;  2P9P C;  3OW8 A;  3F3F A;  5A2Q g;  4L3G D;  4FA4 D;  5EAP A;  4JSV C;  2I3S A;  3C75 H;  4GQ1 A;  3N0E A;  2B5M A;  3C99 A;  3FM0 A;  4JT5 C;  4GGA A;  3VA6 A;  4BL0 A;  3I89 A;  4X60 B;  3FGB A;  1JOF A;  3EG6 A;  3V7D B;  1SQ9 A;  4O3U B;  3OKY B;  4QRJ A;  1NEX B;  2H9N A;  2XL2 A;  3B7F A;  4O1Q D;  3UKR C;  3OKY A;  2AGW A;  3MMY A;  2IWK A;  5I5I A;  3L4O D;  5TEE A;  4FAV D;  4LG8 A;  2PM6 B;  5IT9 g;  3PVU B;  5CXC B;  3HFQ A;  1XKS A;  5CXC A;  5B4W A;  1B9X A;  3AFC A;  3FRX A;  2OIZ A;  3KRW B;  5TF2 A;  4MK0 B;  4E5Z B;  4E5Z A;  4FHL A;  5I5J A;  2P9S C;  5HE1 B;  5IC7 A;  2AGX A;  4UI9 R;  5EML B;  4CI2 A;  3IKO A;  4J8B A;  4J0W A;  4GGD A;  3PE7 A;  2H9P A;  3C9C A;  2OVQ B;  1PGU A;  3K27 A;  4J82 A;  4YVD A;  1OLZ A;  5GXI A;  3MKS B;  2HKM A;  2OVR B;  3KRX B;  4ES0 A;  3RSE C;  3NVQ A;  4Y7R A;  4ZOV A;  5FLX g;  4GZ8 A;  1Q47 A;  4AOW A;  1MG3 A;  4PBZ A;  4O45 A;  4CY1 A;  3SFZ A;  3IIY A;  3IJ1 A;  5AJA A;  4K3J B;  5FKT A;  4FB1 D;  5FXY A;  5EMJ B;  2CN3 A;  4A7J A;  4L1Q D;  5HYN B;  3DM0 A;  4ZN4 A;  3MXX A;  3F3G A;  3UVO A;  4D6V A;  5KDO B;  3I7O A;  3PXS D;  5K19 A;  2YB8 B;  3K26 A;  4A09 B;  2AH0 A;  1TYQ C;  1S4U X;  3AL9 A;  2UZX B;  3SBP A;  3EU7 A;  4A0B B;  4A0B A;  2H13 A;  5H17 A;  1OMW B;  3PSC B;  2G9A A;  3EI3 B;  4J0X A;  3EI3 A;  3AL8 B;  3U4Y A;  3AL8 A;  3V9F A;  3P4F A;  2Z2N A;  5AMS A;  4CZV A;  3BG1 A;  2AGY A;  2CN2 A;  4G56 B;  2AH1 A;  4AEZ A;  3IJ0 A;  5EM2 B;  2P9K C;  5TDH B;  5GSA A;  1K32 A;  5EM2 A;  4CI3 A;  2I0R A;  4PC0 A;  1VYH C;  3N0D A;  3SBR A;  2AGL A;  3L4M D;  4O9D A;  3RRM C;  3IIW A;  3RFH A;  5FKS A;  2Z2P A;  3ODT A;  4KFM B;  3UVN A;  4IMM A;  4GGC A;  1N6D A;  1B9Y A;  3JPX A;  3A0F A;  4Z8L A;  3SHF A;  5TEF A;  3UVK A;  3JB9 L;  2I3T A;  1A0R B;  3RLM D;  3SCY A;  4ERY A;  5H1M A;  5CYK B;  1U4C A;  2YNP A;  3OKW A;  4J8G A;  5CYK A;  5IJ7 E;  4BH6 A;  4I79 A;  1SHY B;  3W15 A;  2GNQ A;  2IUQ A;  4J79 A;  4L3H D;  4OWR A;  4OZU A;  4JT6 C;  4GM8 A;  2H3X A;  2J56 H;  4A2M A;  3C5M A;  5GXH A;  3EWE A;  2YMU A;  1NR0 A;  3SJL D;  2BCJ B;  4QT8 A;  3PXT D;  1GOT B;  1N6F A;  4O3T B;  1QNI A;  3PXW D;  3OTT A;  4CY5 A;  5C9Z B;  2OK6 A;  5K1C C;  2IAA A;  4JXM A;  3SMR A;  3UR4 A;  1YFQ A;  2TRC B;  4CZX A;  2IWF A;  5CXB B;  5CXB A;  3I2N A;  1MDA H;  2OK4 A;  3JAM g;  4U1E I;  5IGO A;  5EAR A;  3VH0 A;  4JSP C;  2MTA H;  2CNX A;  2I0T A;  2W18 A;  4PBY A;  1K8K C;  2B5L A;  4CC9 A;  3JZH A;  1L0Q A;  4ESG A;  4J77 A;  2CO0 C;  5SXM A;  3UKU C;  5H14 A;  4A11 B;  1PEV A;  2OVP B;  4JD2 C;  2GC4 A;  4ERQ A;  4A11 A;  4EWR A;  1XHM A;  1PBY B;  2J55 H;  4CI1 A;  2IUV A;  4PNK B;  4A0A B;  2B5N A;  4A09 A;  1ERJ A;  3J80 g;  4GQB B;  4A0A A;  4QQE A;  4FA5 D;  1RI6 A;  2B4E A;  5GMK n;  2H68 A;  4E54 B;  1P22 A;  4IA9 A;  1SQJ A;  2HES X;  2EBS A;  2UZY B;  2Z2O A;  2H6N A;  2CE9 A;  1XIP A;  3MZK A;  2P9L C;  3RFG A;  3GRE A;  3ZWL B;  4PSX B;  3OKT A;  5FKQ A;  2CO0 A;  4A2L A;  3AH8 B;  4R7A B;  3V5W B;  5THA A;  5FKR A;  5C2W B;  4U7A A;  2IUR A;  4GM9 A;  4GQ2 P;  2P9U C;  4J84 A;  3SWS D;  3PVW B;  3UVM A;  3J81 g;  3VGZ A;  5C2V B;  4ERZ A;  4D0K A;  1FWX A;  2IUP A;  3E0C A;  5IGQ A;  4N14 A;  5FA5 B;  3DWL C;  3NVN A;  3MZL A;  4LGN A;  1GXR A;  2CE8 A;  5I5M A;  3I8C A;  1U2V C;  1N6E A;  2XL3 A;  2QC5 A;  4TZ4 A;  4J78 A;  4J73 A;  5JWZ A;  4FAN D;  3PSL A;  2QXV A;  3I7K A;  4A08 B;  4A08 A;  3SXT D;  3I7L A;  2J57 G;  4L9O A;  4LG9 A;  4BUJ C;  3EI1 B;  4X3E A;  4K3I D;  4NSX A;  1JJU B;  2OJY A;  3SN6 B;  3EI1 A;  2HJ4 A;  5FQD A;  3F3P A;  5HE0 B;  3OL2 B;  2PM7 B;  1TBG A;  2AQ5 A;  2HJB A;  3OL2 A;  4J87 A;  2P9N C;  4H5J A;  1PI6 A;  2YBA A;  5IJ8 E;  3IJC A;  4PSW B;  2I0S A;  5HE2 B;  3RN1 D;  3EI4 B;  4X63 B;  2P9I C;  5EMK B;  3EI4 A;  4PXW A;  5HE3 B;  2PBI B;  2H9M A;  3BG0 A;  4CI8 A;  3RMZ D;  2XU7 A;  2G99 A;  2AGZ A;  5EAL A;  3DXK C;  3I7H A;  4XEI C;  2HYE A;  3JRP A;  3ORV D;  4X61 B;  4XYH A;  2H14 A;  3CFV A;  3I8E A;  2HXC A;  4J81 A;  3EI2 B;  3MKQ A;  3JZN A;  3JRO A;  3EI2 A;  4CY2 A;  1GG2 B;  5HQG A;  4XYI A;  1MG2 A;  3SLE D;  4JSN C;  1JMX B;  4JSX C;  2O9K A;  3GFC A;  5AFU 3;  3NVX A;  3BWS A;  4FA1 D;  1R5M A;  2BBK H;  4FWW A;  4GMB A;  1JMZ B;  4E54 A;  2H47 A;  3I7P A;  3SVW D;  2HKR A;  1GP2 B;  3CIK B;  3RN0 D;  4GM3 A;  5EAM A;  3I7N A;  4CY3 A;  3ULE C;  2GC7 A;  3DSM A;  2H6Q A;  4QL1 A;  2Q7Q A;  3CFS B;  4ZOX A;  4J86 A;  3UVL A;  4CZY A;  4FA9 D;  2PM9 B;  2XYI A;  4H5I A;  4ZOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...