3N0EA

Crystal structure of wdr5 mutant (w330y)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
315
Chain Sequence
GGQQMGRGSEFVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLYKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Effect of Asp-His-Ser/Thr-Trp Tetrad on the Thermostability of WD40-Repeat Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
total genus 94
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3n0eA00
3SCYA 5GXHA 4A09A 4JSVC 1TBGA 3SJLD 1N6EA 3BG0A 4GGDA 4BUJC 4JT6C 3N0EA 3VA6A 1XHMA 3DM0A 4E5ZB 4FHLA 5AMSA 1XKSA 3MKSB 5HE0B 4FAND 3I7KA 2Z2NA 4D0KA 3N0DA 4CI3A 4CY5A 2GC4A 3PXSD 4A0AA 3EI1A 4IA9A 1XIPA 4FA1D 4A11B 5I5IA 2BBKH 3OL2B 1S4UX 3L4MD 2UZXB 3I8CA 2CE9A 3EU7A 3ODTA 3OKYB 1N6FA 4O3UB 2I3TA 3OL2A 1NR0A 3UVMA 1GOTB 4U7AA 4E54A 3SMRA 3ZWLB 4JSXC 3I7LA 5IC7A 2AGZA 5IJ8E 3EI1B 2EBSA 4JXMA 3JZHA 1MDAH 3EI3B 3V5WB 1PBYB 3P4FA 5HE1B 4A09B 3EMHA 5TDHB 3KRWB 3IJ0A 2B4EA 4X61B 2GNQA 4PNKB 4CI1A 3MMYA 4Y5RD 3BWSA 3RFGA 2I0TA 2HYEA 3J80g 4CI2A 3I2NA 3UKUC 5C2VB 3B7FA 5TF2A 2H14A 4Z8LA 3FM0A 4EWRA 5THAA 4E5ZA 4J73A 2P9KC 2AQ5A 4HDJA 3V7DB 4O3TB 4ZOXA 3EI2A 3UR4A 5I5MA 3F3FA 4LGNA 1K32A 1TYQC 4ERYA 1VYHC 3EI4A 4MK0B 4Y7RA 4J0XA 4TZ4A 2YNOA 5CXBB 2Z2PA 3RLMD 3C9CA 3V9FA 5FKTA 2AH0A 4FA5D 5H14A 2I3SA 3W15A 2AGYA 2PM7B 5K19A 3UVKA 3J81g 2OVRB 3BG1A 3EWEA 4O9DA 2B5LA 4PC0A 5FXYA 5GMKn 4GZ8A 4JD2C 5CXBA 3VH0A 3DXKC 2G9AA 3EI3A 4J86A 5FKQA 3I7HA 4A2MA 4GQ2P 2H13A 4L3HD 3PE7A 1YFQA 2AGLA 4L1QD 1P22A 1A0RB 2HJBA 4X3EA 4FAVD 4A0BA 3JZNA 4GGCA 2H68A 4FA9D 3GFCA 1MG3A 4GGAA 2J57G 3MKQA 2H6NA 4PXWA 3CIKB 5HE3B 3I89A 3NVQA 1JMXB 4L3GD 3ULEC 3SVWD 4J81A 4J8GA 5IGQA 4JSNC 4GM3A 2Q7QA 2OK6A 4OZUA 4J8BA 2P9LC 2H6KA 3C75H 3A0FA 5FA5B 3SBPA 4XYIA 3PVWB 4GM8A 4AOWA 2OVPB 5EMMB 2BCJB 4ERQA 3EI2B 2PM9A 3RN1D 3E0CA 3AL9A 2P9PC 2MTAH 5EARA 3F3PA 3C99A 3EI4B 5FQDA 2I0SA 5IGOA 4ZOYA 2PM6B 5CXCB 1NEXB 4ESGA 3JROA 5TEEA 4J82A 3PVUB 3I8EA 1ERJA 3RRMC 4GMBA 3NVXA 3I7NA 4A08A 4N14A 2G99A 5C9ZB 1RI6A 2OVQB 4IMMA 4ZOZA 4U1EI 1K8KC 4PBYA 4A08B 3SWSD 5C2WB 2O9KA 2W18A 1U4CA 5I5JA 4QL1A 3U4YA 1GG2B 1PGUA 2P9SC 4CI8A 4BL0A 3NVNA 2HXCA 1FWXA 4A11A 3IIYA 3K26A 3FRXA 3C5MA 3IJCA 4GQ1A 5HQGA 2H9NA 4X60B 4QQEA 2Z2OA 3UVNA 2IURA 3RSEC 2IUPA 3UVOA 5HE2B 1PI6A 5GSAA 5EMKB 2CE8A 3FGBA 2UZYB 3GREA 4FB1D 5EAMA 2P9IC 2H9MA 1OLZA 3AH8B 3OKWA 4UI9R 5TEFA 3SBQA 4H5IA 3L4OD 2HKMA 3SBRA 4E54B 2IAAA 5FLXg 4PBZA 5CXCA 5FKSA 3SFZA 2TRCB 2HJ4A 2H47A 5GXIA 5CYKA 3DWLC 3MZKA 4QT8A 4O1QD 3UKRC 4A2LA 4ZOVA 3EG6A 3OTTA 3PXWD 2AH1A 1OMWB 2IWFA 5EMLB 2J55H 5AFU3 4CZYA 2QXVA 3KRXB 5B4WA 3ORVD 4ZN4A 2J56H 4XEIC 3SHFA 5AJAA 3JPXA 2B5NA 3SN6B 2H6QA 4J87A 2AGWA 2H3XA 3DXMC 5FKRA 4JT5C 3F3GA 3IJ1A 3UVLA 4A0AB 5SXMA 4ERZA 5A2Qg 3PXTD 2P9UC 4JSPC 4J0WA 4CY1A 1JJUB 1R5MA 1N6DA 4AEZA 2PBIB 1L0QA 3PSLA 2YMUA 4CZVA 2AGXA 4BH6A 2HESX 4GQBB 5H1MA 2GC7A 1MG2A 3MXXA 2HKRA 4LG8A 2IUVA 3AFCA 2I0RA 1B9XA 2OIZA 2IWKA 5CYKB 3VGZA 3RFHA 5EMJB 4PSWB 5EALA 5IT9g 1QNIA 1JOFA 5EM2B 4J84A 3OW8A 3IIWA 4H5JA 4KFMB 4O45A 4OWRA 2XL3A 1JMZB 4LG9A 4ES0A 4QRJA 4J77A 4PSXB 4X63B 5JWZA 3SLED 3HFQA 3I7PA 3OKYA 4J78A 2YB8B 2XYIA 4A0BB 1U2VC 1SQJA 1Q47A 4CY2A 3RN0D 2PM9B 3AL8A 4K3ID 3JZGA 3OKTA 2CO0C 4GM9A 4FWWA 5EAPA 2YBAA 3K27A 4FA4D 1GXRA 4D6VA 3CFVA 4I79A 5KDOB 3SXTD 2XL2A 3CFSB 4G56B 3JB9L 4CC9A 2QC5A 2CO0A 4NSXA 2YNPA 2B5MA 3JRPA 3AL8B 4J79A 3MZLA 1PEVA 1SQ9A 3I7OA 5EM2A 3RMZD 1SHYB 4K3JB 2H9LA 2OJYA 4A7JA 3DSMA 5H17A 1GP2B 5IJ7E 2CN3A 2CN2A 3PSCB 2OK4A 4CY3A 2XU7A 4XYHA 2CNXA 5K1CC 4CZXA 1B9YA 4L9OA 5HYNB 3JAMg 2H9PA 3IKOA 4R7AB 4YVDA 2IUQA 2P9NC 2YNNA
chains in the Genus database with same CATH superfamily
3SCYA 5GXHA 4A09A 4JSVC 1TBGA 3SJLD 5M5TA 1N6EA 3BG0A 3OF7A 4GGDA 4BUJC 4JT6C 4O02A 3N0EA 3VA6A 1XHMA 2VDQA 3DM0A 4E5ZB 4FHLA 3QHYB 5AMSA 1XKSA 3MKSB 5HE0B 4BCCA 4FAND 3I7KA 2Z2NA 4D0KA 3N0DA 4CI3A 4CY5A 2JKXA 3IUMA 2GC4A 3EQ9A 3DDUA 4MMYA 3PXSD 4A0AA 3EI1A 4IA9A 1XIPA 4O2WA 4FA1D 3IUNA 4A11B 5I5IA 3QI0A 2BBKH 4Z7NA 5M5RA 3OL2B 1S4UX 3L4MD 2UZXB 3I8CA 2CE9A 3EU7A 3ODTA 3OKYB 4Z7OA 1N6FA 2VDLA 2VZ1A 4O3UB 2I3TA 3OL2A 1NR0A 3UVMA 1GOTB 4U7AA 4WK4A 4E54A 3SMRA 3ZWLB 4JSXC 3I7LA 5IC7A 2AGZA 5IJ8E 3EI1B 2EBSA 3MVDK 4JXMA 3JZHA 1MDAH 3EI3B 3V5WB 2EIEA 1O6GA 1PBYB 3NIFA 3P4FA 5HE1B 4A09B 1I2MB 3EMHA 4JHPC 2VDMA 3IJ0A 3KRWB 2B4EA 5TDHB 4X61B 2GNQA 5FFGA 4PNKB 4CI1A 3MMYA 4Y5RD 3BWSA 5HDBA 1GOFA 2VZ3A 5M5UA 3RFGA 2I0TA 2HYEA 3J80g 4CI2A 3I2NA 3UKUC 5C2VB 3B7FA 5TF2A 2H14A 4D9SA 4Z8LA 3FM0A 4EWRA 5THAA 4E5ZA 4J73A 2P9KC 5M5SA 2AQ5A 4HDJA 1H2XA 3V7DB 4O3TB 4ZOXA 3EI2A 3UR4A 1VZ2A 5I5MA 3F3FA 4LGNA 4UM9A 4L1MA 1K32A 1TYQC 2VDPA 4ERYA 4BCBA 4DNWA 1VYHC 3EI4A 3ZDZA 4MK0B 4Y7RA 3GC3B 4J0XA 4TZ4A 2YNOA 5CXBB 2Z2PA 1C9IA 3RLMD 3C9CA 1UTCA 3V4VA 3V9FA 5FKTA 2AH0A 4FA5D 4DNUA 4MMZA 5H14A 2I3SA 4NC4A 3W15A 2AGYA 2PM7B 5K19A 4RE5A 3UVKA 3J81g 3KCIA 2OVRB 3BG1A 3O4JA 3EWEA 4G1MA 4O9DA 2B5LA 4PC0A 5FXYA 5GMKn 2VDKA 4GZ8A 4JD2C 5CXBA 3VH0A 3DXKC 3VI3A 2G9AA 3EI3A 4J86A 5FKQA 3I7HA 3MUNA 5FFOA 4A2MA 4GQ2P 2H13A 4L3HD 3ZE2A 3PE7A 1YFQA 2AGLA 1GOGA 4L1QD 1P22A 1A0RB 1UOPA 2HJBA 4X3EA 4FAVD 4A0BA 3JZNA 4JHNA 4GGCA 2H68A 4FA9D 3GFCA 1MG3A 4GGAA 2J57G 3MKQA 2QR5A 2H6NA 2EIBA 4PXWA 3CIKB 5HE3B 3I89A 3NVQA 1JMXB 4L3GD 1L5GA 2XZGA 2QZPA 3ULEC 3SVWD 4J81A 4J8GA 5IGQA 3ZE1A 4JSNC 4GM3A 2Q7QA 2OK6A 4OZUA 4IRZA 4J8BA 2P9LC 1E8NA 2H6KA 3C75H 3A0FA 5FA5B 3SBPA 3T3MA 4XYIA 1U8CA 3PVWB 4GM8A 4AOWA 2OVPB 5EMMB 2VDNA 2BCJB 4ERQA 3EI2B 2PM9A 3RN1D 3E0CA 3AL9A 2P9PC 2MTAH 5EARA 4AMZA 3F3PA 4NBMA 3C99A 3EI4B 5FQDA 2I0SA 5IGOA 4ZOYA 2PM6B 3O4IA 2VC2A 5CXCB 5E6SA 1NEXB 4ESGA 3JROA 5TEEA 4J82A 3PVUB 3I8EA 1ERJA 5C86A 3RRMC 4GMBA 1C9LA 3NVXA 3I7NA 4A08A 4N14A 2G99A 4Z7QA 3FCSA 5C9ZB 2VDRA 5M5VA 1RI6A 2OVQB 4IMMA 4ZOZA 4U1EI 1K8KC 1JTDB 4PBYA 4A08B 3SWSD 5C2WB 2O9KA 2W18A 1U4CA 5I5JA 2XDWA 4QL1A 3U4YA 1GG2B 1PGUA 1E5TA 2P9SC 4CI8A 4BL0A 3NVNA 2HXCA 1FWXA 5E6UA 3ZDXA 4BP8A 4A11A 3IIYA 3K26A 1H2WA 3FRXA 4QAMA 1TYEA 3C5MA 1VE6A 3IJCA 4GQ1A 4WJKA 5HQGA 2H9NA 4X60B 4QQEA 2Z2OA 3UVNA 2IURA 3RSEC 2IUPA 3UVOA 3V4PA 5HE2B 1PI6A 2HU8A 5EMKB 5GSAA 2CE8A 3FGBA 2UZYB 3GREA 3K71A 4AX4A 1BPOA 4FB1D 3MUOA 5EAMA 2P9IC 2H9MA 1OLZA 3AH8B 3OKWA 4UI9R 5TEFA 3SBQA 4H5IA 3L4OD 2HKMA 3SBRA 4E54B 2IAAA 5FLXg 4PBZA 5CXCA 1YR2A 3ZE0A 3IUJA 5FKSA 4AN0A 4RE6A 2TRCB 2HJ4A 3SFZA 2H47A 5GXIA 3FCUA 5CYKA 3DWLC 3IURA 4G55A 3MZKA 4QT8A 4O1QD 3UKRC 4A2LA 4ZOVA 3EG6A 3OTTA 3PXWD 2AH1A 1OMWB 2IWFA 4MMXA 4UM8A 5EMLB 4WK0A 2J55H 5AFU3 4CZYA 2QXVA 3KRXB 5B4WA 3ORVD 3NIGA 4ZN4A 2J56H 4XEIC 3SHFA 5AJAA 3JPXA 2B5NA 3SN6B 2H6QA 4J87A 2AGWA 3O4GA 2H3XA 3DXMC 5FKRA 4JT5C 3F3GA 5E6RA 3IJ1A 4WK2A 3UVLA 4A0AB 5SXMA 4ERZA 5A2Qg 3PXTD 2P9UC 4JSPC 4J0WA 4CY1A 1JJUB 1R5MA 1N6DA 4AEZA 3ZDYA 2PBIB 1VZ3A 3IULA 1L0QA 3T3PA 3PSLA 1H2ZA 2YMUA 4CZVA 2AGXA 4G1EA 4BH6A 2HESX 4GQBB 5H1MA 3VI4A 2GC7A 1MG2A 3MXXA 2HKRA 4LG8A 2IUVA 3AFCA 2I0RA 1B9XA 3EQ8A 2OIZA 2IWKA 1O6FA 5CYKB 3VGZA 3RFHA 1JV2A 5EMJB 4PSWB 5M61A 2BKLA 5EALA 1H2YA 1A12A 5IT9g 1QNIA 1JOFA 5EM2B 4J84A 3EQ7A 3OW8A 4BCDA 3IIWA 4H5JA 3IUQA 4KFMB 1QFSA 4O45A 4NENA 4OWRA 2XL3A 2WQ8A 1JMZB 4LG9A 4ES0A 4QRJA 4J77A 4PSXB 4X63B 1K3IA 5JWZA 3SLED 3HFQA 3I7PA 3OKYA 4J78A 2YB8B 4DNVA 4NAAA 2XYIA 4A0BB 1U2VC 1SQJA 1Q47A 4CY2A 1UOOA 3RN0D 2PM9B 3AL8A 4K3ID 3JZGA 3OKTA 2CO0C 4GM9A 4FWWA 5EAPA 4BP9A 1E8MA 2YBAA 3K27A 4FA4D 1GXRA 4AN1A 4D6VA 3CFVA 2XE4A 3NIDA 4I79A 5KDOB 2EIDA 3SXTD 2XL2A 3CFSB 4G56B 3JB9L 4CC9A 2QC5A 2CO0A 4NSXA 2YNPA 1T2XA 1QFMA 2B5MA 3JRPA 3AL8B 4J79A 3MZLA 4AMYA 5C92A 1PEVA 1SQ9A 3I7OA 1UOQA 1M1XA 3IVMA 5EM2A 3RMZD 1SHYB 4K3JB 2H9LA 2OJYA 4A7JA 3DSMA 1GOHA 5H17A 2VDOA 1GP2B 5IJ7E 2CN3A 2HU7A 2CN2A 3PSCB 2OK4A 4CY3A 2XU7A 3O4HA 2CNXA 3K72A 4XYHA 5K1CC 4CZXA 1B9YA 4L9OA 5HYNB 3JAMg 3IJEA 2EICA 3GD1I 2H9PA 3IKOA 4R7AB 4YVDA 2IUQA 1VE7A 3K6SA 2HU5A 2P9NC 2YNNA
chains in the Genus database with same CATH topology
3SCYA 5GXHA 4A09A 4JSVC 1TBGA 3SJLD 1N6EA 3BG0A 4GGDA 4BUJC 4JT6C 3N0EA 3VA6A 1XHMA 3DM0A 4E5ZB 4FHLA 5AMSA 1XKSA 3MKSB 5HE0B 4FAND 3I7KA 2Z2NA 4D0KA 3N0DA 4CI3A 4CY5A 2GC4A 3PXSD 4A0AA 3EI1A 4IA9A 1XIPA 4FA1D 4A11B 5I5IA 2BBKH 3OL2B 1S4UX 3L4MD 2UZXB 3I8CA 2CE9A 3EU7A 3ODTA 3OKYB 1N6FA 4O3UB 2I3TA 3OL2A 1NR0A 3UVMA 1GOTB 4U7AA 4E54A 3SMRA 3ZWLB 4JSXC 3I7LA 5IC7A 2AGZA 5IJ8E 3EI1B 2EBSA 4JXMA 3JZHA 1MDAH 3EI3B 3V5WB 1PBYB 3P4FA 5HE1B 4A09B 3EMHA 5TDHB 3KRWB 3IJ0A 2B4EA 4X61B 2GNQA 4PNKB 4CI1A 3MMYA 4Y5RD 3BWSA 3RFGA 2I0TA 2HYEA 3J80g 4CI2A 3I2NA 3UKUC 5C2VB 3B7FA 5TF2A 2H14A 4Z8LA 3FM0A 4EWRA 5THAA 4E5ZA 4J73A 2P9KC 2AQ5A 4HDJA 3V7DB 4O3TB 4ZOXA 3EI2A 3UR4A 5I5MA 3F3FA 4LGNA 1K32A 1TYQC 4ERYA 1VYHC 3EI4A 4MK0B 4Y7RA 4J0XA 4TZ4A 2YNOA 5CXBB 2Z2PA 3RLMD 3C9CA 3V9FA 5FKTA 2AH0A 4FA5D 5H14A 2I3SA 3W15A 2AGYA 2PM7B 5K19A 3UVKA 3J81g 2OVRB 3BG1A 3EWEA 4O9DA 2B5LA 4PC0A 5FXYA 5GMKn 4GZ8A 4JD2C 5CXBA 3VH0A 3DXKC 2G9AA 3EI3A 4J86A 5FKQA 3I7HA 4A2MA 4GQ2P 2H13A 4L3HD 3PE7A 1YFQA 2AGLA 4L1QD 1P22A 1A0RB 2HJBA 4X3EA 4FAVD 4A0BA 3JZNA 4GGCA 2H68A 4FA9D 3GFCA 1MG3A 4GGAA 2J57G 3MKQA 2H6NA 4PXWA 3CIKB 5HE3B 3I89A 3NVQA 1JMXB 4L3GD 3ULEC 3SVWD 4J81A 4J8GA 5IGQA 4JSNC 4GM3A 2Q7QA 2OK6A 4OZUA 4J8BA 2P9LC 2H6KA 3C75H 3A0FA 5FA5B 3SBPA 4XYIA 3PVWB 4GM8A 4AOWA 2OVPB 5EMMB 2BCJB 4ERQA 3EI2B 2PM9A 3RN1D 3E0CA 3AL9A 2P9PC 2MTAH 5EARA 3F3PA 3C99A 3EI4B 5FQDA 2I0SA 5IGOA 4ZOYA 2PM6B 5CXCB 1NEXB 4ESGA 3JROA 5TEEA 4J82A 3PVUB 3I8EA 1ERJA 3RRMC 4GMBA 3NVXA 3I7NA 4A08A 4N14A 2G99A 5C9ZB 1RI6A 2OVQB 4IMMA 4ZOZA 4U1EI 1K8KC 4PBYA 4A08B 3SWSD 5C2WB 2O9KA 2W18A 1U4CA 5I5JA 4QL1A 3U4YA 1GG2B 1PGUA 2P9SC 4CI8A 4BL0A 3NVNA 2HXCA 1FWXA 4A11A 3IIYA 3K26A 3FRXA 3C5MA 3IJCA 4GQ1A 5HQGA 2H9NA 4X60B 4QQEA 2Z2OA 3UVNA 2IURA 3RSEC 2IUPA 3UVOA 5HE2B 1PI6A 5GSAA 5EMKB 2CE8A 3FGBA 2UZYB 3GREA 4FB1D 5EAMA 2P9IC 2H9MA 1OLZA 3AH8B 3OKWA 4UI9R 5TEFA 3SBQA 4H5IA 3L4OD 2HKMA 3SBRA 4E54B 2IAAA 5FLXg 4PBZA 5CXCA 5FKSA 3SFZA 2TRCB 2HJ4A 2H47A 5GXIA 5CYKA 3DWLC 3MZKA 4QT8A 4O1QD 3UKRC 4A2LA 4ZOVA 3EG6A 3OTTA 3PXWD 2AH1A 1OMWB 2IWFA 5EMLB 2J55H 5AFU3 4CZYA 2QXVA 3KRXB 5B4WA 3ORVD 4ZN4A 2J56H 4XEIC 3SHFA 5AJAA 3JPXA 2B5NA 3SN6B 2H6QA 4J87A 2AGWA 2H3XA 3DXMC 5FKRA 4JT5C 3F3GA 3IJ1A 3UVLA 4A0AB 5SXMA 4ERZA 5A2Qg 3PXTD 2P9UC 4JSPC 4J0WA 4CY1A 1JJUB 1R5MA 1N6DA 4AEZA 2PBIB 1L0QA 3PSLA 2YMUA 4CZVA 2AGXA 4BH6A 2HESX 4GQBB 5H1MA 2GC7A 1MG2A 3MXXA 2HKRA 4LG8A 2IUVA 3AFCA 2I0RA 1B9XA 2OIZA 2IWKA 5CYKB 3VGZA 3RFHA 5EMJB 4PSWB 5EALA 5IT9g 1QNIA 1JOFA 5EM2B 4J84A 3OW8A 3IIWA 4H5JA 4KFMB 4O45A 4OWRA 2XL3A 1JMZB 4LG9A 4ES0A 4QRJA 4J77A 4PSXB 4X63B 5JWZA 3SLED 3HFQA 3I7PA 3OKYA 4J78A 2YB8B 2XYIA 4A0BB 1U2VC 1SQJA 1Q47A 4CY2A 3RN0D 2PM9B 3AL8A 4K3ID 3JZGA 3OKTA 2CO0C 4GM9A 4FWWA 5EAPA 2YBAA 3K27A 4FA4D 1GXRA 4D6VA 3CFVA 4I79A 5KDOB 3SXTD 2XL2A 3CFSB 4G56B 3JB9L 4CC9A 2QC5A 2CO0A 4NSXA 2YNPA 2B5MA 3JRPA 3AL8B 4J79A 3MZLA 1PEVA 1SQ9A 3I7OA 5EM2A 3RMZD 1SHYB 4K3JB 2H9LA 2OJYA 4A7JA 3DSMA 5H17A 1GP2B 5IJ7E 2CN3A 2CN2A 3PSCB 2OK4A 4CY3A 2XU7A 4XYHA 2CNXA 5K1CC 4CZXA 1B9YA 4L9OA 5HYNB 3JAMg 2H9PA 3IKOA 4R7AB 4YVDA 2IUQA 2P9NC 2YNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SCY A;  5GXH A;  4A09 A;  4JSV C;  1TBG A;  3SJL D;  1N6E A;  3BG0 A;  4GGD A;  4BUJ C;  4JT6 C;  3N0E A;  3VA6 A;  1XHM A;  3DM0 A;  4E5Z B;  4FHL A;  5AMS A;  1XKS A;  3MKS B;  5HE0 B;  4FAN D;  3I7K A;  2Z2N A;  4D0K A;  3N0D A;  4CI3 A;  4CY5 A;  2GC4 A;  3PXS D;  4A0A A;  3EI1 A;  4IA9 A;  1XIP A;  4FA1 D;  4A11 B;  5I5I A;  2BBK H;  3OL2 B;  1S4U X;  3L4M D;  2UZX B;  3I8C A;  2CE9 A;  3EU7 A;  3ODT A;  3OKY B;  1N6F A;  4O3U B;  2I3T A;  3OL2 A;  1NR0 A;  3UVM A;  1GOT B;  4U7A A;  4E54 A;  3SMR A;  3ZWL B;  4JSX C;  3I7L A;  5IC7 A;  2AGZ A;  5IJ8 E;  3EI1 B;  2EBS A;  4JXM A;  3JZH A;  1MDA H;  3EI3 B;  3V5W B;  1PBY B;  3P4F A;  5HE1 B;  4A09 B;  3EMH A;  5TDH B;  3KRW B;  3IJ0 A;  2B4E A;  4X61 B;  2GNQ A;  4PNK B;  4CI1 A;  3MMY A;  4Y5R D;  3BWS A;  3RFG A;  2I0T A;  2HYE A;  3J80 g;  4CI2 A;  3I2N A;  3UKU C;  5C2V B;  3B7F A;  5TF2 A;  2H14 A;  4Z8L A;  3FM0 A;  4EWR A;  5THA A;  4E5Z A;  4J73 A;  2P9K C;  2AQ5 A;  4HDJ A;  3V7D B;  4O3T B;  4ZOX A;  3EI2 A;  3UR4 A;  5I5M A;  3F3F A;  4LGN A;  1K32 A;  1TYQ C;  4ERY A;  1VYH C;  3EI4 A;  4MK0 B;  4Y7R A;  4J0X A;  4TZ4 A;  2YNO A;  5CXB B;  2Z2P A;  3RLM D;  3C9C A;  3V9F A;  5FKT A;  2AH0 A;  4FA5 D;  5H14 A;  2I3S A;  3W15 A;  2AGY A;  2PM7 B;  5K19 A;  3UVK A;  3J81 g;  2OVR B;  3BG1 A;  3EWE A;  4O9D A;  2B5L A;  4PC0 A;  5FXY A;  5GMK n;  4GZ8 A;  4JD2 C;  5CXB A;  3VH0 A;  3DXK C;  2G9A A;  3EI3 A;  4J86 A;  5FKQ A;  3I7H A;  4A2M A;  4GQ2 P;  2H13 A;  4L3H D;  3PE7 A;  1YFQ A;  2AGL A;  4L1Q D;  1P22 A;  1A0R B;  2HJB A;  4X3E A;  4FAV D;  4A0B A;  3JZN A;  4GGC A;  2H68 A;  4FA9 D;  3GFC A;  1MG3 A;  4GGA A;  2J57 G;  3MKQ A;  2H6N A;  4PXW A;  3CIK B;  5HE3 B;  3I89 A;  3NVQ A;  1JMX B;  4L3G D;  3ULE C;  3SVW D;  4J81 A;  4J8G A;  5IGQ A;  4JSN C;  4GM3 A;  2Q7Q A;  2OK6 A;  4OZU A;  4J8B A;  2P9L C;  2H6K A;  3C75 H;  3A0F A;  5FA5 B;  3SBP A;  4XYI A;  3PVW B;  4GM8 A;  4AOW A;  2OVP B;  5EMM B;  2BCJ B;  4ERQ A;  3EI2 B;  2PM9 A;  3RN1 D;  3E0C A;  3AL9 A;  2P9P C;  2MTA H;  5EAR A;  3F3P A;  3C99 A;  3EI4 B;  5FQD A;  2I0S A;  5IGO A;  4ZOY A;  2PM6 B;  5CXC B;  1NEX B;  4ESG A;  3JRO A;  5TEE A;  4J82 A;  3PVU B;  3I8E A;  1ERJ A;  3RRM C;  4GMB A;  3NVX A;  3I7N A;  4A08 A;  4N14 A;  2G99 A;  5C9Z B;  1RI6 A;  2OVQ B;  4IMM A;  4ZOZ A;  4U1E I;  1K8K C;  4PBY A;  4A08 B;  3SWS D;  5C2W B;  2O9K A;  2W18 A;  1U4C A;  5I5J A;  4QL1 A;  3U4Y A;  1GG2 B;  1PGU A;  2P9S C;  4CI8 A;  4BL0 A;  3NVN A;  2HXC A;  1FWX A;  4A11 A;  3IIY A;  3K26 A;  3FRX A;  3C5M A;  3IJC A;  4GQ1 A;  5HQG A;  2H9N A;  4X60 B;  4QQE A;  2Z2O A;  3UVN A;  2IUR A;  3RSE C;  2IUP A;  3UVO A;  5HE2 B;  1PI6 A;  5GSA A;  5EMK B;  2CE8 A;  3FGB A;  2UZY B;  3GRE A;  4FB1 D;  5EAM A;  2P9I C;  2H9M A;  1OLZ A;  3AH8 B;  3OKW A;  4UI9 R;  5TEF A;  3SBQ A;  4H5I A;  3L4O D;  2HKM A;  3SBR A;  4E54 B;  2IAA A;  5FLX g;  4PBZ A;  5CXC A;  5FKS A;  3SFZ A;  2TRC B;  2HJ4 A;  2H47 A;  5GXI A;  5CYK A;  3DWL C;  3MZK A;  4QT8 A;  4O1Q D;  3UKR C;  4A2L A;  4ZOV A;  3EG6 A;  3OTT A;  3PXW D;  2AH1 A;  1OMW B;  2IWF A;  5EML B;  2J55 H;  5AFU 3;  4CZY A;  2QXV A;  3KRX B;  5B4W A;  3ORV D;  4ZN4 A;  2J56 H;  4XEI C;  3SHF A;  5AJA A;  3JPX A;  2B5N A;  3SN6 B;  2H6Q A;  4J87 A;  2AGW A;  2H3X A;  3DXM C;  5FKR A;  4JT5 C;  3F3G A;  3IJ1 A;  3UVL A;  4A0A B;  5SXM A;  4ERZ A;  5A2Q g;  3PXT D;  2P9U C;  4JSP C;  4J0W A;  4CY1 A;  1JJU B;  1R5M A;  1N6D A;  4AEZ A;  2PBI B;  1L0Q A;  3PSL A;  2YMU A;  4CZV A;  2AGX A;  4BH6 A;  2HES X;  4GQB B;  5H1M A;  2GC7 A;  1MG2 A;  3MXX A;  2HKR A;  4LG8 A;  2IUV A;  3AFC A;  2I0R A;  1B9X A;  2OIZ A;  2IWK A;  5CYK B;  3VGZ A;  3RFH A;  5EMJ B;  4PSW B;  5EAL A;  5IT9 g;  1QNI A;  1JOF A;  5EM2 B;  4J84 A;  3OW8 A;  3IIW A;  4H5J A;  4KFM B;  4O45 A;  4OWR A;  2XL3 A;  1JMZ B;  4LG9 A;  4ES0 A;  4QRJ A;  4J77 A;  4PSX B;  4X63 B;  5JWZ A;  3SLE D;  3HFQ A;  3I7P A;  3OKY A;  4J78 A;  2YB8 B;  2XYI A;  4A0B B;  1U2V C;  1SQJ A;  1Q47 A;  4CY2 A;  3RN0 D;  2PM9 B;  3AL8 A;  4K3I D;  3JZG A;  3OKT A;  2CO0 C;  4GM9 A;  4FWW A;  5EAP A;  2YBA A;  3K27 A;  4FA4 D;  1GXR A;  4D6V A;  3CFV A;  4I79 A;  5KDO B;  3SXT D;  2XL2 A;  3CFS B;  4G56 B;  3JB9 L;  4CC9 A;  2QC5 A;  2CO0 A;  4NSX A;  2YNP A;  2B5M A;  3JRP A;  3AL8 B;  4J79 A;  3MZL A;  1PEV A;  1SQ9 A;  3I7O A;  5EM2 A;  3RMZ D;  1SHY B;  4K3J B;  2H9L A;  2OJY A;  4A7J A;  3DSM A;  5H17 A;  1GP2 B;  5IJ7 E;  2CN3 A;  2CN2 A;  3PSC B;  2OK4 A;  4CY3 A;  2XU7 A;  4XYH A;  2CNX A;  5K1C C;  4CZX A;  1B9Y A;  4L9O A;  5HYN B;  3JAM g;  2H9P A;  3IKO A;  4R7A B;  4YVD A;  2IUQ A;  2P9N C;  2YNN A; 
#chains in the Genus database with same CATH topology
 3SCY A;  5GXH A;  4A09 A;  4JSV C;  1TBG A;  3SJL D;  5M5T A;  1N6E A;  3BG0 A;  3OF7 A;  4GGD A;  4BUJ C;  4JT6 C;  4O02 A;  3N0E A;  3VA6 A;  1XHM A;  2VDQ A;  3DM0 A;  4E5Z B;  4FHL A;  3QHY B;  5AMS A;  1XKS A;  3MKS B;  5HE0 B;  4BCC A;  4FAN D;  3I7K A;  2Z2N A;  4D0K A;  3N0D A;  4CI3 A;  4CY5 A;  2JKX A;  3IUM A;  2GC4 A;  3EQ9 A;  3DDU A;  4MMY A;  3PXS D;  4A0A A;  3EI1 A;  4IA9 A;  1XIP A;  4O2W A;  4FA1 D;  3IUN A;  4A11 B;  5I5I A;  3QI0 A;  2BBK H;  4Z7N A;  5M5R A;  3OL2 B;  1S4U X;  3L4M D;  2UZX B;  3I8C A;  2CE9 A;  3EU7 A;  3ODT A;  3OKY B;  4Z7O A;  1N6F A;  2VDL A;  2VZ1 A;  4O3U B;  2I3T A;  3OL2 A;  1NR0 A;  3UVM A;  1GOT B;  4U7A A;  4WK4 A;  4E54 A;  3SMR A;  3ZWL B;  4JSX C;  3I7L A;  5IC7 A;  2AGZ A;  5IJ8 E;  3EI1 B;  2EBS A;  3MVD K;  4JXM A;  3JZH A;  1MDA H;  3EI3 B;  3V5W B;  2EIE A;  1O6G A;  1PBY B;  3NIF A;  3P4F A;  5HE1 B;  4A09 B;  1I2M B;  3EMH A;  4JHP C;  2VDM A;  3IJ0 A;  3KRW B;  2B4E A;  5TDH B;  4X61 B;  2GNQ A;  5FFG A;  4PNK B;  4CI1 A;  3MMY A;  4Y5R D;  3BWS A;  5HDB A;  1GOF A;  2VZ3 A;  5M5U A;  3RFG A;  2I0T A;  2HYE A;  3J80 g;  4CI2 A;  3I2N A;  3UKU C;  5C2V B;  3B7F A;  5TF2 A;  2H14 A;  4D9S A;  4Z8L A;  3FM0 A;  4EWR A;  5THA A;  4E5Z A;  4J73 A;  2P9K C;  5M5S A;  2AQ5 A;  4HDJ A;  1H2X A;  3V7D B;  4O3T B;  4ZOX A;  3EI2 A;  3UR4 A;  1VZ2 A;  5I5M A;  3F3F A;  4LGN A;  4UM9 A;  4L1M A;  1K32 A;  1TYQ C;  2VDP A;  4ERY A;  4BCB A;  4DNW A;  1VYH C;  3EI4 A;  3ZDZ A;  4MK0 B;  4Y7R A;  3GC3 B;  4J0X A;  4TZ4 A;  2YNO A;  5CXB B;  2Z2P A;  1C9I A;  3RLM D;  3C9C A;  1UTC A;  3V4V A;  3V9F A;  5FKT A;  2AH0 A;  4FA5 D;  4DNU A;  4MMZ A;  5H14 A;  2I3S A;  4NC4 A;  3W15 A;  2AGY A;  2PM7 B;  5K19 A;  4RE5 A;  3UVK A;  3J81 g;  3KCI A;  2OVR B;  3BG1 A;  3O4J A;  3EWE A;  4G1M A;  4O9D A;  2B5L A;  4PC0 A;  5FXY A;  5GMK n;  2VDK A;  4GZ8 A;  4JD2 C;  5CXB A;  3VH0 A;  3DXK C;  3VI3 A;  2G9A A;  3EI3 A;  4J86 A;  5FKQ A;  3I7H A;  3MUN A;  5FFO A;  4A2M A;  4GQ2 P;  2H13 A;  4L3H D;  3ZE2 A;  3PE7 A;  1YFQ A;  2AGL A;  1GOG A;  4L1Q D;  1P22 A;  1A0R B;  1UOP A;  2HJB A;  4X3E A;  4FAV D;  4A0B A;  3JZN A;  4JHN A;  4GGC A;  2H68 A;  4FA9 D;  3GFC A;  1MG3 A;  4GGA A;  2J57 G;  3MKQ A;  2QR5 A;  2H6N A;  2EIB A;  4PXW A;  3CIK B;  5HE3 B;  3I89 A;  3NVQ A;  1JMX B;  4L3G D;  1L5G A;  2XZG A;  2QZP A;  3ULE C;  3SVW D;  4J81 A;  4J8G A;  5IGQ A;  3ZE1 A;  4JSN C;  4GM3 A;  2Q7Q A;  2OK6 A;  4OZU A;  4IRZ A;  4J8B A;  2P9L C;  1E8N A;  2H6K A;  3C75 H;  3A0F A;  5FA5 B;  3SBP A;  3T3M A;  4XYI A;  1U8C A;  3PVW B;  4GM8 A;  4AOW A;  2OVP B;  5EMM B;  2VDN A;  2BCJ B;  4ERQ A;  3EI2 B;  2PM9 A;  3RN1 D;  3E0C A;  3AL9 A;  2P9P C;  2MTA H;  5EAR A;  4AMZ A;  3F3P A;  4NBM A;  3C99 A;  3EI4 B;  5FQD A;  2I0S A;  5IGO A;  4ZOY A;  2PM6 B;  3O4I A;  2VC2 A;  5CXC B;  5E6S A;  1NEX B;  4ESG A;  3JRO A;  5TEE A;  4J82 A;  3PVU B;  3I8E A;  1ERJ A;  5C86 A;  3RRM C;  4GMB A;  1C9L A;  3NVX A;  3I7N A;  4A08 A;  4N14 A;  2G99 A;  4Z7Q A;  3FCS A;  5C9Z B;  2VDR A;  5M5V A;  1RI6 A;  2OVQ B;  4IMM A;  4ZOZ A;  4U1E I;  1K8K C;  1JTD B;  4PBY A;  4A08 B;  3SWS D;  5C2W B;  2O9K A;  2W18 A;  1U4C A;  5I5J A;  2XDW A;  4QL1 A;  3U4Y A;  1GG2 B;  1PGU A;  1E5T A;  2P9S C;  4CI8 A;  4BL0 A;  3NVN A;  2HXC A;  1FWX A;  5E6U A;  3ZDX A;  4BP8 A;  4A11 A;  3IIY A;  3K26 A;  1H2W A;  3FRX A;  4QAM A;  1TYE A;  3C5M A;  1VE6 A;  3IJC A;  4GQ1 A;  4WJK A;  5HQG A;  2H9N A;  4X60 B;  4QQE A;  2Z2O A;  3UVN A;  2IUR A;  3RSE C;  2IUP A;  3UVO A;  3V4P A;  5HE2 B;  1PI6 A;  2HU8 A;  5EMK B;  5GSA A;  2CE8 A;  3FGB A;  2UZY B;  3GRE A;  3K71 A;  4AX4 A;  1BPO A;  4FB1 D;  3MUO A;  5EAM A;  2P9I C;  2H9M A;  1OLZ A;  3AH8 B;  3OKW A;  4UI9 R;  5TEF A;  3SBQ A;  4H5I A;  3L4O D;  2HKM A;  3SBR A;  4E54 B;  2IAA A;  5FLX g;  4PBZ A;  5CXC A;  1YR2 A;  3ZE0 A;  3IUJ A;  5FKS A;  4AN0 A;  4RE6 A;  2TRC B;  2HJ4 A;  3SFZ A;  2H47 A;  5GXI A;  3FCU A;  5CYK A;  3DWL C;  3IUR A;  4G55 A;  3MZK A;  4QT8 A;  4O1Q D;  3UKR C;  4A2L A;  4ZOV A;  3EG6 A;  3OTT A;  3PXW D;  2AH1 A;  1OMW B;  2IWF A;  4MMX A;  4UM8 A;  5EML B;  4WK0 A;  2J55 H;  5AFU 3;  4CZY A;  2QXV A;  3KRX B;  5B4W A;  3ORV D;  3NIG A;  4ZN4 A;  2J56 H;  4XEI C;  3SHF A;  5AJA A;  3JPX A;  2B5N A;  3SN6 B;  2H6Q A;  4J87 A;  2AGW A;  3O4G A;  2H3X A;  3DXM C;  5FKR A;  4JT5 C;  3F3G A;  5E6R A;  3IJ1 A;  4WK2 A;  3UVL A;  4A0A B;  5SXM A;  4ERZ A;  5A2Q g;  3PXT D;  2P9U C;  4JSP C;  4J0W A;  4CY1 A;  1JJU B;  1R5M A;  1N6D A;  4AEZ A;  3ZDY A;  2PBI B;  1VZ3 A;  3IUL A;  1L0Q A;  3T3P A;  3PSL A;  1H2Z A;  2YMU A;  4CZV A;  2AGX A;  4G1E A;  4BH6 A;  2HES X;  4GQB B;  5H1M A;  3VI4 A;  2GC7 A;  1MG2 A;  3MXX A;  2HKR A;  4LG8 A;  2IUV A;  3AFC A;  2I0R A;  1B9X A;  3EQ8 A;  2OIZ A;  2IWK A;  1O6F A;  5CYK B;  3VGZ A;  3RFH A;  1JV2 A;  5EMJ B;  4PSW B;  5M61 A;  2BKL A;  5EAL A;  1H2Y A;  1A12 A;  5IT9 g;  1QNI A;  1JOF A;  5EM2 B;  4J84 A;  3EQ7 A;  3OW8 A;  4BCD A;  3IIW A;  4H5J A;  3IUQ A;  4KFM B;  1QFS A;  4O45 A;  4NEN A;  4OWR A;  2XL3 A;  2WQ8 A;  1JMZ B;  4LG9 A;  4ES0 A;  4QRJ A;  4J77 A;  4PSX B;  4X63 B;  1K3I A;  5JWZ A;  3SLE D;  3HFQ A;  3I7P A;  3OKY A;  4J78 A;  2YB8 B;  4DNV A;  4NAA A;  2XYI A;  4A0B B;  1U2V C;  1SQJ A;  1Q47 A;  4CY2 A;  1UOO A;  3RN0 D;  2PM9 B;  3AL8 A;  4K3I D;  3JZG A;  3OKT A;  2CO0 C;  4GM9 A;  4FWW A;  5EAP A;  4BP9 A;  1E8M A;  2YBA A;  3K27 A;  4FA4 D;  1GXR A;  4AN1 A;  4D6V A;  3CFV A;  2XE4 A;  3NID A;  4I79 A;  5KDO B;  2EID A;  3SXT D;  2XL2 A;  3CFS B;  4G56 B;  3JB9 L;  4CC9 A;  2QC5 A;  2CO0 A;  4NSX A;  2YNP A;  1T2X A;  1QFM A;  2B5M A;  3JRP A;  3AL8 B;  4J79 A;  3MZL A;  4AMY A;  5C92 A;  1PEV A;  1SQ9 A;  3I7O A;  1UOQ A;  1M1X A;  3IVM A;  5EM2 A;  3RMZ D;  1SHY B;  4K3J B;  2H9L A;  2OJY A;  4A7J A;  3DSM A;  1GOH A;  5H17 A;  2VDO A;  1GP2 B;  5IJ7 E;  2CN3 A;  2HU7 A;  2CN2 A;  3PSC B;  2OK4 A;  4CY3 A;  2XU7 A;  3O4H A;  2CNX A;  3K72 A;  4XYH A;  5K1C C;  4CZX A;  1B9Y A;  4L9O A;  5HYN B;  3JAM g;  3IJE A;  2EIC A;  3GD1 I;  2H9P A;  3IKO A;  4R7A B;  4YVD A;  2IUQ A;  1VE7 A;  3K6S A;  2HU5 A;  2P9N C;  2YNN A; 
#chains in the Genus database with same CATH homology
 3SCY A;  5GXH A;  4A09 A;  4JSV C;  1TBG A;  3SJL D;  1N6E A;  3BG0 A;  4GGD A;  4BUJ C;  4JT6 C;  3N0E A;  3VA6 A;  1XHM A;  3DM0 A;  4E5Z B;  4FHL A;  5AMS A;  1XKS A;  3MKS B;  5HE0 B;  4FAN D;  3I7K A;  2Z2N A;  4D0K A;  3N0D A;  4CI3 A;  4CY5 A;  2GC4 A;  3PXS D;  4A0A A;  3EI1 A;  4IA9 A;  1XIP A;  4FA1 D;  4A11 B;  5I5I A;  2BBK H;  3OL2 B;  1S4U X;  3L4M D;  2UZX B;  3I8C A;  2CE9 A;  3EU7 A;  3ODT A;  3OKY B;  1N6F A;  4O3U B;  2I3T A;  3OL2 A;  1NR0 A;  3UVM A;  1GOT B;  4U7A A;  4E54 A;  3SMR A;  3ZWL B;  4JSX C;  3I7L A;  5IC7 A;  2AGZ A;  5IJ8 E;  3EI1 B;  2EBS A;  4JXM A;  3JZH A;  1MDA H;  3EI3 B;  3V5W B;  1PBY B;  3P4F A;  5HE1 B;  4A09 B;  3EMH A;  5TDH B;  3KRW B;  3IJ0 A;  2B4E A;  4X61 B;  2GNQ A;  4PNK B;  4CI1 A;  3MMY A;  4Y5R D;  3BWS A;  3RFG A;  2I0T A;  2HYE A;  3J80 g;  4CI2 A;  3I2N A;  3UKU C;  5C2V B;  3B7F A;  5TF2 A;  2H14 A;  4Z8L A;  3FM0 A;  4EWR A;  5THA A;  4E5Z A;  4J73 A;  2P9K C;  2AQ5 A;  4HDJ A;  3V7D B;  4O3T B;  4ZOX A;  3EI2 A;  3UR4 A;  5I5M A;  3F3F A;  4LGN A;  1K32 A;  1TYQ C;  4ERY A;  1VYH C;  3EI4 A;  4MK0 B;  4Y7R A;  4J0X A;  4TZ4 A;  2YNO A;  5CXB B;  2Z2P A;  3RLM D;  3C9C A;  3V9F A;  5FKT A;  2AH0 A;  4FA5 D;  5H14 A;  2I3S A;  3W15 A;  2AGY A;  2PM7 B;  5K19 A;  3UVK A;  3J81 g;  2OVR B;  3BG1 A;  3EWE A;  4O9D A;  2B5L A;  4PC0 A;  5FXY A;  5GMK n;  4GZ8 A;  4JD2 C;  5CXB A;  3VH0 A;  3DXK C;  2G9A A;  3EI3 A;  4J86 A;  5FKQ A;  3I7H A;  4A2M A;  4GQ2 P;  2H13 A;  4L3H D;  3PE7 A;  1YFQ A;  2AGL A;  4L1Q D;  1P22 A;  1A0R B;  2HJB A;  4X3E A;  4FAV D;  4A0B A;  3JZN A;  4GGC A;  2H68 A;  4FA9 D;  3GFC A;  1MG3 A;  4GGA A;  2J57 G;  3MKQ A;  2H6N A;  4PXW A;  3CIK B;  5HE3 B;  3I89 A;  3NVQ A;  1JMX B;  4L3G D;  3ULE C;  3SVW D;  4J81 A;  4J8G A;  5IGQ A;  4JSN C;  4GM3 A;  2Q7Q A;  2OK6 A;  4OZU A;  4J8B A;  2P9L C;  2H6K A;  3C75 H;  3A0F A;  5FA5 B;  3SBP A;  4XYI A;  3PVW B;  4GM8 A;  4AOW A;  2OVP B;  5EMM B;  2BCJ B;  4ERQ A;  3EI2 B;  2PM9 A;  3RN1 D;  3E0C A;  3AL9 A;  2P9P C;  2MTA H;  5EAR A;  3F3P A;  3C99 A;  3EI4 B;  5FQD A;  2I0S A;  5IGO A;  4ZOY A;  2PM6 B;  5CXC B;  1NEX B;  4ESG A;  3JRO A;  5TEE A;  4J82 A;  3PVU B;  3I8E A;  1ERJ A;  3RRM C;  4GMB A;  3NVX A;  3I7N A;  4A08 A;  4N14 A;  2G99 A;  5C9Z B;  1RI6 A;  2OVQ B;  4IMM A;  4ZOZ A;  4U1E I;  1K8K C;  4PBY A;  4A08 B;  3SWS D;  5C2W B;  2O9K A;  2W18 A;  1U4C A;  5I5J A;  4QL1 A;  3U4Y A;  1GG2 B;  1PGU A;  2P9S C;  4CI8 A;  4BL0 A;  3NVN A;  2HXC A;  1FWX A;  4A11 A;  3IIY A;  3K26 A;  3FRX A;  3C5M A;  3IJC A;  4GQ1 A;  5HQG A;  2H9N A;  4X60 B;  4QQE A;  2Z2O A;  3UVN A;  2IUR A;  3RSE C;  2IUP A;  3UVO A;  5HE2 B;  1PI6 A;  5GSA A;  5EMK B;  2CE8 A;  3FGB A;  2UZY B;  3GRE A;  4FB1 D;  5EAM A;  2P9I C;  2H9M A;  1OLZ A;  3AH8 B;  3OKW A;  4UI9 R;  5TEF A;  3SBQ A;  4H5I A;  3L4O D;  2HKM A;  3SBR A;  4E54 B;  2IAA A;  5FLX g;  4PBZ A;  5CXC A;  5FKS A;  3SFZ A;  2TRC B;  2HJ4 A;  2H47 A;  5GXI A;  5CYK A;  3DWL C;  3MZK A;  4QT8 A;  4O1Q D;  3UKR C;  4A2L A;  4ZOV A;  3EG6 A;  3OTT A;  3PXW D;  2AH1 A;  1OMW B;  2IWF A;  5EML B;  2J55 H;  5AFU 3;  4CZY A;  2QXV A;  3KRX B;  5B4W A;  3ORV D;  4ZN4 A;  2J56 H;  4XEI C;  3SHF A;  5AJA A;  3JPX A;  2B5N A;  3SN6 B;  2H6Q A;  4J87 A;  2AGW A;  2H3X A;  3DXM C;  5FKR A;  4JT5 C;  3F3G A;  3IJ1 A;  3UVL A;  4A0A B;  5SXM A;  4ERZ A;  5A2Q g;  3PXT D;  2P9U C;  4JSP C;  4J0W A;  4CY1 A;  1JJU B;  1R5M A;  1N6D A;  4AEZ A;  2PBI B;  1L0Q A;  3PSL A;  2YMU A;  4CZV A;  2AGX A;  4BH6 A;  2HES X;  4GQB B;  5H1M A;  2GC7 A;  1MG2 A;  3MXX A;  2HKR A;  4LG8 A;  2IUV A;  3AFC A;  2I0R A;  1B9X A;  2OIZ A;  2IWK A;  5CYK B;  3VGZ A;  3RFH A;  5EMJ B;  4PSW B;  5EAL A;  5IT9 g;  1QNI A;  1JOF A;  5EM2 B;  4J84 A;  3OW8 A;  3IIW A;  4H5J A;  4KFM B;  4O45 A;  4OWR A;  2XL3 A;  1JMZ B;  4LG9 A;  4ES0 A;  4QRJ A;  4J77 A;  4PSX B;  4X63 B;  5JWZ A;  3SLE D;  3HFQ A;  3I7P A;  3OKY A;  4J78 A;  2YB8 B;  2XYI A;  4A0B B;  1U2V C;  1SQJ A;  1Q47 A;  4CY2 A;  3RN0 D;  2PM9 B;  3AL8 A;  4K3I D;  3JZG A;  3OKT A;  2CO0 C;  4GM9 A;  4FWW A;  5EAP A;  2YBA A;  3K27 A;  4FA4 D;  1GXR A;  4D6V A;  3CFV A;  4I79 A;  5KDO B;  3SXT D;  2XL2 A;  3CFS B;  4G56 B;  3JB9 L;  4CC9 A;  2QC5 A;  2CO0 A;  4NSX A;  2YNP A;  2B5M A;  3JRP A;  3AL8 B;  4J79 A;  3MZL A;  1PEV A;  1SQ9 A;  3I7O A;  5EM2 A;  3RMZ D;  1SHY B;  4K3J B;  2H9L A;  2OJY A;  4A7J A;  3DSM A;  5H17 A;  1GP2 B;  5IJ7 E;  2CN3 A;  2CN2 A;  3PSC B;  2OK4 A;  4CY3 A;  2XU7 A;  4XYH A;  2CNX A;  5K1C C;  4CZX A;  1B9Y A;  4L9O A;  5HYN B;  3JAM g;  2H9P A;  3IKO A;  4R7A B;  4YVD A;  2IUQ A;  2P9N C;  2YNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...