3N0EA

Crystal structure of wdr5 mutant (w330y)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
315
Chain Sequence
GGQQMGRGSEFVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLYKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title The Effect of Asp-His-Ser/Thr-Trp Tetrad on the Thermostability of WD40-Repeat Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 94
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3n0eA00
5THAA 3VH0A 4N14A 2J55H 4BUJC 4E5ZB 3SCYA 3JPXA 1OMWB 5KDOB 5CXBA 3MMYA 4PXWA 4FAVD 2AGWA 3RMZD 3F3FA 2YNPA 3GREA 4FA4D 4GM9A 2EBSA 1U4CA 4QQEA 3CIKB 3KRXB 3PSCB 4CI3A 2HESX 3N0EA 4L3GD 5FKQA 2OJYA 4CZYA 1VYHC 4A11B 3JZGA 5B4WA 1JJUB 5EMLB 3EMHA 1L0QA 4PNKB 1Q47A 2OVRB 3E0CA 4JSXC 3EI1B 2TRCB 2H14A 2I3TA 3AL8A 2XL2A 3OW8A 3JRPA 3PXSD 5A2Qg 3ODTA 4GMBA 3GFCA 1N6EA 2CN3A 3C75H 3UVKA 5HE3B 4AEZA 4D6VA 4ZOYA 1GG2B 4J79A 2YNOA 5IGOA 3BWSA 5SXMA 3PXTD 4GQ2P 3PVUB 1N6DA 4CI8A 5FA5B 2UZXB 2P9PC 4J78A 2MTAH 5EAMA 4I79A 2PM9A 1MG2A 2QXVA 2AH1A 1N6FA 1JMZB 3OL2A 1B9YA 2H68A 5EAPA 2I0SA 3DXMC 2H6NA 5IJ8E 3I7KA 3OKTA 3EWEA 3IIWA 4A09A 5CYKA 2HYEA 2B5LA 4JD2C 2B5MA 3C9CA 3NVNA 4A08A 3UKRC 5IJ7E 1TYQC 3L4MD 3SBQA 2IAAA 4O3UB 5K1CC 5I5MA 5HE2B 4ZOZA 4L3HD 2H3XA 2OK6A 4CC9A 2Z2OA 5AMSA 5EALA 2H47A 5FKSA 4ZN4A 2I0RA 5FQDA 3NVXA 3IJ0A 3RSEC 2OIZA 3IIYA 3C5MA 1JMXB 4J84A 4X63B 3V7DB 3L4OD 2P9KC 4X61B 3EI3B 4FA9D 4ERYA 4IA9A 5IC7A 5EMMB 2UZYB 3U4YA 4J8GA 4Z8LA 4ERQA 5TEFA 3PXWD 5FKTA 2P9SC 3I7LA 5AJAA 5TEEA 3VA6A 4PSWB 3K27A 2H9NA 2CO0C 4GQ1A 3CFVA 2AH0A 2HJBA 3EU7A 4J0WA 2CN2A 2O9KA 3EI4B 1NR0A 5AFU3 2P9NC 3OTTA 4H5JA 3OKWA 4FWWA 4L9OA 5CXCB 2HKRA 4K3JB 2Q7QA 4XYHA 4QT8A 5FXYA 4A0BA 3IJ1A 2H9PA 3MXXA 3I89A 4A7JA 2IWKA 1XKSA 2IUQA 3SJLD 4MK0B 3I2NA 3OKYB 3PSLA 3KRWB 3DSMA 4OWRA 2AGYA 5EM2A 1XHMA 4J77A 5HE0B 4J82A 2B4EA 2CE8A 2YMUA 4CY3A 3BG1A 4CY5A 4E5ZA 2BBKH 5HE1B 4UI9R 4GM3A 4BL0A 1JOFA 3SBRA 2XL3A 3EI2A 1GOTB 3C99A 3PVWB 2J56H 4A2MA 4IMMA 1U2VC 3UVOA 4A0AB 4PC0A 1SQ9A 5HQGA 3V9FA 2YNNA 2P9LC 3F3GA 4CI1A 1MG3A 2H6KA 2H6QA 5C2VB 1P22A 1QNIA 2I0TA 2OVPB 3ULEC 4J8BA 3UVLA 2H9LA 4E54B 4A11A 3FM0A 3AFCA 4FHLA 4LG9A 5CXBB 3SLED 5H1MA 1PGUA 2AGLA 2HJ4A 4ES0A 3UKUC 4BH6A 2H9MA 4J87A 4LGNA 4XEIC 3ZWLB 4ERZA 3EI1A 4KFMB 1GXRA 2PBIB 4TZ4A 5EMKB 2G99A 1MDAH 4A2LA 3A0FA 3SXTD 4X60B 4D0KA 4ZOVA 5GXIA 2CNXA 3F3PA 3JAMg 1PEVA 4U7AA 3MZKA 1GP2B 4O9DA 5K19A 3NVQA 1A0RB 2QC5A 3I8EA 2J57G 1S4UX 5GSAA 4CY2A 3UVMA 4ESGA 4NSXA 1YFQA 4Y7RA 2HXCA 3AL8B 4O1QD 2YBAA 4J86A 3RFGA 4FA5D 2W18A 3I7NA 2GC7A 3MKSB 3K26A 2AGZA 1PI6A 3I7OA 3SN6B 2G9AA 4GGDA 4GQBB 5GMKn 4CI2A 5C9ZB 2PM7B 2CO0A 1OLZA 4HDJA 3EI2B 3RRMC 3RN1D 2BCJB 3JZNA 4CZVA 3W15A 3SWSD 5TDHB 4Y5RD 5FLXg 3FRXA 4O45A 2PM9B 4JSVC 4GGCA 5GXHA 3RFHA 2I3SA 3OL2B 3J81g 5H14A 3CFSB 4EWRA 5I5JA 4OZUA 4U1EI 3VGZA 3V5WB 2P9IC 3I8CA 4CY1A 1B9XA 4ZOXA 4A09B 3HFQA 1NEXB 4H5IA 5CYKB 3JB9L 2AQ5A 3IJCA 3B7FA 2P9UC 4A08B 2PM6B 2B5NA 5EMJB 1PBYB 3EI3A 3UR4A 3MKQA 4J73A 5HYNB 4QL1A 3ORVD 5EARA 3PE7A 4GGAA 2AGXA 5IGQA 4R7AB 2GC4A 4PBYA 3P4FA 1XIPA 4LG8A 3AL9A 2CE9A 1SHYB 3SBPA 3EI4A 1K32A 1R5MA 5JWZA 2YB8B 2IUPA 4AOWA 4JXMA 5C2WB 5IT9g 1ERJA 4JSNC 1RI6A 4PBZA 3BG0A 2Z2PA 3FGBA 5CXCA 4FAND 1K8KC 3IKOA 4GZ8A 2OK4A 4L1QD 4YVDA 5H17A 2IURA 2GNQA 3DWLC 5I5IA 2OVQB 3OKYA 4QRJA 4GM8A 2HKMA 4JT5C 3RLMD 1TBGA 3SMRA 2XU7A 3UVNA 3I7PA 1FWXA 4X3EA 4CZXA 3SFZA 3J80g 3JROA 3DXKC 4K3ID 3AH8B 2Z2NA 3SHFA 4A0BB 4JT6C 4FB1D 2XYIA 4A0AA 4G56B 4FA1D 2IWFA 4J81A 1SQJA 2IUVA 3EG6A 3JZHA 4PSXB 3I7HA 4JSPC 3MZLA 5FKRA 3RN0D 4J0XA 4O3TB 3SVWD 5EM2B 5TF2A 2H13A 3N0DA 4XYIA 3DM0A 4E54A
chains in the Genus database with same CATH superfamily
5THAA 4AX4A 4N14A 2J55H 3V4PA 4BUJC 3VH0A 4E5ZB 3SCYA 3JPXA 1OMWB 2EICA 5KDOB 1E5TA 5CXBA 3MMYA 3EQ7A 4PXWA 3IUNA 4FAVD 2AGWA 2HU5A 3RMZD 3ZE0A 3F3FA 2YNPA 3GREA 4FA4D 4GM9A 5M5TA 2EBSA 1U4CA 4QQEA 3CIKB 4BCBA 3KRXB 1C9LA 4Z7OA 2VZ3A 3PSCB 4CI3A 2HESX 4JHNA 3N0EA 4L3GD 5FKQA 1VE7A 2OJYA 4CZYA 4AMZA 1VYHC 4A11B 3JZGA 1UOOA 5B4WA 5FFOA 1JJUB 5EMLB 5M5SA 3EMHA 1L0QA 2BKLA 3QHYB 4PNKB 1Q47A 2OVRB 3E0CA 3QI0A 4JSXC 3EI1B 2TRCB 2H14A 2I3TA 2VDPA 3AL8A 2VDOA 2XL2A 3OW8A 3JRPA 3PXSD 5A2Qg 3ODTA 4GMBA 3GFCA 4BCDA 3O4JA 1N6EA 2CN3A 3C75H 3UVKA 5HE3B 4AEZA 4D6VA 3OF7A 4ZOYA 1GG2B 4J79A 2YNOA 4NBMA 5IGOA 3BWSA 3EQ8A 5SXMA 3PXTD 1YR2A 4GQ2P 3PVUB 1N6DA 4CI8A 5FA5B 2UZXB 2P9PC 4J78A 2MTAH 5EAMA 4I79A 2PM9A 1MG2A 2QXVA 2AH1A 2VDKA 1N6FA 4NAAA 1JMZB 3OL2A 1B9YA 2H68A 5EAPA 2I0SA 3DXMC 2H6NA 5IJ8E 3I7KA 3VI4A 3OKTA 3EWEA 3IIWA 4MMYA 4WJKA 4A09A 5CYKA 2HYEA 2B5LA 4JD2C 2B5MA 1M1XA 3C9CA 4IRZA 3NVNA 4A08A 5M5UA 3UKRC 2XZGA 5IJ7E 5HDBA 1E8MA 1TYQC 4AN1A 3L4MD 2WQ8A 3SBQA 2IAAA 2VDMA 4O3UB 5K1CC 5I5MA 5HE2B 3FCSA 4ZOZA 4L3HD 2H3XA 2OK6A 4CC9A 2Z2OA 5AMSA 5EALA 2H47A 5FKSA 4ZN4A 2I0RA 3IULA 1H2WA 3NVXA 1A12A 5FQDA 3IJ0A 3RSEC 2OIZA 3IIYA 3C5MA 1JMXB 4J84A 4X63B 3V7DB 1C9IA 3L4OD 3KCIA 2P9KC 4X61B 3EI3B 4FA9D 4ERYA 4IA9A 5IC7A 5EMMB 2UZYB 3U4YA 3O4GA 1L5GA 1O6FA 2EIBA 1GOFA 4J8GA 3FCUA 4Z8LA 4ERQA 5TEFA 3PXWD 5FKTA 2P9SC 3I7LA 5AJAA 5TEEA 3VA6A 4PSWB 3K27A 2H9NA 3IURA 2CO0C 4GQ1A 3CFVA 2AH0A 2HJBA 3EU7A 4J0WA 2CN2A 2O9KA 3EI4B 1NR0A 5AFU3 2P9NC 3OTTA 4H5JA 1GOHA 2EIDA 1UOQA 3OKWA 4FWWA 4G1EA 4L9OA 5CXCB 2HKRA 2QZPA 4K3JB 2Q7QA 4XYHA 4QT8A 5FXYA 4A0BA 3IJ1A 3DDUA 2H9PA 3MXXA 3I89A 4A7JA 2IWKA 1XKSA 2IUQA 1UOPA 3SJLD 3K6SA 1VZ2A 3I2NA 3OKYB 3PSLA 4MK0B 3KRWB 3DSMA 4OWRA 2AGYA 5EM2A 1XHMA 4J77A 5HE0B 4WK4A 4G55A 4J82A 4NENA 2B4EA 3T3MA 2CE8A 1U8CA 2YMUA 3IUQA 4CY3A 3BG1A 4CY5A 4E5ZA 2BBKH 4NC4A 4UI9R 5HE1B 4E54A 4GM3A 4BL0A 2JKXA 1JOFA 4DNWA 3SBRA 2XL3A 3EI2A 1GOTB 3C99A 5M5RA 3T3PA 3PVWB 1K3IA 2J56H 4A2MA 4IMMA 1U2VC 3ZE2A 3UVOA 4A0AB 4PC0A 1SQ9A 5HQGA 3V9FA 2YNNA 2P9LC 3F3GA 5FFGA 4CI1A 1MG3A 2H6KA 2H6QA 5C2VB 1P22A 1QNIA 2I0TA 2OVPB 3ULEC 4J8BA 3UVLA 2H9LA 4E54B 4A11A 3FM0A 3AFCA 3NIFA 5C92A 5M5VA 4FHLA 4LG9A 5CXBB 4BP8A 4O02A 3SLED 1T2XA 5H1MA 1PGUA 4AMYA 2AGLA 2HJ4A 3ZE1A 4ES0A 3UKUC 4BH6A 4MMXA 2H9MA 4J87A 4LGNA 3NIGA 2QR5A 4XEIC 2EIEA 3ZWLB 4MMZA 4ERZA 3GC3B 3EI1A 4KFMB 1GXRA 2PBIB 4TZ4A 5EMKB 3IUJA 2G99A 1MDAH 4WK0A 4A2LA 3A0FA 4Z7QA 3SXTD 1H2XA 3VI3A 4X60B 4D0KA 4ZOVA 5GXIA 3IUMA 2CNXA 3F3PA 3JAMg 1PEVA 4U7AA 3MZKA 1GP2B 1I2MB 4O9DA 5K19A 3NVQA 1A0RB 2QC5A 3I8EA 2J57G 1VE6A 1S4UX 1H2ZA 5GSAA 4CY2A 1JV2A 3UVMA 2VDRA 4ESGA 3MVDK 4NSXA 1JTDB 1YFQA 4Y7RA 2HXCA 5E6RA 5E6SA 3AL8B 4O1QD 2YBAA 4J86A 3RFGA 4FA5D 2W18A 3I7NA 2GC7A 4UM9A 3MKSB 3K26A 2AGZA 1E8NA 3IJEA 3V4VA 1PI6A 3I7OA 3SN6B 2G9AA 3ZDZA 4GGDA 4GQBB 5GMKn 1O6GA 4CI2A 5C9ZB 4JHPC 2PM7B 2CO0A 1OLZA 4HDJA 3EI2B 3RRMC 3RN1D 2BCJB 3JZNA 4CZVA 1QFSA 3K71A 3W15A 3SWSD 2VDNA 4RE6A 5TDHB 4Y5RD 5FLXg 3O4IA 3FRXA 4O45A 2PM9B 4L1MA 4JSVC 4GGCA 4WK2A 5GXHA 3RFHA 2I3SA 3OL2B 3J81g 5H14A 3CFSB 4EWRA 2XE4A 5I5JA 4OZUA 1GOGA 4U1EI 3VGZA 3V5WB 5M61A 2P9IC 3I8CA 4CY1A 1B9XA 4ZOXA 4A09B 3HFQA 1NEXB 4H5IA 5CYKB 3JB9L 2AQ5A 3IJCA 3NIDA 3B7FA 2P9UC 4A08B 2PM6B 2B5NA 5EMJB 1PBYB 3EI3A 3UR4A 3ZDYA 2XDWA 3MKQA 4J73A 4O2WA 5HYNB 4QL1A 3ORVD 5EARA 3PE7A 3IVMA 4GGAA 2AGXA 5IGQA 4QAMA 4R7AB 2GC4A 1BPOA 4PBYA 3P4FA 1XIPA 4LG8A 3AL9A 2CE9A 1SHYB 4BP9A 3SBPA 3EI4A 1K32A 1R5MA 3O4HA 2YB8B 5JWZA 2IUPA 4AOWA 4JXMA 4Z7NA 3K72A 3ZDXA 5C2WB 5IT9g 1ERJA 4JSNC 1RI6A 5E6UA 4PBZA 4D9SA 3BG0A 2Z2PA 3FGBA 5CXCA 4FAND 1K8KC 3IKOA 4GZ8A 2OK4A 4L1QD 1UTCA 3MUOA 4YVDA 5H17A 3EQ9A 1VZ3A 2IURA 2GNQA 3DWLC 5I5IA 1TYEA 2OVQB 3OKYA 4QRJA 1H2YA 4GM8A 4RE5A 2HKMA 4JT5C 3RLMD 1TBGA 2VDLA 3SMRA 2XU7A 3UVNA 3I7PA 4G1MA 1FWXA 4X3EA 4DNVA 4CZXA 3SFZA 3J80g 3JROA 4DNUA 2VZ1A 3DXKC 2HU7A 4K3ID 3AH8B 2Z2NA 3SHFA 4A0BB 2VDQA 4JT6C 5C86A 4FB1D 2XYIA 4A0AA 4G56B 4FA1D 2HU8A 2IWFA 4J81A 1QFMA 1SQJA 2IUVA 3EG6A 3JZHA 4UM8A 4PSXB 3I7HA 4JSPC 4AN0A 3MZLA 3GD1I 5FKRA 3RN0D 4J0XA 4O3TB 3SVWD 5EM2B 5TF2A 2H13A 3N0DA 3MUNA 4XYIA 3DM0A 2VC2A 4BCCA
chains in the Genus database with same CATH topology
5THAA 3VH0A 4N14A 2J55H 4BUJC 4E5ZB 3SCYA 3JPXA 1OMWB 5KDOB 5CXBA 3MMYA 4PXWA 4FAVD 2AGWA 3RMZD 3F3FA 2YNPA 3GREA 4FA4D 4GM9A 2EBSA 1U4CA 4QQEA 3CIKB 3KRXB 3PSCB 4CI3A 2HESX 3N0EA 4L3GD 5FKQA 2OJYA 4CZYA 1VYHC 4A11B 3JZGA 5B4WA 1JJUB 5EMLB 3EMHA 1L0QA 4PNKB 1Q47A 2OVRB 3E0CA 4JSXC 3EI1B 2TRCB 2H14A 2I3TA 3AL8A 2XL2A 3OW8A 3JRPA 3PXSD 5A2Qg 3ODTA 4GMBA 3GFCA 1N6EA 2CN3A 3C75H 3UVKA 5HE3B 4AEZA 4D6VA 4ZOYA 1GG2B 4J79A 2YNOA 5IGOA 3BWSA 5SXMA 3PXTD 4GQ2P 3PVUB 1N6DA 4CI8A 5FA5B 2UZXB 2P9PC 4J78A 2MTAH 5EAMA 4I79A 2PM9A 1MG2A 2QXVA 2AH1A 1N6FA 1JMZB 3OL2A 1B9YA 2H68A 5EAPA 2I0SA 3DXMC 2H6NA 5IJ8E 3I7KA 3OKTA 3EWEA 3IIWA 4A09A 5CYKA 2HYEA 2B5LA 4JD2C 2B5MA 3C9CA 3NVNA 4A08A 3UKRC 5IJ7E 1TYQC 3L4MD 3SBQA 2IAAA 4O3UB 5K1CC 5I5MA 5HE2B 4ZOZA 4L3HD 2H3XA 2OK6A 4CC9A 2Z2OA 5AMSA 5EALA 2H47A 5FKSA 4ZN4A 2I0RA 5FQDA 3NVXA 3IJ0A 3RSEC 2OIZA 3IIYA 3C5MA 1JMXB 4J84A 4X63B 3V7DB 3L4OD 2P9KC 4X61B 3EI3B 4FA9D 4ERYA 4IA9A 5IC7A 5EMMB 2UZYB 3U4YA 4J8GA 4Z8LA 4ERQA 5TEFA 3PXWD 5FKTA 2P9SC 3I7LA 5AJAA 5TEEA 3VA6A 4PSWB 3K27A 2H9NA 2CO0C 4GQ1A 3CFVA 2AH0A 2HJBA 3EU7A 4J0WA 2CN2A 2O9KA 3EI4B 1NR0A 5AFU3 2P9NC 3OTTA 4H5JA 3OKWA 4FWWA 4L9OA 5CXCB 2HKRA 4K3JB 2Q7QA 4XYHA 4QT8A 5FXYA 4A0BA 3IJ1A 2H9PA 3MXXA 3I89A 4A7JA 2IWKA 1XKSA 2IUQA 3SJLD 4MK0B 3I2NA 3OKYB 3PSLA 3KRWB 3DSMA 4OWRA 2AGYA 5EM2A 1XHMA 4J77A 5HE0B 4J82A 2B4EA 2CE8A 2YMUA 4CY3A 3BG1A 4CY5A 4E5ZA 2BBKH 5HE1B 4UI9R 4GM3A 4BL0A 1JOFA 3SBRA 2XL3A 3EI2A 1GOTB 3C99A 3PVWB 2J56H 4A2MA 4IMMA 1U2VC 3UVOA 4A0AB 4PC0A 1SQ9A 5HQGA 3V9FA 2YNNA 2P9LC 3F3GA 4CI1A 1MG3A 2H6KA 2H6QA 5C2VB 1P22A 1QNIA 2I0TA 2OVPB 3ULEC 4J8BA 3UVLA 2H9LA 4E54B 4A11A 3FM0A 3AFCA 4FHLA 4LG9A 5CXBB 3SLED 5H1MA 1PGUA 2AGLA 2HJ4A 4ES0A 3UKUC 4BH6A 2H9MA 4J87A 4LGNA 4XEIC 3ZWLB 4ERZA 3EI1A 4KFMB 1GXRA 2PBIB 4TZ4A 5EMKB 2G99A 1MDAH 4A2LA 3A0FA 3SXTD 4X60B 4D0KA 4ZOVA 5GXIA 2CNXA 3F3PA 3JAMg 1PEVA 4U7AA 3MZKA 1GP2B 4O9DA 5K19A 3NVQA 1A0RB 2QC5A 3I8EA 2J57G 1S4UX 5GSAA 4CY2A 3UVMA 4ESGA 4NSXA 1YFQA 4Y7RA 2HXCA 3AL8B 4O1QD 2YBAA 4J86A 3RFGA 4FA5D 2W18A 3I7NA 2GC7A 3MKSB 3K26A 2AGZA 1PI6A 3I7OA 3SN6B 2G9AA 4GGDA 4GQBB 5GMKn 4CI2A 5C9ZB 2PM7B 2CO0A 1OLZA 4HDJA 3EI2B 3RRMC 3RN1D 2BCJB 3JZNA 4CZVA 3W15A 3SWSD 5TDHB 4Y5RD 5FLXg 3FRXA 4O45A 2PM9B 4JSVC 4GGCA 5GXHA 3RFHA 2I3SA 3OL2B 3J81g 5H14A 3CFSB 4EWRA 5I5JA 4OZUA 4U1EI 3VGZA 3V5WB 2P9IC 3I8CA 4CY1A 1B9XA 4ZOXA 4A09B 3HFQA 1NEXB 4H5IA 5CYKB 3JB9L 2AQ5A 3IJCA 3B7FA 2P9UC 4A08B 2PM6B 2B5NA 5EMJB 1PBYB 3EI3A 3UR4A 3MKQA 4J73A 5HYNB 4QL1A 3ORVD 5EARA 3PE7A 4GGAA 2AGXA 5IGQA 4R7AB 2GC4A 4PBYA 3P4FA 1XIPA 4LG8A 3AL9A 2CE9A 1SHYB 3SBPA 3EI4A 1K32A 1R5MA 5JWZA 2YB8B 2IUPA 4AOWA 4JXMA 5C2WB 5IT9g 1ERJA 4JSNC 1RI6A 4PBZA 3BG0A 2Z2PA 3FGBA 5CXCA 4FAND 1K8KC 3IKOA 4GZ8A 2OK4A 4L1QD 4YVDA 5H17A 2IURA 2GNQA 3DWLC 5I5IA 2OVQB 3OKYA 4QRJA 4GM8A 2HKMA 4JT5C 3RLMD 1TBGA 3SMRA 2XU7A 3UVNA 3I7PA 1FWXA 4X3EA 4CZXA 3SFZA 3J80g 3JROA 3DXKC 4K3ID 3AH8B 2Z2NA 3SHFA 4A0BB 4JT6C 4FB1D 2XYIA 4A0AA 4G56B 4FA1D 2IWFA 4J81A 1SQJA 2IUVA 3EG6A 3JZHA 4PSXB 3I7HA 4JSPC 3MZLA 5FKRA 3RN0D 4J0XA 4O3TB 3SVWD 5EM2B 5TF2A 2H13A 3N0DA 4XYIA 3DM0A 4E54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5THA A;  3VH0 A;  4N14 A;  2J55 H;  4BUJ C;  4E5Z B;  3SCY A;  3JPX A;  1OMW B;  5KDO B;  5CXB A;  3MMY A;  4PXW A;  4FAV D;  2AGW A;  3RMZ D;  3F3F A;  2YNP A;  3GRE A;  4FA4 D;  4GM9 A;  2EBS A;  1U4C A;  4QQE A;  3CIK B;  3KRX B;  3PSC B;  4CI3 A;  2HES X;  3N0E A;  4L3G D;  5FKQ A;  2OJY A;  4CZY A;  1VYH C;  4A11 B;  3JZG A;  5B4W A;  1JJU B;  5EML B;  3EMH A;  1L0Q A;  4PNK B;  1Q47 A;  2OVR B;  3E0C A;  4JSX C;  3EI1 B;  2TRC B;  2H14 A;  2I3T A;  3AL8 A;  2XL2 A;  3OW8 A;  3JRP A;  3PXS D;  5A2Q g;  3ODT A;  4GMB A;  3GFC A;  1N6E A;  2CN3 A;  3C75 H;  3UVK A;  5HE3 B;  4AEZ A;  4D6V A;  4ZOY A;  1GG2 B;  4J79 A;  2YNO A;  5IGO A;  3BWS A;  5SXM A;  3PXT D;  4GQ2 P;  3PVU B;  1N6D A;  4CI8 A;  5FA5 B;  2UZX B;  2P9P C;  4J78 A;  2MTA H;  5EAM A;  4I79 A;  2PM9 A;  1MG2 A;  2QXV A;  2AH1 A;  1N6F A;  1JMZ B;  3OL2 A;  1B9Y A;  2H68 A;  5EAP A;  2I0S A;  3DXM C;  2H6N A;  5IJ8 E;  3I7K A;  3OKT A;  3EWE A;  3IIW A;  4A09 A;  5CYK A;  2HYE A;  2B5L A;  4JD2 C;  2B5M A;  3C9C A;  3NVN A;  4A08 A;  3UKR C;  5IJ7 E;  1TYQ C;  3L4M D;  3SBQ A;  2IAA A;  4O3U B;  5K1C C;  5I5M A;  5HE2 B;  4ZOZ A;  4L3H D;  2H3X A;  2OK6 A;  4CC9 A;  2Z2O A;  5AMS A;  5EAL A;  2H47 A;  5FKS A;  4ZN4 A;  2I0R A;  5FQD A;  3NVX A;  3IJ0 A;  3RSE C;  2OIZ A;  3IIY A;  3C5M A;  1JMX B;  4J84 A;  4X63 B;  3V7D B;  3L4O D;  2P9K C;  4X61 B;  3EI3 B;  4FA9 D;  4ERY A;  4IA9 A;  5IC7 A;  5EMM B;  2UZY B;  3U4Y A;  4J8G A;  4Z8L A;  4ERQ A;  5TEF A;  3PXW D;  5FKT A;  2P9S C;  3I7L A;  5AJA A;  5TEE A;  3VA6 A;  4PSW B;  3K27 A;  2H9N A;  2CO0 C;  4GQ1 A;  3CFV A;  2AH0 A;  2HJB A;  3EU7 A;  4J0W A;  2CN2 A;  2O9K A;  3EI4 B;  1NR0 A;  5AFU 3;  2P9N C;  3OTT A;  4H5J A;  3OKW A;  4FWW A;  4L9O A;  5CXC B;  2HKR A;  4K3J B;  2Q7Q A;  4XYH A;  4QT8 A;  5FXY A;  4A0B A;  3IJ1 A;  2H9P A;  3MXX A;  3I89 A;  4A7J A;  2IWK A;  1XKS A;  2IUQ A;  3SJL D;  4MK0 B;  3I2N A;  3OKY B;  3PSL A;  3KRW B;  3DSM A;  4OWR A;  2AGY A;  5EM2 A;  1XHM A;  4J77 A;  5HE0 B;  4J82 A;  2B4E A;  2CE8 A;  2YMU A;  4CY3 A;  3BG1 A;  4CY5 A;  4E5Z A;  2BBK H;  5HE1 B;  4UI9 R;  4GM3 A;  4BL0 A;  1JOF A;  3SBR A;  2XL3 A;  3EI2 A;  1GOT B;  3C99 A;  3PVW B;  2J56 H;  4A2M A;  4IMM A;  1U2V C;  3UVO A;  4A0A B;  4PC0 A;  1SQ9 A;  5HQG A;  3V9F A;  2YNN A;  2P9L C;  3F3G A;  4CI1 A;  1MG3 A;  2H6K A;  2H6Q A;  5C2V B;  1P22 A;  1QNI A;  2I0T A;  2OVP B;  3ULE C;  4J8B A;  3UVL A;  2H9L A;  4E54 B;  4A11 A;  3FM0 A;  3AFC A;  4FHL A;  4LG9 A;  5CXB B;  3SLE D;  5H1M A;  1PGU A;  2AGL A;  2HJ4 A;  4ES0 A;  3UKU C;  4BH6 A;  2H9M A;  4J87 A;  4LGN A;  4XEI C;  3ZWL B;  4ERZ A;  3EI1 A;  4KFM B;  1GXR A;  2PBI B;  4TZ4 A;  5EMK B;  2G99 A;  1MDA H;  4A2L A;  3A0F A;  3SXT D;  4X60 B;  4D0K A;  4ZOV A;  5GXI A;  2CNX A;  3F3P A;  3JAM g;  1PEV A;  4U7A A;  3MZK A;  1GP2 B;  4O9D A;  5K19 A;  3NVQ A;  1A0R B;  2QC5 A;  3I8E A;  2J57 G;  1S4U X;  5GSA A;  4CY2 A;  3UVM A;  4ESG A;  4NSX A;  1YFQ A;  4Y7R A;  2HXC A;  3AL8 B;  4O1Q D;  2YBA A;  4J86 A;  3RFG A;  4FA5 D;  2W18 A;  3I7N A;  2GC7 A;  3MKS B;  3K26 A;  2AGZ A;  1PI6 A;  3I7O A;  3SN6 B;  2G9A A;  4GGD A;  4GQB B;  5GMK n;  4CI2 A;  5C9Z B;  2PM7 B;  2CO0 A;  1OLZ A;  4HDJ A;  3EI2 B;  3RRM C;  3RN1 D;  2BCJ B;  3JZN A;  4CZV A;  3W15 A;  3SWS D;  5TDH B;  4Y5R D;  5FLX g;  3FRX A;  4O45 A;  2PM9 B;  4JSV C;  4GGC A;  5GXH A;  3RFH A;  2I3S A;  3OL2 B;  3J81 g;  5H14 A;  3CFS B;  4EWR A;  5I5J A;  4OZU A;  4U1E I;  3VGZ A;  3V5W B;  2P9I C;  3I8C A;  4CY1 A;  1B9X A;  4ZOX A;  4A09 B;  3HFQ A;  1NEX B;  4H5I A;  5CYK B;  3JB9 L;  2AQ5 A;  3IJC A;  3B7F A;  2P9U C;  4A08 B;  2PM6 B;  2B5N A;  5EMJ B;  1PBY B;  3EI3 A;  3UR4 A;  3MKQ A;  4J73 A;  5HYN B;  4QL1 A;  3ORV D;  5EAR A;  3PE7 A;  4GGA A;  2AGX A;  5IGQ A;  4R7A B;  2GC4 A;  4PBY A;  3P4F A;  1XIP A;  4LG8 A;  3AL9 A;  2CE9 A;  1SHY B;  3SBP A;  3EI4 A;  1K32 A;  1R5M A;  5JWZ A;  2YB8 B;  2IUP A;  4AOW A;  4JXM A;  5C2W B;  5IT9 g;  1ERJ A;  4JSN C;  1RI6 A;  4PBZ A;  3BG0 A;  2Z2P A;  3FGB A;  5CXC A;  4FAN D;  1K8K C;  3IKO A;  4GZ8 A;  2OK4 A;  4L1Q D;  4YVD A;  5H17 A;  2IUR A;  2GNQ A;  3DWL C;  5I5I A;  2OVQ B;  3OKY A;  4QRJ A;  4GM8 A;  2HKM A;  4JT5 C;  3RLM D;  1TBG A;  3SMR A;  2XU7 A;  3UVN A;  3I7P A;  1FWX A;  4X3E A;  4CZX A;  3SFZ A;  3J80 g;  3JRO A;  3DXK C;  4K3I D;  3AH8 B;  2Z2N A;  3SHF A;  4A0B B;  4JT6 C;  4FB1 D;  2XYI A;  4A0A A;  4G56 B;  4FA1 D;  2IWF A;  4J81 A;  1SQJ A;  2IUV A;  3EG6 A;  3JZH A;  4PSX B;  3I7H A;  4JSP C;  3MZL A;  5FKR A;  3RN0 D;  4J0X A;  4O3T B;  3SVW D;  5EM2 B;  5TF2 A;  2H13 A;  3N0D A;  4XYI A;  3DM0 A;  4E54 A; 
#chains in the Genus database with same CATH topology
 5THA A;  4AX4 A;  4N14 A;  2J55 H;  3V4P A;  4BUJ C;  3VH0 A;  4E5Z B;  3SCY A;  3JPX A;  1OMW B;  2EIC A;  5KDO B;  1E5T A;  5CXB A;  3MMY A;  3EQ7 A;  4PXW A;  3IUN A;  4FAV D;  2AGW A;  2HU5 A;  3RMZ D;  3ZE0 A;  3F3F A;  2YNP A;  3GRE A;  4FA4 D;  4GM9 A;  5M5T A;  2EBS A;  1U4C A;  4QQE A;  3CIK B;  4BCB A;  3KRX B;  1C9L A;  4Z7O A;  2VZ3 A;  3PSC B;  4CI3 A;  2HES X;  4JHN A;  3N0E A;  4L3G D;  5FKQ A;  1VE7 A;  2OJY A;  4CZY A;  4AMZ A;  1VYH C;  4A11 B;  3JZG A;  1UOO A;  5B4W A;  5FFO A;  1JJU B;  5EML B;  5M5S A;  3EMH A;  1L0Q A;  2BKL A;  3QHY B;  4PNK B;  1Q47 A;  2OVR B;  3E0C A;  3QI0 A;  4JSX C;  3EI1 B;  2TRC B;  2H14 A;  2I3T A;  2VDP A;  3AL8 A;  2VDO A;  2XL2 A;  3OW8 A;  3JRP A;  3PXS D;  5A2Q g;  3ODT A;  4GMB A;  3GFC A;  4BCD A;  3O4J A;  1N6E A;  2CN3 A;  3C75 H;  3UVK A;  5HE3 B;  4AEZ A;  4D6V A;  3OF7 A;  4ZOY A;  1GG2 B;  4J79 A;  2YNO A;  4NBM A;  5IGO A;  3BWS A;  3EQ8 A;  5SXM A;  3PXT D;  1YR2 A;  4GQ2 P;  3PVU B;  1N6D A;  4CI8 A;  5FA5 B;  2UZX B;  2P9P C;  4J78 A;  2MTA H;  5EAM A;  4I79 A;  2PM9 A;  1MG2 A;  2QXV A;  2AH1 A;  2VDK A;  1N6F A;  4NAA A;  1JMZ B;  3OL2 A;  1B9Y A;  2H68 A;  5EAP A;  2I0S A;  3DXM C;  2H6N A;  5IJ8 E;  3I7K A;  3VI4 A;  3OKT A;  3EWE A;  3IIW A;  4MMY A;  4WJK A;  4A09 A;  5CYK A;  2HYE A;  2B5L A;  4JD2 C;  2B5M A;  1M1X A;  3C9C A;  4IRZ A;  3NVN A;  4A08 A;  5M5U A;  3UKR C;  2XZG A;  5IJ7 E;  5HDB A;  1E8M A;  1TYQ C;  4AN1 A;  3L4M D;  2WQ8 A;  3SBQ A;  2IAA A;  2VDM A;  4O3U B;  5K1C C;  5I5M A;  5HE2 B;  3FCS A;  4ZOZ A;  4L3H D;  2H3X A;  2OK6 A;  4CC9 A;  2Z2O A;  5AMS A;  5EAL A;  2H47 A;  5FKS A;  4ZN4 A;  2I0R A;  3IUL A;  1H2W A;  3NVX A;  1A12 A;  5FQD A;  3IJ0 A;  3RSE C;  2OIZ A;  3IIY A;  3C5M A;  1JMX B;  4J84 A;  4X63 B;  3V7D B;  1C9I A;  3L4O D;  3KCI A;  2P9K C;  4X61 B;  3EI3 B;  4FA9 D;  4ERY A;  4IA9 A;  5IC7 A;  5EMM B;  2UZY B;  3U4Y A;  3O4G A;  1L5G A;  1O6F A;  2EIB A;  1GOF A;  4J8G A;  3FCU A;  4Z8L A;  4ERQ A;  5TEF A;  3PXW D;  5FKT A;  2P9S C;  3I7L A;  5AJA A;  5TEE A;  3VA6 A;  4PSW B;  3K27 A;  2H9N A;  3IUR A;  2CO0 C;  4GQ1 A;  3CFV A;  2AH0 A;  2HJB A;  3EU7 A;  4J0W A;  2CN2 A;  2O9K A;  3EI4 B;  1NR0 A;  5AFU 3;  2P9N C;  3OTT A;  4H5J A;  1GOH A;  2EID A;  1UOQ A;  3OKW A;  4FWW A;  4G1E A;  4L9O A;  5CXC B;  2HKR A;  2QZP A;  4K3J B;  2Q7Q A;  4XYH A;  4QT8 A;  5FXY A;  4A0B A;  3IJ1 A;  3DDU A;  2H9P A;  3MXX A;  3I89 A;  4A7J A;  2IWK A;  1XKS A;  2IUQ A;  1UOP A;  3SJL D;  3K6S A;  1VZ2 A;  3I2N A;  3OKY B;  3PSL A;  4MK0 B;  3KRW B;  3DSM A;  4OWR A;  2AGY A;  5EM2 A;  1XHM A;  4J77 A;  5HE0 B;  4WK4 A;  4G55 A;  4J82 A;  4NEN A;  2B4E A;  3T3M A;  2CE8 A;  1U8C A;  2YMU A;  3IUQ A;  4CY3 A;  3BG1 A;  4CY5 A;  4E5Z A;  2BBK H;  4NC4 A;  4UI9 R;  5HE1 B;  4E54 A;  4GM3 A;  4BL0 A;  2JKX A;  1JOF A;  4DNW A;  3SBR A;  2XL3 A;  3EI2 A;  1GOT B;  3C99 A;  5M5R A;  3T3P A;  3PVW B;  1K3I A;  2J56 H;  4A2M A;  4IMM A;  1U2V C;  3ZE2 A;  3UVO A;  4A0A B;  4PC0 A;  1SQ9 A;  5HQG A;  3V9F A;  2YNN A;  2P9L C;  3F3G A;  5FFG A;  4CI1 A;  1MG3 A;  2H6K A;  2H6Q A;  5C2V B;  1P22 A;  1QNI A;  2I0T A;  2OVP B;  3ULE C;  4J8B A;  3UVL A;  2H9L A;  4E54 B;  4A11 A;  3FM0 A;  3AFC A;  3NIF A;  5C92 A;  5M5V A;  4FHL A;  4LG9 A;  5CXB B;  4BP8 A;  4O02 A;  3SLE D;  1T2X A;  5H1M A;  1PGU A;  4AMY A;  2AGL A;  2HJ4 A;  3ZE1 A;  4ES0 A;  3UKU C;  4BH6 A;  4MMX A;  2H9M A;  4J87 A;  4LGN A;  3NIG A;  2QR5 A;  4XEI C;  2EIE A;  3ZWL B;  4MMZ A;  4ERZ A;  3GC3 B;  3EI1 A;  4KFM B;  1GXR A;  2PBI B;  4TZ4 A;  5EMK B;  3IUJ A;  2G99 A;  1MDA H;  4WK0 A;  4A2L A;  3A0F A;  4Z7Q A;  3SXT D;  1H2X A;  3VI3 A;  4X60 B;  4D0K A;  4ZOV A;  5GXI A;  3IUM A;  2CNX A;  3F3P A;  3JAM g;  1PEV A;  4U7A A;  3MZK A;  1GP2 B;  1I2M B;  4O9D A;  5K19 A;  3NVQ A;  1A0R B;  2QC5 A;  3I8E A;  2J57 G;  1VE6 A;  1S4U X;  1H2Z A;  5GSA A;  4CY2 A;  1JV2 A;  3UVM A;  2VDR A;  4ESG A;  3MVD K;  4NSX A;  1JTD B;  1YFQ A;  4Y7R A;  2HXC A;  5E6R A;  5E6S A;  3AL8 B;  4O1Q D;  2YBA A;  4J86 A;  3RFG A;  4FA5 D;  2W18 A;  3I7N A;  2GC7 A;  4UM9 A;  3MKS B;  3K26 A;  2AGZ A;  1E8N A;  3IJE A;  3V4V A;  1PI6 A;  3I7O A;  3SN6 B;  2G9A A;  3ZDZ A;  4GGD A;  4GQB B;  5GMK n;  1O6G A;  4CI2 A;  5C9Z B;  4JHP C;  2PM7 B;  2CO0 A;  1OLZ A;  4HDJ A;  3EI2 B;  3RRM C;  3RN1 D;  2BCJ B;  3JZN A;  4CZV A;  1QFS A;  3K71 A;  3W15 A;  3SWS D;  2VDN A;  4RE6 A;  5TDH B;  4Y5R D;  5FLX g;  3O4I A;  3FRX A;  4O45 A;  2PM9 B;  4L1M A;  4JSV C;  4GGC A;  4WK2 A;  5GXH A;  3RFH A;  2I3S A;  3OL2 B;  3J81 g;  5H14 A;  3CFS B;  4EWR A;  2XE4 A;  5I5J A;  4OZU A;  1GOG A;  4U1E I;  3VGZ A;  3V5W B;  5M61 A;  2P9I C;  3I8C A;  4CY1 A;  1B9X A;  4ZOX A;  4A09 B;  3HFQ A;  1NEX B;  4H5I A;  5CYK B;  3JB9 L;  2AQ5 A;  3IJC A;  3NID A;  3B7F A;  2P9U C;  4A08 B;  2PM6 B;  2B5N A;  5EMJ B;  1PBY B;  3EI3 A;  3UR4 A;  3ZDY A;  2XDW A;  3MKQ A;  4J73 A;  4O2W A;  5HYN B;  4QL1 A;  3ORV D;  5EAR A;  3PE7 A;  3IVM A;  4GGA A;  2AGX A;  5IGQ A;  4QAM A;  4R7A B;  2GC4 A;  1BPO A;  4PBY A;  3P4F A;  1XIP A;  4LG8 A;  3AL9 A;  2CE9 A;  1SHY B;  4BP9 A;  3SBP A;  3EI4 A;  1K32 A;  1R5M A;  3O4H A;  2YB8 B;  5JWZ A;  2IUP A;  4AOW A;  4JXM A;  4Z7N A;  3K72 A;  3ZDX A;  5C2W B;  5IT9 g;  1ERJ A;  4JSN C;  1RI6 A;  5E6U A;  4PBZ A;  4D9S A;  3BG0 A;  2Z2P A;  3FGB A;  5CXC A;  4FAN D;  1K8K C;  3IKO A;  4GZ8 A;  2OK4 A;  4L1Q D;  1UTC A;  3MUO A;  4YVD A;  5H17 A;  3EQ9 A;  1VZ3 A;  2IUR A;  2GNQ A;  3DWL C;  5I5I A;  1TYE A;  2OVQ B;  3OKY A;  4QRJ A;  1H2Y A;  4GM8 A;  4RE5 A;  2HKM A;  4JT5 C;  3RLM D;  1TBG A;  2VDL A;  3SMR A;  2XU7 A;  3UVN A;  3I7P A;  4G1M A;  1FWX A;  4X3E A;  4DNV A;  4CZX A;  3SFZ A;  3J80 g;  3JRO A;  4DNU A;  2VZ1 A;  3DXK C;  2HU7 A;  4K3I D;  3AH8 B;  2Z2N A;  3SHF A;  4A0B B;  2VDQ A;  4JT6 C;  5C86 A;  4FB1 D;  2XYI A;  4A0A A;  4G56 B;  4FA1 D;  2HU8 A;  2IWF A;  4J81 A;  1QFM A;  1SQJ A;  2IUV A;  3EG6 A;  3JZH A;  4UM8 A;  4PSX B;  3I7H A;  4JSP C;  4AN0 A;  3MZL A;  3GD1 I;  5FKR A;  3RN0 D;  4J0X A;  4O3T B;  3SVW D;  5EM2 B;  5TF2 A;  2H13 A;  3N0D A;  3MUN A;  4XYI A;  3DM0 A;  2VC2 A;  4BCC A; 
#chains in the Genus database with same CATH homology
 5THA A;  3VH0 A;  4N14 A;  2J55 H;  4BUJ C;  4E5Z B;  3SCY A;  3JPX A;  1OMW B;  5KDO B;  5CXB A;  3MMY A;  4PXW A;  4FAV D;  2AGW A;  3RMZ D;  3F3F A;  2YNP A;  3GRE A;  4FA4 D;  4GM9 A;  2EBS A;  1U4C A;  4QQE A;  3CIK B;  3KRX B;  3PSC B;  4CI3 A;  2HES X;  3N0E A;  4L3G D;  5FKQ A;  2OJY A;  4CZY A;  1VYH C;  4A11 B;  3JZG A;  5B4W A;  1JJU B;  5EML B;  3EMH A;  1L0Q A;  4PNK B;  1Q47 A;  2OVR B;  3E0C A;  4JSX C;  3EI1 B;  2TRC B;  2H14 A;  2I3T A;  3AL8 A;  2XL2 A;  3OW8 A;  3JRP A;  3PXS D;  5A2Q g;  3ODT A;  4GMB A;  3GFC A;  1N6E A;  2CN3 A;  3C75 H;  3UVK A;  5HE3 B;  4AEZ A;  4D6V A;  4ZOY A;  1GG2 B;  4J79 A;  2YNO A;  5IGO A;  3BWS A;  5SXM A;  3PXT D;  4GQ2 P;  3PVU B;  1N6D A;  4CI8 A;  5FA5 B;  2UZX B;  2P9P C;  4J78 A;  2MTA H;  5EAM A;  4I79 A;  2PM9 A;  1MG2 A;  2QXV A;  2AH1 A;  1N6F A;  1JMZ B;  3OL2 A;  1B9Y A;  2H68 A;  5EAP A;  2I0S A;  3DXM C;  2H6N A;  5IJ8 E;  3I7K A;  3OKT A;  3EWE A;  3IIW A;  4A09 A;  5CYK A;  2HYE A;  2B5L A;  4JD2 C;  2B5M A;  3C9C A;  3NVN A;  4A08 A;  3UKR C;  5IJ7 E;  1TYQ C;  3L4M D;  3SBQ A;  2IAA A;  4O3U B;  5K1C C;  5I5M A;  5HE2 B;  4ZOZ A;  4L3H D;  2H3X A;  2OK6 A;  4CC9 A;  2Z2O A;  5AMS A;  5EAL A;  2H47 A;  5FKS A;  4ZN4 A;  2I0R A;  5FQD A;  3NVX A;  3IJ0 A;  3RSE C;  2OIZ A;  3IIY A;  3C5M A;  1JMX B;  4J84 A;  4X63 B;  3V7D B;  3L4O D;  2P9K C;  4X61 B;  3EI3 B;  4FA9 D;  4ERY A;  4IA9 A;  5IC7 A;  5EMM B;  2UZY B;  3U4Y A;  4J8G A;  4Z8L A;  4ERQ A;  5TEF A;  3PXW D;  5FKT A;  2P9S C;  3I7L A;  5AJA A;  5TEE A;  3VA6 A;  4PSW B;  3K27 A;  2H9N A;  2CO0 C;  4GQ1 A;  3CFV A;  2AH0 A;  2HJB A;  3EU7 A;  4J0W A;  2CN2 A;  2O9K A;  3EI4 B;  1NR0 A;  5AFU 3;  2P9N C;  3OTT A;  4H5J A;  3OKW A;  4FWW A;  4L9O A;  5CXC B;  2HKR A;  4K3J B;  2Q7Q A;  4XYH A;  4QT8 A;  5FXY A;  4A0B A;  3IJ1 A;  2H9P A;  3MXX A;  3I89 A;  4A7J A;  2IWK A;  1XKS A;  2IUQ A;  3SJL D;  4MK0 B;  3I2N A;  3OKY B;  3PSL A;  3KRW B;  3DSM A;  4OWR A;  2AGY A;  5EM2 A;  1XHM A;  4J77 A;  5HE0 B;  4J82 A;  2B4E A;  2CE8 A;  2YMU A;  4CY3 A;  3BG1 A;  4CY5 A;  4E5Z A;  2BBK H;  5HE1 B;  4UI9 R;  4GM3 A;  4BL0 A;  1JOF A;  3SBR A;  2XL3 A;  3EI2 A;  1GOT B;  3C99 A;  3PVW B;  2J56 H;  4A2M A;  4IMM A;  1U2V C;  3UVO A;  4A0A B;  4PC0 A;  1SQ9 A;  5HQG A;  3V9F A;  2YNN A;  2P9L C;  3F3G A;  4CI1 A;  1MG3 A;  2H6K A;  2H6Q A;  5C2V B;  1P22 A;  1QNI A;  2I0T A;  2OVP B;  3ULE C;  4J8B A;  3UVL A;  2H9L A;  4E54 B;  4A11 A;  3FM0 A;  3AFC A;  4FHL A;  4LG9 A;  5CXB B;  3SLE D;  5H1M A;  1PGU A;  2AGL A;  2HJ4 A;  4ES0 A;  3UKU C;  4BH6 A;  2H9M A;  4J87 A;  4LGN A;  4XEI C;  3ZWL B;  4ERZ A;  3EI1 A;  4KFM B;  1GXR A;  2PBI B;  4TZ4 A;  5EMK B;  2G99 A;  1MDA H;  4A2L A;  3A0F A;  3SXT D;  4X60 B;  4D0K A;  4ZOV A;  5GXI A;  2CNX A;  3F3P A;  3JAM g;  1PEV A;  4U7A A;  3MZK A;  1GP2 B;  4O9D A;  5K19 A;  3NVQ A;  1A0R B;  2QC5 A;  3I8E A;  2J57 G;  1S4U X;  5GSA A;  4CY2 A;  3UVM A;  4ESG A;  4NSX A;  1YFQ A;  4Y7R A;  2HXC A;  3AL8 B;  4O1Q D;  2YBA A;  4J86 A;  3RFG A;  4FA5 D;  2W18 A;  3I7N A;  2GC7 A;  3MKS B;  3K26 A;  2AGZ A;  1PI6 A;  3I7O A;  3SN6 B;  2G9A A;  4GGD A;  4GQB B;  5GMK n;  4CI2 A;  5C9Z B;  2PM7 B;  2CO0 A;  1OLZ A;  4HDJ A;  3EI2 B;  3RRM C;  3RN1 D;  2BCJ B;  3JZN A;  4CZV A;  3W15 A;  3SWS D;  5TDH B;  4Y5R D;  5FLX g;  3FRX A;  4O45 A;  2PM9 B;  4JSV C;  4GGC A;  5GXH A;  3RFH A;  2I3S A;  3OL2 B;  3J81 g;  5H14 A;  3CFS B;  4EWR A;  5I5J A;  4OZU A;  4U1E I;  3VGZ A;  3V5W B;  2P9I C;  3I8C A;  4CY1 A;  1B9X A;  4ZOX A;  4A09 B;  3HFQ A;  1NEX B;  4H5I A;  5CYK B;  3JB9 L;  2AQ5 A;  3IJC A;  3B7F A;  2P9U C;  4A08 B;  2PM6 B;  2B5N A;  5EMJ B;  1PBY B;  3EI3 A;  3UR4 A;  3MKQ A;  4J73 A;  5HYN B;  4QL1 A;  3ORV D;  5EAR A;  3PE7 A;  4GGA A;  2AGX A;  5IGQ A;  4R7A B;  2GC4 A;  4PBY A;  3P4F A;  1XIP A;  4LG8 A;  3AL9 A;  2CE9 A;  1SHY B;  3SBP A;  3EI4 A;  1K32 A;  1R5M A;  5JWZ A;  2YB8 B;  2IUP A;  4AOW A;  4JXM A;  5C2W B;  5IT9 g;  1ERJ A;  4JSN C;  1RI6 A;  4PBZ A;  3BG0 A;  2Z2P A;  3FGB A;  5CXC A;  4FAN D;  1K8K C;  3IKO A;  4GZ8 A;  2OK4 A;  4L1Q D;  4YVD A;  5H17 A;  2IUR A;  2GNQ A;  3DWL C;  5I5I A;  2OVQ B;  3OKY A;  4QRJ A;  4GM8 A;  2HKM A;  4JT5 C;  3RLM D;  1TBG A;  3SMR A;  2XU7 A;  3UVN A;  3I7P A;  1FWX A;  4X3E A;  4CZX A;  3SFZ A;  3J80 g;  3JRO A;  3DXK C;  4K3I D;  3AH8 B;  2Z2N A;  3SHF A;  4A0B B;  4JT6 C;  4FB1 D;  2XYI A;  4A0A A;  4G56 B;  4FA1 D;  2IWF A;  4J81 A;  1SQJ A;  2IUV A;  3EG6 A;  3JZH A;  4PSX B;  3I7H A;  4JSP C;  3MZL A;  5FKR A;  3RN0 D;  4J0X A;  4O3T B;  3SVW D;  5EM2 B;  5TF2 A;  2H13 A;  3N0D A;  4XYI A;  3DM0 A;  4E54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...