4J79A

Crystal structure of beta'-cop/pedvspike complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
total genus 87
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j79A01
4ERZA 1OLZA 3ODTA 2QC5A 3SHFA 2BCJB 5K19A 3IJ1A 4EWRA 3I7NA 2AGLA 4J77A 3JZGA 4E5ZA 5H17A 1GG2B 3BWSA 5IC7A 4PSWB 5GSAA 3AL8B 3UR4A 4L1QD 4CY5A 1ERJA 1JMXB 3SCYA 4I79A 2XL3A 5HE0B 3AH8B 3IJCA 2J57G 3FRXA 3MXXA 4PXWA 2XU7A 3N0EA 2P9UC 3C9CA 3OKWA 2YB8B 1VYHC 4E54B 3SXTD 4TZ4A 3AL8A 3V7DB 3A0FA 5FKTA 2H3XA 4Z8LA 4BUJC 2J56H 1N6EA 2IWFA 2I0RA 2IUVA 5EMMB 4GGDA 4J8BA 2UZXB 3DXKC 2TRCB 1B9YA 2YMUA 4J78A 4N14A 4ZOVA 2J55H 4ES0A 4CZXA 4GZ8A 4E54A 4U7AA 3CIKB 4GM9A 2B5NA 5H14A 2CNXA 4A2MA 4JD2C 3PXTD 1OMWB 3MZLA 3J81g 5CXCB 4GMBA 2I3TA 3GREA 3RN0D 3W15A 4FB1D 1MG2A 4GM8A 5HE2B 2H14A 3JB9L 3P4FA 5HE3B 3FGBA 1P22A 2H9LA 2OVQB 2IURA 3J80g 5IGOA 4UI9R 3DXMC 2CO0A 4Y5RD 3UKUC 4BH6A 4O45A 3EI4B 4QL1A 2OIZA 3KRXB 4D6VA 3SBQA 1U4CA 2Q7QA 3PVUB 5CXCA 4QRJA 1Q47A 5CXBB 3UVMA 3SFZA 3VH0A 4K3JB 3ULEC 4ZN4A 5IJ8E 1U2VC 5FKSA 1QNIA 4A2LA 2P9LC 2CO0C 3PVWB 4JSXC 4YVDA 4K3ID 3EI4A 5FXYA 2H6KA 2P9SC 1PEVA 5C9ZB 2AH0A 2YNPA 4KFMB 4L3HD 4QQEA 4GQBB 3OTTA 4G56B 1JOFA 4BL0A 5CXBA 1N6DA 2OJYA 5EAPA 3I89A 5GMKn 4D0KA 1PGUA 3ZWLB 2W18A 3F3PA 4FA4D 3SLED 4FAND 3F3FA 1XKSA 4AOWA 2GC4A 3SWSD 3EU7A 4PC0A 3NVXA 4CI3A 3RLMD 5HE1B 4ESGA 4A0BB 4X3EA 4XYIA 3DWLC 2XYIA 5B4WA 3EI2B 1GP2B 4X63B 3NVQA 2YBAA 4CI8A 2QXVA 3I7HA 4PNKB 5IJ7E 3K27A 3SMRA 4CI2A 5IT9g 1PI6A 2UZYB 4GGCA 2HKRA 2H6QA 3N0DA 3CFVA 4A0BA 2IWKA 4A7JA 3FM0A 2Z2PA 2B4EA 1JMZB 5AMSA 3EI2A 3EG6A 1GXRA 4X60B 3PSLA 1YFQA 5FQDA 4ZOYA 3OW8A 3RN1D 2O9KA 3SBRA 1NR0A 2IAAA 3I7OA 4FHLA 1MG3A 5EALA 3KRWB 2HYEA 5EMLB 5H1MA 3B7FA 3SN6B 5TDHB 3MMYA 5THAA 2GC7A 5FKQA 4LG8A 2GNQA 2AGWA 4PBYA 4JT6C 2AGYA 3OL2B 3RMZD 2B5LA 3PXSD 3U4YA 1N6FA 4X61B 2PBIB 4CC9A 4FWWA 3UKRC 3DSMA 4AEZA 3IJ0A 3PXWD 2G9AA 4PBZA 5FA5B 1A0RB 4A09B 3C5MA 2H13A 2YNOA 2EBSA 2IUPA 2H9NA 5C2WB 4A0AB 3OL2A 3EMHA 4CZYA 1R5MA 5CYKB 3I7KA 4R7AB 5GXIA 4FA5D 2PM7B 3CFSB 5HYNB 1L0QA 4JT5C 2I3SA 4A11B 4LG9A 4A09A 1MDAH 1GOTB 4H5IA 4ZOXA 4CZVA 4IMMA 1SQ9A 4A0AA 5KDOB 4CY1A 5CYKA 3JRPA 5A2Qg 5K1CC 2Z2OA 2H9MA 1SQJA 2H68A 3OKYB 3VGZA 3I7LA 5EM2B 4J8GA 4A11A 3EI1B 2CE8A 4OZUA 2CN3A 4Y7RA 3JZNA 2HJBA 4O3TB 4HDJA 4ZOZA 3JROA 3I2NA 2HKMA 3PE7A 5FKRA 3EWEA 1K32A 3OKYA 3L4MD 4IA9A 3RFGA 4O9DA 5EM2A 5EMJB 3BG1A 3EI1A 2P9IC 1PBYB 1TYQC 1TBGA 1NEXB 5AFU3 4J82A 2PM9B 2H9PA 2CN2A 4CY3A 1XHMA 3IKOA 3HFQA 1JJUB 2AQ5A 3BG0A 4J86A 5I5MA 3UVOA 5JWZA 2CE9A 2XL2A 3I7PA 2OK6A 4J79A 5TF2A 4OWRA 3RFHA 3JZHA 3I8EA 3PSCB 2PM9A 3C75H 3JAMg 2AGXA 4QT8A 5IGQA 2OVRB 4GGAA 2Z2NA 2OVPB 1K8KC 4NSXA 5EMKB 2HJ4A 4JSVC 5TEFA 2P9KC 3JPXA 3RRMC 3MKQA 4XYHA 3MKSB 3L4OD 5SXMA 3F3GA 3AFCA 4J87A 3OKTA 2P9NC 4ERQA 3UVNA 2PM6B 4JXMA 2H47A 4O3UB 1FWXA 3UVKA 2B5MA 2P9PC 3ORVD 5GXHA 3DM0A 4LGNA 4GQ2P 4GQ1A 3SBPA 3AL9A 5EAMA 4FA9D 3GFCA 3SVWD 4J73A 4H5JA 4J0XA 4A08B 3EI3B 5C2VB 3VA6A 2I0TA 5I5IA 5FLXg 4FAVD 5AJAA 1RI6A 2HXCA 4J0WA 4FA1D 4L9OA 4O1QD 2H6NA 3IIWA 4J81A 4JSPC 3V9FA 1S4UX 4MK0B 4GM3A 2G99A 4J84A 1XIPA 2AGZA 3EI3A 4A08A 2BBKH 4ERYA 3V5WB 3E0CA 2MTAH 2YNNA 5HQGA 2HESX 3MZKA 3C99A 2OK4A 5TEEA 3NVNA 2IUQA 5I5JA 3RSEC 4E5ZB 3UVLA 5EARA 3I8CA 3IIYA 1B9XA 4CY2A 4U1EI 2AH1A 4CI1A 4XEIC 2I0SA 4L3GD 3K26A 4JSNC 4PSXB 3SJLD 1SHYB
chains in the Genus database with same CATH superfamily
4ERZA 3MUNA 1OLZA 3ODTA 4Z7OA 2QC5A 3SHFA 2BCJB 5K19A 3IJ1A 4EWRA 3I7NA 2AGLA 4J77A 3JZGA 2VDOA 5M5RA 4E5ZA 5H17A 1GG2B 3BWSA 5IC7A 1O6GA 4PSWB 1C9LA 2VDQA 4AMZA 5GSAA 4IRZA 3AL8B 3UR4A 4L1QD 4CY5A 1ERJA 1JMXB 3SCYA 4I79A 2XL3A 5HE0B 3AH8B 3IJCA 2J57G 3FRXA 3MXXA 4PXWA 2XU7A 3N0EA 4AN1A 2P9UC 3C9CA 3OKWA 2YB8B 3VI3A 2QZPA 1VYHC 4E54B 3SXTD 4TZ4A 3AL8A 3V7DB 3A0FA 3O4HA 2H3XA 5FKTA 4Z8LA 4BUJC 2J56H 1N6EA 2IWFA 2I0RA 2IUVA 5EMMB 4GGDA 4J8BA 2UZXB 3DXKC 2TRCB 1B9YA 2YMUA 4J78A 1VZ3A 4N14A 4ZOVA 4BCCA 3K6SA 1A12A 2J55H 4ES0A 2VDPA 4CZXA 4GZ8A 4E54A 4U7AA 3NIDA 4DNWA 3CIKB 4GM9A 2B5NA 5H14A 2CNXA 4A2MA 2VC2A 4JD2C 3PXTD 4MMZA 1OMWB 3MZLA 3J81g 5CXCB 4GMBA 2I3TA 3GREA 3RN0D 3W15A 4FB1D 4G1MA 1MG2A 4GM8A 3T3MA 5HE2B 3IUJA 2H14A 3JB9L 2VZ3A 3P4FA 5HE3B 1I2MB 3FGBA 1P22A 4AX4A 2H9LA 2OVQB 2IURA 4UM8A 1GOHA 3J80g 5IGOA 3OF7A 4UI9R 3DXMC 2CO0A 1H2WA 2QR5A 4Y5RD 3UKUC 3EQ7A 4BH6A 4O45A 3EI4B 4QL1A 2OIZA 3KRXB 4D6VA 5HDBA 1U4CA 3FCUA 2Q7QA 3PVUB 4L1MA 5E6RA 3SBQA 5CXCA 1E5TA 4QRJA 1Q47A 4O02A 5CXBB 3UVMA 3SFZA 3VH0A 4K3JB 4BP9A 3ULEC 4ZN4A 5IJ8E 1U2VC 5FKSA 1QNIA 3IVMA 2P9LC 4A2LA 5C86A 5E6SA 2HU5A 2CO0C 3PVWB 4JSXC 4YVDA 4K3ID 3EI4A 5M5UA 5FXYA 2H6KA 2P9SC 1H2XA 1PEVA 5C9ZB 1YR2A 2AH0A 2YNPA 4KFMB 4L3HD 4QQEA 2EICA 4GQBB 2EIDA 3OTTA 4G56B 1JOFA 4BL0A 5CXBA 1N6DA 2OJYA 3T3PA 5EAPA 3I89A 5GMKn 4D0KA 1PGUA 1UOPA 3ZWLB 2W18A 3F3PA 4FA4D 3SLED 4AN0A 4FAND 3F3FA 1XKSA 2BKLA 3K71A 4NBMA 4AOWA 5M61A 2GC4A 1E8NA 3SWSD 3EU7A 1E8MA 4PC0A 2XDWA 3NVXA 4CI3A 3RLMD 5HE1B 4ESGA 4A0BB 4X3EA 4WJKA 3FCSA 4XYIA 3DWLC 3O4IA 2XYIA 1H2ZA 5B4WA 3EI2B 1GP2B 4X63B 3NVQA 5M5VA 2YBAA 4CI8A 2QXVA 3I7HA 4PNKB 5IJ7E 3K27A 3SMRA 4CI2A 5IT9g 1PI6A 1QFSA 3MVDK 2UZYB 4GGCA 2HKRA 2H6QA 3N0DA 3CFVA 4A0BA 2IWKA 4A7JA 3FM0A 2VZ1A 2Z2PA 3IURA 2B4EA 1JMZB 5AMSA 3EI2A 3EG6A 1BPOA 3ZE0A 1C9IA 1GXRA 4X60B 4QAMA 1VE7A 1YFQA 3PSLA 5FQDA 3OW8A 4ZOYA 3RN1D 2O9KA 3SBRA 3DDUA 1NR0A 2IAAA 3I7OA 4FHLA 1MG3A 4MMYA 5EALA 3KRWB 2HYEA 5EMLB 5H1MA 3B7FA 3SN6B 3IUQA 5TDHB 3MMYA 5THAA 2GC7A 3GC3B 5FKQA 4LG8A 2GNQA 2XE4A 2AGWA 4PBYA 4JT6C 2HU7A 2AGYA 3IUNA 3OL2B 3RMZD 2B5LA 3EQ9A 3PXSD 1N6FA 3U4YA 4X61B 2PBIB 4CC9A 4FWWA 3UKRC 3DSMA 4AEZA 2WQ8A 3IJ0A 3PXWD 2G9AA 4PBZA 1H2YA 5FA5B 1A0RB 4A09B 3C5MA 2H13A 4DNVA 2YNOA 2EIBA 2EBSA 2IUPA 2H9NA 5C2WB 4A0AB 3OL2A 3EMHA 3V4VA 4CZYA 1R5MA 4G55A 5CYKB 3I7KA 4R7AB 4BCBA 5GXIA 1QFMA 4FA5D 2PM7B 3CFSB 5HYNB 5M5TA 4RE6A 1L0QA 3NIFA 2XZGA 4JT5C 2I3SA 4A11B 4LG9A 4A09A 3EQ8A 1MDAH 1GOTB 1UOQA 4H5IA 4D9SA 4ZOXA 4CZVA 4IMMA 3ZDXA 1JTDB 1SQ9A 4A0AA 5KDOB 4CY1A 5CYKA 3JRPA 5A2Qg 1T2XA 2Z2OA 5K1CC 1UTCA 2H9MA 1SQJA 2H68A 3OKYB 3VGZA 3I7LA 5EM2B 3MUOA 3O4JA 4J8GA 4A11A 3EI1B 2CE8A 4OZUA 2CN3A 4Y7RA 3JZNA 2HJBA 4O3TB 4HDJA 3IUMA 4BCDA 2HU8A 4ZOZA 3JROA 4JHNA 3I2NA 2HKMA 3PE7A 3GD1I 1JV2A 5FKRA 3EWEA 1K32A 3OKYA 3L4MD 4Z7QA 4IA9A 3RFGA 4O9DA 5EM2A 5EMJB 3BG1A 3EI1A 2P9IC 1PBYB 3ZE1A 1TYQC 1TBGA 3O4GA 3ZE2A 2EIEA 1VE6A 3IJEA 1NEXB 5AFU3 4J82A 2PM9B 2H9PA 2VDLA 4NENA 2CN2A 4CY3A 1XHMA 3IKOA 3HFQA 1JJUB 4JHPC 3VI4A 2AQ5A 5FFGA 3BG0A 4J86A 5I5MA 4G1EA 3UVOA 1VZ2A 5FFOA 5JWZA 2CE9A 3IULA 2XL2A 2VDKA 2OK6A 3I7PA 4J79A 5TF2A 4OWRA 3RFHA 4BP8A 3JZHA 5C92A 3I8EA 5E6UA 3SJLD 3PSCB 4NC4A 4WK2A 2PM9A 3C75H 3JAMg 2AGXA 4QT8A 5IGQA 2OVRB 4GGAA 1GOFA 2Z2NA 2OVPB 4Z7NA 1K8KC 4NSXA 5EMKB 3V4PA 2HJ4A 4JSVC 5TEFA 2P9KC 3JPXA 4WK0A 3RRMC 3MKQA 4XYHA 3MKSB 3L4OD 5SXMA 3F3GA 3AFCA 4J87A 4UM9A 2VDNA 3OKTA 2P9NC 4ERQA 3UVNA 2PM6B 4JXMA 2H47A 4O3UB 1FWXA 3UVKA 3K72A 3ZDYA 2B5MA 3KCIA 2P9PC 3ORVD 1L5GA 5GXHA 3DM0A 1K3IA 4GQ2P 4LGNA 4GQ1A 3SBPA 3AL9A 5EAMA 1GOGA 4FA9D 3GFCA 3SVWD 1O6FA 4J73A 4H5JA 4J0XA 4DNUA 3EI3B 4A08B 5C2VB 3ZDZA 2JKXA 1M1XA 3VA6A 2I0TA 5I5IA 1TYEA 5FLXg 4MMXA 4FAVD 2VDMA 4O2WA 5AJAA 1RI6A 2HXCA 4J0WA 4FA1D 1U8CA 4AMYA 4L9OA 4O1QD 2H6NA 3IIWA 4J81A 4JSPC 4WK4A 3V9FA 3QHYB 4RE5A 1S4UX 4MK0B 4GM3A 2G99A 3NIGA 4J84A 1XIPA 2AGZA 3EI3A 4A08A 5M5SA 2BBKH 4ERYA 3V5WB 3E0CA 2MTAH 2YNNA 5HQGA 2HESX 3MZKA 3C99A 2OK4A 5TEEA 3NVNA 2IUQA 5I5JA 3RSEC 4E5ZB 3UVLA 5EARA 1UOOA 4NAAA 3I8CA 3IIYA 1B9XA 4CY2A 4U1EI 2AH1A 4CI1A 4XEIC 2I0SA 4L3GD 3K26A 4JSNC 4PSXB 2VDRA 3QI0A 1SHYB
chains in the Genus database with same CATH topology
4ERZA 1OLZA 3ODTA 2QC5A 3SHFA 2BCJB 5K19A 3IJ1A 4EWRA 3I7NA 2AGLA 4J77A 3JZGA 4E5ZA 5H17A 1GG2B 3BWSA 5IC7A 4PSWB 5GSAA 3AL8B 3UR4A 4L1QD 4CY5A 1ERJA 1JMXB 3SCYA 4I79A 2XL3A 5HE0B 3AH8B 3IJCA 2J57G 3FRXA 3MXXA 4PXWA 2XU7A 3N0EA 2P9UC 3C9CA 3OKWA 2YB8B 1VYHC 4E54B 3SXTD 4TZ4A 3AL8A 3V7DB 3A0FA 5FKTA 2H3XA 4Z8LA 4BUJC 2J56H 1N6EA 2IWFA 2I0RA 2IUVA 5EMMB 4GGDA 4J8BA 2UZXB 3DXKC 2TRCB 1B9YA 2YMUA 4J78A 4N14A 4ZOVA 2J55H 4ES0A 4CZXA 4GZ8A 4E54A 4U7AA 3CIKB 4GM9A 2B5NA 5H14A 2CNXA 4A2MA 4JD2C 3PXTD 1OMWB 3MZLA 3J81g 5CXCB 4GMBA 2I3TA 3GREA 3RN0D 3W15A 4FB1D 1MG2A 4GM8A 5HE2B 2H14A 3JB9L 3P4FA 5HE3B 3FGBA 1P22A 2H9LA 2OVQB 2IURA 3J80g 5IGOA 4UI9R 3DXMC 2CO0A 4Y5RD 3UKUC 4BH6A 4O45A 3EI4B 4QL1A 2OIZA 3KRXB 4D6VA 3SBQA 1U4CA 2Q7QA 3PVUB 5CXCA 4QRJA 1Q47A 5CXBB 3UVMA 3SFZA 3VH0A 4K3JB 3ULEC 4ZN4A 5IJ8E 1U2VC 5FKSA 1QNIA 4A2LA 2P9LC 2CO0C 3PVWB 4JSXC 4YVDA 4K3ID 3EI4A 5FXYA 2H6KA 2P9SC 1PEVA 5C9ZB 2AH0A 2YNPA 4KFMB 4L3HD 4QQEA 4GQBB 3OTTA 4G56B 1JOFA 4BL0A 5CXBA 1N6DA 2OJYA 5EAPA 3I89A 5GMKn 4D0KA 1PGUA 3ZWLB 2W18A 3F3PA 4FA4D 3SLED 4FAND 3F3FA 1XKSA 4AOWA 2GC4A 3SWSD 3EU7A 4PC0A 3NVXA 4CI3A 3RLMD 5HE1B 4ESGA 4A0BB 4X3EA 4XYIA 3DWLC 2XYIA 5B4WA 3EI2B 1GP2B 4X63B 3NVQA 2YBAA 4CI8A 2QXVA 3I7HA 4PNKB 5IJ7E 3K27A 3SMRA 4CI2A 5IT9g 1PI6A 2UZYB 4GGCA 2HKRA 2H6QA 3N0DA 3CFVA 4A0BA 2IWKA 4A7JA 3FM0A 2Z2PA 2B4EA 1JMZB 5AMSA 3EI2A 3EG6A 1GXRA 4X60B 3PSLA 1YFQA 5FQDA 4ZOYA 3OW8A 3RN1D 2O9KA 3SBRA 1NR0A 2IAAA 3I7OA 4FHLA 1MG3A 5EALA 3KRWB 2HYEA 5EMLB 5H1MA 3B7FA 3SN6B 5TDHB 3MMYA 5THAA 2GC7A 5FKQA 4LG8A 2GNQA 2AGWA 4PBYA 4JT6C 2AGYA 3OL2B 3RMZD 2B5LA 3PXSD 3U4YA 1N6FA 4X61B 2PBIB 4CC9A 4FWWA 3UKRC 3DSMA 4AEZA 3IJ0A 3PXWD 2G9AA 4PBZA 5FA5B 1A0RB 4A09B 3C5MA 2H13A 2YNOA 2EBSA 2IUPA 2H9NA 5C2WB 4A0AB 3OL2A 3EMHA 4CZYA 1R5MA 5CYKB 3I7KA 4R7AB 5GXIA 4FA5D 2PM7B 3CFSB 5HYNB 1L0QA 4JT5C 2I3SA 4A11B 4LG9A 4A09A 1MDAH 1GOTB 4H5IA 4ZOXA 4CZVA 4IMMA 1SQ9A 4A0AA 5KDOB 4CY1A 5CYKA 3JRPA 5A2Qg 5K1CC 2Z2OA 2H9MA 1SQJA 2H68A 3OKYB 3VGZA 3I7LA 5EM2B 4J8GA 4A11A 3EI1B 2CE8A 4OZUA 2CN3A 4Y7RA 3JZNA 2HJBA 4O3TB 4HDJA 4ZOZA 3JROA 3I2NA 2HKMA 3PE7A 5FKRA 3EWEA 1K32A 3OKYA 3L4MD 4IA9A 3RFGA 4O9DA 5EM2A 5EMJB 3BG1A 3EI1A 2P9IC 1PBYB 1TYQC 1TBGA 1NEXB 5AFU3 4J82A 2PM9B 2H9PA 2CN2A 4CY3A 1XHMA 3IKOA 3HFQA 1JJUB 2AQ5A 3BG0A 4J86A 5I5MA 3UVOA 5JWZA 2CE9A 2XL2A 3I7PA 2OK6A 4J79A 5TF2A 4OWRA 3RFHA 3JZHA 3I8EA 3PSCB 2PM9A 3C75H 3JAMg 2AGXA 4QT8A 5IGQA 2OVRB 4GGAA 2Z2NA 2OVPB 1K8KC 4NSXA 5EMKB 2HJ4A 4JSVC 5TEFA 2P9KC 3JPXA 3RRMC 3MKQA 4XYHA 3MKSB 3L4OD 5SXMA 3F3GA 3AFCA 4J87A 3OKTA 2P9NC 4ERQA 3UVNA 2PM6B 4JXMA 2H47A 4O3UB 1FWXA 3UVKA 2B5MA 2P9PC 3ORVD 5GXHA 3DM0A 4LGNA 4GQ2P 4GQ1A 3SBPA 3AL9A 5EAMA 4FA9D 3GFCA 3SVWD 4J73A 4H5JA 4J0XA 4A08B 3EI3B 5C2VB 3VA6A 2I0TA 5I5IA 5FLXg 4FAVD 5AJAA 1RI6A 2HXCA 4J0WA 4FA1D 4L9OA 4O1QD 2H6NA 3IIWA 4J81A 4JSPC 3V9FA 1S4UX 4MK0B 4GM3A 2G99A 4J84A 1XIPA 2AGZA 3EI3A 4A08A 2BBKH 4ERYA 3V5WB 3E0CA 2MTAH 2YNNA 5HQGA 2HESX 3MZKA 3C99A 2OK4A 5TEEA 3NVNA 2IUQA 5I5JA 3RSEC 4E5ZB 3UVLA 5EARA 3I8CA 3IIYA 1B9XA 4CY2A 4U1EI 2AH1A 4CI1A 4XEIC 2I0SA 4L3GD 3K26A 4JSNC 4PSXB 3SJLD 1SHYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ERZ A;  1OLZ A;  3ODT A;  2QC5 A;  3SHF A;  2BCJ B;  5K19 A;  3IJ1 A;  4EWR A;  3I7N A;  2AGL A;  4J77 A;  3JZG A;  4E5Z A;  5H17 A;  1GG2 B;  3BWS A;  5IC7 A;  4PSW B;  5GSA A;  3AL8 B;  3UR4 A;  4L1Q D;  4CY5 A;  1ERJ A;  1JMX B;  3SCY A;  4I79 A;  2XL3 A;  5HE0 B;  3AH8 B;  3IJC A;  2J57 G;  3FRX A;  3MXX A;  4PXW A;  2XU7 A;  3N0E A;  2P9U C;  3C9C A;  3OKW A;  2YB8 B;  1VYH C;  4E54 B;  3SXT D;  4TZ4 A;  3AL8 A;  3V7D B;  3A0F A;  5FKT A;  2H3X A;  4Z8L A;  4BUJ C;  2J56 H;  1N6E A;  2IWF A;  2I0R A;  2IUV A;  5EMM B;  4GGD A;  4J8B A;  2UZX B;  3DXK C;  2TRC B;  1B9Y A;  2YMU A;  4J78 A;  4N14 A;  4ZOV A;  2J55 H;  4ES0 A;  4CZX A;  4GZ8 A;  4E54 A;  4U7A A;  3CIK B;  4GM9 A;  2B5N A;  5H14 A;  2CNX A;  4A2M A;  4JD2 C;  3PXT D;  1OMW B;  3MZL A;  3J81 g;  5CXC B;  4GMB A;  2I3T A;  3GRE A;  3RN0 D;  3W15 A;  4FB1 D;  1MG2 A;  4GM8 A;  5HE2 B;  2H14 A;  3JB9 L;  3P4F A;  5HE3 B;  3FGB A;  1P22 A;  2H9L A;  2OVQ B;  2IUR A;  3J80 g;  5IGO A;  4UI9 R;  3DXM C;  2CO0 A;  4Y5R D;  3UKU C;  4BH6 A;  4O45 A;  3EI4 B;  4QL1 A;  2OIZ A;  3KRX B;  4D6V A;  3SBQ A;  1U4C A;  2Q7Q A;  3PVU B;  5CXC A;  4QRJ A;  1Q47 A;  5CXB B;  3UVM A;  3SFZ A;  3VH0 A;  4K3J B;  3ULE C;  4ZN4 A;  5IJ8 E;  1U2V C;  5FKS A;  1QNI A;  4A2L A;  2P9L C;  2CO0 C;  3PVW B;  4JSX C;  4YVD A;  4K3I D;  3EI4 A;  5FXY A;  2H6K A;  2P9S C;  1PEV A;  5C9Z B;  2AH0 A;  2YNP A;  4KFM B;  4L3H D;  4QQE A;  4GQB B;  3OTT A;  4G56 B;  1JOF A;  4BL0 A;  5CXB A;  1N6D A;  2OJY A;  5EAP A;  3I89 A;  5GMK n;  4D0K A;  1PGU A;  3ZWL B;  2W18 A;  3F3P A;  4FA4 D;  3SLE D;  4FAN D;  3F3F A;  1XKS A;  4AOW A;  2GC4 A;  3SWS D;  3EU7 A;  4PC0 A;  3NVX A;  4CI3 A;  3RLM D;  5HE1 B;  4ESG A;  4A0B B;  4X3E A;  4XYI A;  3DWL C;  2XYI A;  5B4W A;  3EI2 B;  1GP2 B;  4X63 B;  3NVQ A;  2YBA A;  4CI8 A;  2QXV A;  3I7H A;  4PNK B;  5IJ7 E;  3K27 A;  3SMR A;  4CI2 A;  5IT9 g;  1PI6 A;  2UZY B;  4GGC A;  2HKR A;  2H6Q A;  3N0D A;  3CFV A;  4A0B A;  2IWK A;  4A7J A;  3FM0 A;  2Z2P A;  2B4E A;  1JMZ B;  5AMS A;  3EI2 A;  3EG6 A;  1GXR A;  4X60 B;  3PSL A;  1YFQ A;  5FQD A;  4ZOY A;  3OW8 A;  3RN1 D;  2O9K A;  3SBR A;  1NR0 A;  2IAA A;  3I7O A;  4FHL A;  1MG3 A;  5EAL A;  3KRW B;  2HYE A;  5EML B;  5H1M A;  3B7F A;  3SN6 B;  5TDH B;  3MMY A;  5THA A;  2GC7 A;  5FKQ A;  4LG8 A;  2GNQ A;  2AGW A;  4PBY A;  4JT6 C;  2AGY A;  3OL2 B;  3RMZ D;  2B5L A;  3PXS D;  3U4Y A;  1N6F A;  4X61 B;  2PBI B;  4CC9 A;  4FWW A;  3UKR C;  3DSM A;  4AEZ A;  3IJ0 A;  3PXW D;  2G9A A;  4PBZ A;  5FA5 B;  1A0R B;  4A09 B;  3C5M A;  2H13 A;  2YNO A;  2EBS A;  2IUP A;  2H9N A;  5C2W B;  4A0A B;  3OL2 A;  3EMH A;  4CZY A;  1R5M A;  5CYK B;  3I7K A;  4R7A B;  5GXI A;  4FA5 D;  2PM7 B;  3CFS B;  5HYN B;  1L0Q A;  4JT5 C;  2I3S A;  4A11 B;  4LG9 A;  4A09 A;  1MDA H;  1GOT B;  4H5I A;  4ZOX A;  4CZV A;  4IMM A;  1SQ9 A;  4A0A A;  5KDO B;  4CY1 A;  5CYK A;  3JRP A;  5A2Q g;  5K1C C;  2Z2O A;  2H9M A;  1SQJ A;  2H68 A;  3OKY B;  3VGZ A;  3I7L A;  5EM2 B;  4J8G A;  4A11 A;  3EI1 B;  2CE8 A;  4OZU A;  2CN3 A;  4Y7R A;  3JZN A;  2HJB A;  4O3T B;  4HDJ A;  4ZOZ A;  3JRO A;  3I2N A;  2HKM A;  3PE7 A;  5FKR A;  3EWE A;  1K32 A;  3OKY A;  3L4M D;  4IA9 A;  3RFG A;  4O9D A;  5EM2 A;  5EMJ B;  3BG1 A;  3EI1 A;  2P9I C;  1PBY B;  1TYQ C;  1TBG A;  1NEX B;  5AFU 3;  4J82 A;  2PM9 B;  2H9P A;  2CN2 A;  4CY3 A;  1XHM A;  3IKO A;  3HFQ A;  1JJU B;  2AQ5 A;  3BG0 A;  4J86 A;  5I5M A;  3UVO A;  5JWZ A;  2CE9 A;  2XL2 A;  3I7P A;  2OK6 A;  4J79 A;  5TF2 A;  4OWR A;  3RFH A;  3JZH A;  3I8E A;  3PSC B;  2PM9 A;  3C75 H;  3JAM g;  2AGX A;  4QT8 A;  5IGQ A;  2OVR B;  4GGA A;  2Z2N A;  2OVP B;  1K8K C;  4NSX A;  5EMK B;  2HJ4 A;  4JSV C;  5TEF A;  2P9K C;  3JPX A;  3RRM C;  3MKQ A;  4XYH A;  3MKS B;  3L4O D;  5SXM A;  3F3G A;  3AFC A;  4J87 A;  3OKT A;  2P9N C;  4ERQ A;  3UVN A;  2PM6 B;  4JXM A;  2H47 A;  4O3U B;  1FWX A;  3UVK A;  2B5M A;  2P9P C;  3ORV D;  5GXH A;  3DM0 A;  4LGN A;  4GQ2 P;  4GQ1 A;  3SBP A;  3AL9 A;  5EAM A;  4FA9 D;  3GFC A;  3SVW D;  4J73 A;  4H5J A;  4J0X A;  4A08 B;  3EI3 B;  5C2V B;  3VA6 A;  2I0T A;  5I5I A;  5FLX g;  4FAV D;  5AJA A;  1RI6 A;  2HXC A;  4J0W A;  4FA1 D;  4L9O A;  4O1Q D;  2H6N A;  3IIW A;  4J81 A;  4JSP C;  3V9F A;  1S4U X;  4MK0 B;  4GM3 A;  2G99 A;  4J84 A;  1XIP A;  2AGZ A;  3EI3 A;  4A08 A;  2BBK H;  4ERY A;  3V5W B;  3E0C A;  2MTA H;  2YNN A;  5HQG A;  2HES X;  3MZK A;  3C99 A;  2OK4 A;  5TEE A;  3NVN A;  2IUQ A;  5I5J A;  3RSE C;  4E5Z B;  3UVL A;  5EAR A;  3I8C A;  3IIY A;  1B9X A;  4CY2 A;  4U1E I;  2AH1 A;  4CI1 A;  4XEI C;  2I0S A;  4L3G D;  3K26 A;  4JSN C;  4PSX B;  3SJL D;  1SHY B; 
#chains in the Genus database with same CATH topology
 4ERZ A;  3MUN A;  1OLZ A;  3ODT A;  4Z7O A;  2QC5 A;  3SHF A;  2BCJ B;  5K19 A;  3IJ1 A;  4EWR A;  3I7N A;  2AGL A;  4J77 A;  3JZG A;  2VDO A;  5M5R A;  4E5Z A;  5H17 A;  1GG2 B;  3BWS A;  5IC7 A;  1O6G A;  4PSW B;  1C9L A;  2VDQ A;  4AMZ A;  5GSA A;  4IRZ A;  3AL8 B;  3UR4 A;  4L1Q D;  4CY5 A;  1ERJ A;  1JMX B;  3SCY A;  4I79 A;  2XL3 A;  5HE0 B;  3AH8 B;  3IJC A;  2J57 G;  3FRX A;  3MXX A;  4PXW A;  2XU7 A;  3N0E A;  4AN1 A;  2P9U C;  3C9C A;  3OKW A;  2YB8 B;  3VI3 A;  2QZP A;  1VYH C;  4E54 B;  3SXT D;  4TZ4 A;  3AL8 A;  3V7D B;  3A0F A;  3O4H A;  2H3X A;  5FKT A;  4Z8L A;  4BUJ C;  2J56 H;  1N6E A;  2IWF A;  2I0R A;  2IUV A;  5EMM B;  4GGD A;  4J8B A;  2UZX B;  3DXK C;  2TRC B;  1B9Y A;  2YMU A;  4J78 A;  1VZ3 A;  4N14 A;  4ZOV A;  4BCC A;  3K6S A;  1A12 A;  2J55 H;  4ES0 A;  2VDP A;  4CZX A;  4GZ8 A;  4E54 A;  4U7A A;  3NID A;  4DNW A;  3CIK B;  4GM9 A;  2B5N A;  5H14 A;  2CNX A;  4A2M A;  2VC2 A;  4JD2 C;  3PXT D;  4MMZ A;  1OMW B;  3MZL A;  3J81 g;  5CXC B;  4GMB A;  2I3T A;  3GRE A;  3RN0 D;  3W15 A;  4FB1 D;  4G1M A;  1MG2 A;  4GM8 A;  3T3M A;  5HE2 B;  3IUJ A;  2H14 A;  3JB9 L;  2VZ3 A;  3P4F A;  5HE3 B;  1I2M B;  3FGB A;  1P22 A;  4AX4 A;  2H9L A;  2OVQ B;  2IUR A;  4UM8 A;  1GOH A;  3J80 g;  5IGO A;  3OF7 A;  4UI9 R;  3DXM C;  2CO0 A;  1H2W A;  2QR5 A;  4Y5R D;  3UKU C;  3EQ7 A;  4BH6 A;  4O45 A;  3EI4 B;  4QL1 A;  2OIZ A;  3KRX B;  4D6V A;  5HDB A;  1U4C A;  3FCU A;  2Q7Q A;  3PVU B;  4L1M A;  5E6R A;  3SBQ A;  5CXC A;  1E5T A;  4QRJ A;  1Q47 A;  4O02 A;  5CXB B;  3UVM A;  3SFZ A;  3VH0 A;  4K3J B;  4BP9 A;  3ULE C;  4ZN4 A;  5IJ8 E;  1U2V C;  5FKS A;  1QNI A;  3IVM A;  2P9L C;  4A2L A;  5C86 A;  5E6S A;  2HU5 A;  2CO0 C;  3PVW B;  4JSX C;  4YVD A;  4K3I D;  3EI4 A;  5M5U A;  5FXY A;  2H6K A;  2P9S C;  1H2X A;  1PEV A;  5C9Z B;  1YR2 A;  2AH0 A;  2YNP A;  4KFM B;  4L3H D;  4QQE A;  2EIC A;  4GQB B;  2EID A;  3OTT A;  4G56 B;  1JOF A;  4BL0 A;  5CXB A;  1N6D A;  2OJY A;  3T3P A;  5EAP A;  3I89 A;  5GMK n;  4D0K A;  1PGU A;  1UOP A;  3ZWL B;  2W18 A;  3F3P A;  4FA4 D;  3SLE D;  4AN0 A;  4FAN D;  3F3F A;  1XKS A;  2BKL A;  3K71 A;  4NBM A;  4AOW A;  5M61 A;  2GC4 A;  1E8N A;  3SWS D;  3EU7 A;  1E8M A;  4PC0 A;  2XDW A;  3NVX A;  4CI3 A;  3RLM D;  5HE1 B;  4ESG A;  4A0B B;  4X3E A;  4WJK A;  3FCS A;  4XYI A;  3DWL C;  3O4I A;  2XYI A;  1H2Z A;  5B4W A;  3EI2 B;  1GP2 B;  4X63 B;  3NVQ A;  5M5V A;  2YBA A;  4CI8 A;  2QXV A;  3I7H A;  4PNK B;  5IJ7 E;  3K27 A;  3SMR A;  4CI2 A;  5IT9 g;  1PI6 A;  1QFS A;  3MVD K;  2UZY B;  4GGC A;  2HKR A;  2H6Q A;  3N0D A;  3CFV A;  4A0B A;  2IWK A;  4A7J A;  3FM0 A;  2VZ1 A;  2Z2P A;  3IUR A;  2B4E A;  1JMZ B;  5AMS A;  3EI2 A;  3EG6 A;  1BPO A;  3ZE0 A;  1C9I A;  1GXR A;  4X60 B;  4QAM A;  1VE7 A;  1YFQ A;  3PSL A;  5FQD A;  3OW8 A;  4ZOY A;  3RN1 D;  2O9K A;  3SBR A;  3DDU A;  1NR0 A;  2IAA A;  3I7O A;  4FHL A;  1MG3 A;  4MMY A;  5EAL A;  3KRW B;  2HYE A;  5EML B;  5H1M A;  3B7F A;  3SN6 B;  3IUQ A;  5TDH B;  3MMY A;  5THA A;  2GC7 A;  3GC3 B;  5FKQ A;  4LG8 A;  2GNQ A;  2XE4 A;  2AGW A;  4PBY A;  4JT6 C;  2HU7 A;  2AGY A;  3IUN A;  3OL2 B;  3RMZ D;  2B5L A;  3EQ9 A;  3PXS D;  1N6F A;  3U4Y A;  4X61 B;  2PBI B;  4CC9 A;  4FWW A;  3UKR C;  3DSM A;  4AEZ A;  2WQ8 A;  3IJ0 A;  3PXW D;  2G9A A;  4PBZ A;  1H2Y A;  5FA5 B;  1A0R B;  4A09 B;  3C5M A;  2H13 A;  4DNV A;  2YNO A;  2EIB A;  2EBS A;  2IUP A;  2H9N A;  5C2W B;  4A0A B;  3OL2 A;  3EMH A;  3V4V A;  4CZY A;  1R5M A;  4G55 A;  5CYK B;  3I7K A;  4R7A B;  4BCB A;  5GXI A;  1QFM A;  4FA5 D;  2PM7 B;  3CFS B;  5HYN B;  5M5T A;  4RE6 A;  1L0Q A;  3NIF A;  2XZG A;  4JT5 C;  2I3S A;  4A11 B;  4LG9 A;  4A09 A;  3EQ8 A;  1MDA H;  1GOT B;  1UOQ A;  4H5I A;  4D9S A;  4ZOX A;  4CZV A;  4IMM A;  3ZDX A;  1JTD B;  1SQ9 A;  4A0A A;  5KDO B;  4CY1 A;  5CYK A;  3JRP A;  5A2Q g;  1T2X A;  2Z2O A;  5K1C C;  1UTC A;  2H9M A;  1SQJ A;  2H68 A;  3OKY B;  3VGZ A;  3I7L A;  5EM2 B;  3MUO A;  3O4J A;  4J8G A;  4A11 A;  3EI1 B;  2CE8 A;  4OZU A;  2CN3 A;  4Y7R A;  3JZN A;  2HJB A;  4O3T B;  4HDJ A;  3IUM A;  4BCD A;  2HU8 A;  4ZOZ A;  3JRO A;  4JHN A;  3I2N A;  2HKM A;  3PE7 A;  3GD1 I;  1JV2 A;  5FKR A;  3EWE A;  1K32 A;  3OKY A;  3L4M D;  4Z7Q A;  4IA9 A;  3RFG A;  4O9D A;  5EM2 A;  5EMJ B;  3BG1 A;  3EI1 A;  2P9I C;  1PBY B;  3ZE1 A;  1TYQ C;  1TBG A;  3O4G A;  3ZE2 A;  2EIE A;  1VE6 A;  3IJE A;  1NEX B;  5AFU 3;  4J82 A;  2PM9 B;  2H9P A;  2VDL A;  4NEN A;  2CN2 A;  4CY3 A;  1XHM A;  3IKO A;  3HFQ A;  1JJU B;  4JHP C;  3VI4 A;  2AQ5 A;  5FFG A;  3BG0 A;  4J86 A;  5I5M A;  4G1E A;  3UVO A;  1VZ2 A;  5FFO A;  5JWZ A;  2CE9 A;  3IUL A;  2XL2 A;  2VDK A;  2OK6 A;  3I7P A;  4J79 A;  5TF2 A;  4OWR A;  3RFH A;  4BP8 A;  3JZH A;  5C92 A;  3I8E A;  5E6U A;  3SJL D;  3PSC B;  4NC4 A;  4WK2 A;  2PM9 A;  3C75 H;  3JAM g;  2AGX A;  4QT8 A;  5IGQ A;  2OVR B;  4GGA A;  1GOF A;  2Z2N A;  2OVP B;  4Z7N A;  1K8K C;  4NSX A;  5EMK B;  3V4P A;  2HJ4 A;  4JSV C;  5TEF A;  2P9K C;  3JPX A;  4WK0 A;  3RRM C;  3MKQ A;  4XYH A;  3MKS B;  3L4O D;  5SXM A;  3F3G A;  3AFC A;  4J87 A;  4UM9 A;  2VDN A;  3OKT A;  2P9N C;  4ERQ A;  3UVN A;  2PM6 B;  4JXM A;  2H47 A;  4O3U B;  1FWX A;  3UVK A;  3K72 A;  3ZDY A;  2B5M A;  3KCI A;  2P9P C;  3ORV D;  1L5G A;  5GXH A;  3DM0 A;  1K3I A;  4GQ2 P;  4LGN A;  4GQ1 A;  3SBP A;  3AL9 A;  5EAM A;  1GOG A;  4FA9 D;  3GFC A;  3SVW D;  1O6F A;  4J73 A;  4H5J A;  4J0X A;  4DNU A;  3EI3 B;  4A08 B;  5C2V B;  3ZDZ A;  2JKX A;  1M1X A;  3VA6 A;  2I0T A;  5I5I A;  1TYE A;  5FLX g;  4MMX A;  4FAV D;  2VDM A;  4O2W A;  5AJA A;  1RI6 A;  2HXC A;  4J0W A;  4FA1 D;  1U8C A;  4AMY A;  4L9O A;  4O1Q D;  2H6N A;  3IIW A;  4J81 A;  4JSP C;  4WK4 A;  3V9F A;  3QHY B;  4RE5 A;  1S4U X;  4MK0 B;  4GM3 A;  2G99 A;  3NIG A;  4J84 A;  1XIP A;  2AGZ A;  3EI3 A;  4A08 A;  5M5S A;  2BBK H;  4ERY A;  3V5W B;  3E0C A;  2MTA H;  2YNN A;  5HQG A;  2HES X;  3MZK A;  3C99 A;  2OK4 A;  5TEE A;  3NVN A;  2IUQ A;  5I5J A;  3RSE C;  4E5Z B;  3UVL A;  5EAR A;  1UOO A;  4NAA A;  3I8C A;  3IIY A;  1B9X A;  4CY2 A;  4U1E I;  2AH1 A;  4CI1 A;  4XEI C;  2I0S A;  4L3G D;  3K26 A;  4JSN C;  4PSX B;  2VDR A;  3QI0 A;  1SHY B; 
#chains in the Genus database with same CATH homology
 4ERZ A;  1OLZ A;  3ODT A;  2QC5 A;  3SHF A;  2BCJ B;  5K19 A;  3IJ1 A;  4EWR A;  3I7N A;  2AGL A;  4J77 A;  3JZG A;  4E5Z A;  5H17 A;  1GG2 B;  3BWS A;  5IC7 A;  4PSW B;  5GSA A;  3AL8 B;  3UR4 A;  4L1Q D;  4CY5 A;  1ERJ A;  1JMX B;  3SCY A;  4I79 A;  2XL3 A;  5HE0 B;  3AH8 B;  3IJC A;  2J57 G;  3FRX A;  3MXX A;  4PXW A;  2XU7 A;  3N0E A;  2P9U C;  3C9C A;  3OKW A;  2YB8 B;  1VYH C;  4E54 B;  3SXT D;  4TZ4 A;  3AL8 A;  3V7D B;  3A0F A;  5FKT A;  2H3X A;  4Z8L A;  4BUJ C;  2J56 H;  1N6E A;  2IWF A;  2I0R A;  2IUV A;  5EMM B;  4GGD A;  4J8B A;  2UZX B;  3DXK C;  2TRC B;  1B9Y A;  2YMU A;  4J78 A;  4N14 A;  4ZOV A;  2J55 H;  4ES0 A;  4CZX A;  4GZ8 A;  4E54 A;  4U7A A;  3CIK B;  4GM9 A;  2B5N A;  5H14 A;  2CNX A;  4A2M A;  4JD2 C;  3PXT D;  1OMW B;  3MZL A;  3J81 g;  5CXC B;  4GMB A;  2I3T A;  3GRE A;  3RN0 D;  3W15 A;  4FB1 D;  1MG2 A;  4GM8 A;  5HE2 B;  2H14 A;  3JB9 L;  3P4F A;  5HE3 B;  3FGB A;  1P22 A;  2H9L A;  2OVQ B;  2IUR A;  3J80 g;  5IGO A;  4UI9 R;  3DXM C;  2CO0 A;  4Y5R D;  3UKU C;  4BH6 A;  4O45 A;  3EI4 B;  4QL1 A;  2OIZ A;  3KRX B;  4D6V A;  3SBQ A;  1U4C A;  2Q7Q A;  3PVU B;  5CXC A;  4QRJ A;  1Q47 A;  5CXB B;  3UVM A;  3SFZ A;  3VH0 A;  4K3J B;  3ULE C;  4ZN4 A;  5IJ8 E;  1U2V C;  5FKS A;  1QNI A;  4A2L A;  2P9L C;  2CO0 C;  3PVW B;  4JSX C;  4YVD A;  4K3I D;  3EI4 A;  5FXY A;  2H6K A;  2P9S C;  1PEV A;  5C9Z B;  2AH0 A;  2YNP A;  4KFM B;  4L3H D;  4QQE A;  4GQB B;  3OTT A;  4G56 B;  1JOF A;  4BL0 A;  5CXB A;  1N6D A;  2OJY A;  5EAP A;  3I89 A;  5GMK n;  4D0K A;  1PGU A;  3ZWL B;  2W18 A;  3F3P A;  4FA4 D;  3SLE D;  4FAN D;  3F3F A;  1XKS A;  4AOW A;  2GC4 A;  3SWS D;  3EU7 A;  4PC0 A;  3NVX A;  4CI3 A;  3RLM D;  5HE1 B;  4ESG A;  4A0B B;  4X3E A;  4XYI A;  3DWL C;  2XYI A;  5B4W A;  3EI2 B;  1GP2 B;  4X63 B;  3NVQ A;  2YBA A;  4CI8 A;  2QXV A;  3I7H A;  4PNK B;  5IJ7 E;  3K27 A;  3SMR A;  4CI2 A;  5IT9 g;  1PI6 A;  2UZY B;  4GGC A;  2HKR A;  2H6Q A;  3N0D A;  3CFV A;  4A0B A;  2IWK A;  4A7J A;  3FM0 A;  2Z2P A;  2B4E A;  1JMZ B;  5AMS A;  3EI2 A;  3EG6 A;  1GXR A;  4X60 B;  3PSL A;  1YFQ A;  5FQD A;  4ZOY A;  3OW8 A;  3RN1 D;  2O9K A;  3SBR A;  1NR0 A;  2IAA A;  3I7O A;  4FHL A;  1MG3 A;  5EAL A;  3KRW B;  2HYE A;  5EML B;  5H1M A;  3B7F A;  3SN6 B;  5TDH B;  3MMY A;  5THA A;  2GC7 A;  5FKQ A;  4LG8 A;  2GNQ A;  2AGW A;  4PBY A;  4JT6 C;  2AGY A;  3OL2 B;  3RMZ D;  2B5L A;  3PXS D;  3U4Y A;  1N6F A;  4X61 B;  2PBI B;  4CC9 A;  4FWW A;  3UKR C;  3DSM A;  4AEZ A;  3IJ0 A;  3PXW D;  2G9A A;  4PBZ A;  5FA5 B;  1A0R B;  4A09 B;  3C5M A;  2H13 A;  2YNO A;  2EBS A;  2IUP A;  2H9N A;  5C2W B;  4A0A B;  3OL2 A;  3EMH A;  4CZY A;  1R5M A;  5CYK B;  3I7K A;  4R7A B;  5GXI A;  4FA5 D;  2PM7 B;  3CFS B;  5HYN B;  1L0Q A;  4JT5 C;  2I3S A;  4A11 B;  4LG9 A;  4A09 A;  1MDA H;  1GOT B;  4H5I A;  4ZOX A;  4CZV A;  4IMM A;  1SQ9 A;  4A0A A;  5KDO B;  4CY1 A;  5CYK A;  3JRP A;  5A2Q g;  5K1C C;  2Z2O A;  2H9M A;  1SQJ A;  2H68 A;  3OKY B;  3VGZ A;  3I7L A;  5EM2 B;  4J8G A;  4A11 A;  3EI1 B;  2CE8 A;  4OZU A;  2CN3 A;  4Y7R A;  3JZN A;  2HJB A;  4O3T B;  4HDJ A;  4ZOZ A;  3JRO A;  3I2N A;  2HKM A;  3PE7 A;  5FKR A;  3EWE A;  1K32 A;  3OKY A;  3L4M D;  4IA9 A;  3RFG A;  4O9D A;  5EM2 A;  5EMJ B;  3BG1 A;  3EI1 A;  2P9I C;  1PBY B;  1TYQ C;  1TBG A;  1NEX B;  5AFU 3;  4J82 A;  2PM9 B;  2H9P A;  2CN2 A;  4CY3 A;  1XHM A;  3IKO A;  3HFQ A;  1JJU B;  2AQ5 A;  3BG0 A;  4J86 A;  5I5M A;  3UVO A;  5JWZ A;  2CE9 A;  2XL2 A;  3I7P A;  2OK6 A;  4J79 A;  5TF2 A;  4OWR A;  3RFH A;  3JZH A;  3I8E A;  3PSC B;  2PM9 A;  3C75 H;  3JAM g;  2AGX A;  4QT8 A;  5IGQ A;  2OVR B;  4GGA A;  2Z2N A;  2OVP B;  1K8K C;  4NSX A;  5EMK B;  2HJ4 A;  4JSV C;  5TEF A;  2P9K C;  3JPX A;  3RRM C;  3MKQ A;  4XYH A;  3MKS B;  3L4O D;  5SXM A;  3F3G A;  3AFC A;  4J87 A;  3OKT A;  2P9N C;  4ERQ A;  3UVN A;  2PM6 B;  4JXM A;  2H47 A;  4O3U B;  1FWX A;  3UVK A;  2B5M A;  2P9P C;  3ORV D;  5GXH A;  3DM0 A;  4LGN A;  4GQ2 P;  4GQ1 A;  3SBP A;  3AL9 A;  5EAM A;  4FA9 D;  3GFC A;  3SVW D;  4J73 A;  4H5J A;  4J0X A;  4A08 B;  3EI3 B;  5C2V B;  3VA6 A;  2I0T A;  5I5I A;  5FLX g;  4FAV D;  5AJA A;  1RI6 A;  2HXC A;  4J0W A;  4FA1 D;  4L9O A;  4O1Q D;  2H6N A;  3IIW A;  4J81 A;  4JSP C;  3V9F A;  1S4U X;  4MK0 B;  4GM3 A;  2G99 A;  4J84 A;  1XIP A;  2AGZ A;  3EI3 A;  4A08 A;  2BBK H;  4ERY A;  3V5W B;  3E0C A;  2MTA H;  2YNN A;  5HQG A;  2HES X;  3MZK A;  3C99 A;  2OK4 A;  5TEE A;  3NVN A;  2IUQ A;  5I5J A;  3RSE C;  4E5Z B;  3UVL A;  5EAR A;  3I8C A;  3IIY A;  1B9X A;  4CY2 A;  4U1E I;  2AH1 A;  4CI1 A;  4XEI C;  2I0S A;  4L3G D;  3K26 A;  4JSN C;  4PSX B;  3SJL D;  1SHY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...