3N0EA

Crystal structure of wdr5 mutant (w330y)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
315
Chain Sequence
b'GGQQMGRGSEFVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLYKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title The Effect of Asp-His-Ser/Thr-Trp Tetrad on the Thermostability of WD40-Repeat Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 94
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3n0eA00
3MKSB 3OKYB 5SXMA 3EI2A 3I7LA 1GXRA 2I0SA 5HE1B 3I7KA 3EI4A 3OKYA 4XEIC 3CFVA 3FGBA 2AGXA 5H17A 4AEZA 2OJYA 4QT8A 3DM0A 3IIYA 1JJUB 3EI1B 4GM9A 5CYKA 5EAPA 2IWFA 2GNQA 4UI9R 2OIZA 3PSCB 3KRWB 4A7JA 1XHMA 5IT9g 1TBGA 4GQ2P 2P9PC 3NVNA 5EMLB 2B5MA 4X3EA 2PBIB 5GXIA 2Z2PA 4O9DA 3SWSD 3UR4A 2CN3A 4BH6A 5FKQA 4CY5A 3MZKA 1RI6A 1N6FA 1FWXA 3K27A 4E5ZA 1TYQC 5HQGA 1SQJA 2PM6B 3GREA 4FA5D 2PM7B 3RRMC 2AH1A 4L9OA 1K8KC 4U7AA 3PVUB 5HE2B 4ZOYA 1PEVA 2CE8A 5I5IA 1ERJA 2HKRA 4FHLA 4GQBB 1QNIA 3JZNA 3F3GA 2H6KA 2J56H 4A2MA 4QQEA 3MMYA 4CI1A 3N0EA 2CN2A 4X60B 2QC5A 4PC0A 2OVQB 4A08B 5HE0B 2AGLA 3UKRC 3AFCA 1NEXB 4A08A 1GOTB 4AOWA 4GGDA 2IWKA 3SHFA 4ERQA 2HJ4A 2AGYA 4H5JA 3I8CA 3I7PA 1SQ9A 4JXMA 2AH0A 3C9CA 1NR0A 4L1QD 4J79A 2PM9B 1OMWB 2XL3A 3I7OA 5K19A 2P9LC 1MG2A 4J82A 1JOFA 4MK0B 5FKSA 2YB8B 2YNNA 2HESX 4HDJA 4JT5C 5HE3B 1JMXB 4PNKB 5C9ZB 4J77A 4OWRA 2B5NA 3SLED 3OKWA 3PE7A 4L3GD 3I7HA 3P4FA 3ZWLB 1S4UX 3SVWD 3SJLD 4ZOXA 3SBQA 2I0TA 2H47A 4O45A 3EI2B 4U1EI 2UZXB 5KDOB 3ULEC 1Q47A 4IMMA 2CE9A 3IKOA 3JRPA 4A2LA 3VH0A 2OK6A 3MZLA 3MKQA 3SCYA 4CY3A 4GGCA 5EM2B 3IJCA 2H6QA 4JT6C 5CYKB 4EWRA 3CFSB 3OW8A 4JSPC 3JAMg 4CY2A 5EM2A 1B9XA 2HKMA 4FA1D 4FAVD 2TRCB 5EMKB 4GM8A 3A0FA 4IA9A 2BCJB 3L4OD 3FRXA 3NVQA 3UVKA 4E5ZB 3EI3B 3E0CA 5I5MA 2G9AA 4GZ8A 2AQ5A 2MTAH 4J8GA 5IC7A 3EI3A 4CC9A 4PXWA 2YBAA 4LGNA 4ZN4A 4D6VA 3CIKB 4ZOVA 3IJ0A 1XIPA 3RN0D 3OL2A 1MDAH 4TZ4A 5IGOA 4JSNC 2H13A 5H1MA 3RFHA 3GFCA 4JSVC 3I89A 4Y5RD 5B4WA 4A09A 2Z2OA 2XU7A 5C2WB 1A0RB 1L0QA 3VGZA 1U4CA 4A0AB 4CI3A 3B7FA 4N14A 4NSXA 5TEFA 4K3JB 4PBYA 1XKSA 2IUQA 2HJBA 2I3SA 4A0AA 1R5MA 3I7NA 2BBKH 1GP2B 2EBSA 3F3FA 4PSXB 3SXTD 2H9LA 4ZOZA 3JPXA 2IUVA 4JD2C 2H6NA 4J87A 3AL8B 2UZYB 2YMUA 3EWEA 4CI2A 2CO0A 4A0BA 1N6DA 3AL8A 4O3UB 3VA6A 4FA9D 4FA4D 3U4YA 5HYNB 1VYHC 1PBYB 4PSWB 1K32A 4CY1A 3C99A 5TEEA 2AGZA 3JZHA 2YNPA 5IGQA 5AJAA 4GQ1A 2H68A 5THAA 4GGAA 4D0KA 4J78A 3OTTA 1B9YA 2Z2NA 3PXWD 2OVRB 4J84A 3J81g 3PXSD 2B4EA 2P9KC 4LG9A 3RN1D 3EG6A 3I2NA 4G56B 2IAAA 4OZUA 2GC4A 4J81A 5EAMA 2AGWA 2IURA 4BUJC 3N0DA 4CZYA 5IJ8E 5A2Qg 4CI8A 4PBZA 1GG2B 4QL1A 3SMRA 2HXCA 5EMMB 4BL0A 1U2VC 2H9PA 1PI6A 2P9SC 3UVOA 3W15A 2G99A 4YVDA 4ERZA 5IJ7E 3SFZA 4KFMB 3IIWA 2CNXA 5GSAA 3DXKC 3ORVD 4E54B 4H5IA 3RSEC 2P9NC 5EARA 2H9MA 3SBPA 4J86A 2Q7QA 4E54A 4XYHA 2W18A 4QRJA 3F3PA 4LG8A 4A11B 3AL9A 3OL2B 4A11A 4FB1D 4O3TB 4GMBA 5GMKn 4A09B 4ERYA 3C75H 3EI1A 2I3TA 2GC7A 3NVXA 3I8EA 3RLMD 3V7DB 5FQDA 5CXCB 3KRXB 4J8BA 2CO0C 5H14A 2HYEA 3DSMA 1MG3A 2O9KA 3RFGA 3PVWB 4R7AB 5CXCA 4Y7RA 2H9NA 3ODTA 5EMJB 3V5WB 2H14A 4XYIA 3BWSA 5FA5B 3DXMC 2IUPA 4X63B 5FKTA 2P9UC 5C2VB 4A0BB 2OK4A 5AFU3 5EALA 4CZVA 5FLXg 4L3HD 2J57G 3HFQA 4Z8LA 4J73A 3DWLC 5TF2A 4X61B 3SBRA 3V9FA 5K1CC 3MXXA 3C5MA 5CXBB 3FM0A 3PSLA 2I0RA 5CXBA 1P22A 3J80g 2YNOA 4J0XA 5JWZA 1SHYB 4J0WA 5I5JA 3PXTD 1JMZB 3SN6B 2J55H 2XL2A 3UKUC 2QXVA 4FWWA 5GXHA 3AH8B 4ES0A 2OVPB 5AMSA 3K26A 3UVMA 4CZXA 2PM9A 1PGUA 3EMHA 3OKTA 1YFQA 3UVLA 3BG1A 3JB9L 2XYIA 5FKRA 1OLZA 3JZGA 5FXYA 3RMZD 1N6EA 5TDHB 4K3ID 4FAND 2B5LA 4I79A 4GM3A 3IJ1A 4ESGA 3JROA 3UVNA 3EU7A 2P9IC 4JSXC 4O1QD 3L4MD 3BG0A 2H3XA 3EI4B
chains in the Genus database with same CATH superfamily
4DNVA 3MKSB 1A12A 1VZ3A 1VE7A 3OKYB 5SXMA 3EI2A 3I7LA 1GXRA 2I0SA 5HE1B 3I7KA 3EI4A 3OKYA 2WQ8A 4XEIC 3CFVA 3FGBA 2AGXA 5H17A 1H2ZA 4AEZA 3ZE0A 2QZPA 2OJYA 4QT8A 3DM0A 3IIYA 1JJUB 3EI1B 3NIGA 4GM9A 4NC4A 5CYKA 5EAPA 4Z7QA 2IWFA 2GNQA 4UI9R 2OIZA 1E5TA 3PSCB 3KRWB 4A7JA 1XHMA 5IT9g 1TBGA 4GQ2P 2P9PC 3NVNA 5EMLB 2B5MA 4X3EA 3IULA 2PBIB 5GXIA 2Z2PA 4O9DA 3SWSD 3UR4A 2CN3A 4NENA 5FKQA 4BH6A 3MZKA 4CY5A 1GOGA 1RI6A 1N6FA 1FWXA 3K27A 4E5ZA 1TYQC 3NIFA 5HQGA 4L1MA 1SQJA 2PM6B 4DNWA 3GREA 4FA5D 2PM7B 3RRMC 2AH1A 3FCSA 4L9OA 1K8KC 4U7AA 3PVUB 4O02A 5HE2B 2EIBA 4ZOYA 3IJEA 1PEVA 1H2WA 2CE8A 5I5IA 1ERJA 3EQ8A 2HKRA 4FHLA 4GQBB 1QNIA 4NBMA 3JZNA 3F3GA 3V4PA 2H6KA 2J56H 4A2MA 4QQEA 3IURA 3MMYA 4CI1A 3N0EA 2CN2A 2VDLA 3O4JA 4X60B 2QC5A 4PC0A 2OVQB 4A08B 5HE0B 2AGLA 3UKRC 4QAMA 3AFCA 1QFSA 1NEXB 4A08A 1GOTB 4AOWA 4GGDA 2IWKA 3SHFA 4BP9A 2HJ4A 3IUMA 4ERQA 2AGYA 4H5JA 3I8CA 3I7PA 3VI3A 1SQ9A 4JXMA 2AH0A 3C9CA 1NR0A 2EIEA 4L1QD 4J79A 2PM9B 1OMWB 4UM9A 2XL3A 3I7OA 5K19A 2P9LC 1MG2A 3QHYB 4J82A 1JOFA 5FFGA 4MK0B 4MMXA 5FKSA 2YB8B 2YNNA 2HESX 5M5VA 4HDJA 4JT5C 5HE3B 1JMXB 4PNKB 5C9ZB 3KCIA 4J77A 4OWRA 2B5NA 3MUOA 3SLED 2QR5A 3OKWA 3PE7A 1TYEA 4L3GD 3I7HA 3P4FA 4WK4A 3ZWLB 1S4UX 3SVWD 3SJLD 4ZOXA 3SBQA 2I0TA 5FFOA 2H47A 4AN1A 4O45A 3EI2B 1U8CA 4U1EI 2UZXB 5KDOB 3ULEC 4O2WA 2VDQA 1Q47A 4IMMA 2CE9A 3IKOA 1O6GA 3JRPA 3O4IA 4G1MA 4JHPC 4A2LA 3VH0A 2OK6A 5C86A 3MZLA 3MKQA 3SCYA 4CY3A 4GGCA 5EM2B 3IJCA 1UTCA 2H6QA 4JT6C 5CYKB 3GC3B 4EWRA 1VE6A 3CFSB 3OW8A 4JSPC 3JAMg 3MUNA 4CY2A 5EM2A 1B9XA 3ZE2A 2HKMA 4FA1D 4FAVD 2TRCB 5EMKB 4GM8A 3A0FA 4IA9A 2BCJB 2XE4A 4Z7NA 4WK2A 1L5GA 3L4OD 3FRXA 3NVQA 3UVKA 3K72A 4E5ZB 3EI3B 3E0CA 5I5MA 2G9AA 4GZ8A 2AQ5A 2MTAH 4J8GA 5IC7A 3EI3A 2XDWA 4CC9A 4PXWA 1QFMA 2YBAA 4LGNA 4ZN4A 4BP8A 4D6VA 3CIKB 1M1XA 4ZOVA 3FCUA 3IJ0A 1XIPA 3RN0D 3OL2A 4AN0A 1MDAH 2VDOA 4TZ4A 5IGOA 4JSNC 2H13A 5H1MA 3RFHA 1C9IA 2VDRA 3ZDZA 3GFCA 4JSVC 3I89A 4Y5RD 5B4WA 4A09A 2Z2OA 1H2XA 2XU7A 5C2WB 1A0RB 1L0QA 4UM8A 3VGZA 1U4CA 4A0AB 3VI4A 4CI3A 3B7FA 4N14A 4NSXA 5TEFA 3V4VA 4K3JB 5HDBA 4PBYA 1XKSA 2IUQA 2HJBA 5C92A 5M5UA 2I3SA 4A0AA 1R5MA 3I7NA 2BBKH 2HU7A 1GP2B 2EBSA 2HU8A 3F3FA 4PSXB 3SXTD 5M5RA 2H9LA 2VDPA 4ZOZA 3JPXA 2IUVA 4JD2C 2H6NA 4J87A 3AL8B 2UZYB 2YMUA 3EWEA 3IUQA 4CI2A 2CO0A 4A0BA 1C9LA 3EQ7A 1N6DA 3AL8A 4O3UB 3VA6A 2VDNA 4FA9D 4FA4D 3U4YA 3ZDYA 1JV2A 5HYNB 1VYHC 1PBYB 4PSWB 5M5TA 3IVMA 1K32A 4CY1A 3C99A 5TEEA 2AGZA 3JZHA 2YNPA 5IGQA 5AJAA 4GQ1A 2H68A 5THAA 4GGAA 4D0KA 4J78A 3OTTA 4G1EA 1B9YA 1E8MA 2Z2NA 4BCBA 3ZE1A 3PXWD 1JTDB 2OVRB 4J84A 3J81g 3PXSD 2B4EA 2P9KC 4LG9A 3RN1D 3EG6A 3I2NA 4G56B 2IAAA 4OZUA 2GC4A 4J81A 5EAMA 2BKLA 5M61A 3K6SA 1UOOA 2AGWA 2HU5A 2IURA 4BUJC 3N0DA 4CZYA 5IJ8E 3NIDA 4AX4A 5A2Qg 1T2XA 2XZGA 4CI8A 4Z7OA 4WJKA 4PBZA 1GG2B 4QL1A 3SMRA 2HXCA 4RE5A 5EMMB 4BL0A 1U2VC 2H9PA 1PI6A 2P9SC 3UVOA 3W15A 2G99A 4AMYA 1E8NA 4YVDA 4ERZA 5IJ7E 3SFZA 1UOPA 1H2YA 3IIWA 2CNXA 4KFMB 4AMZA 5GSAA 3DXKC 3ORVD 4E54B 2EIDA 4H5IA 3RSEC 2P9NC 1BPOA 5EARA 2H9MA 3SBPA 4J86A 2Q7QA 4E54A 4XYHA 2W18A 3T3MA 4QRJA 3F3PA 4LG8A 5E6SA 4A11B 1GOFA 3AL9A 3OL2B 4A11A 4RE6A 4FB1D 4O3TB 4GMBA 5GMKn 4A09B 4ERYA 3C75H 3EI1A 2I3TA 4MMYA 2GC7A 3I8EA 3NVXA 3RLMD 4D9SA 3V7DB 5FQDA 5CXCB 3KRXB 4J8BA 2CO0C 5E6RA 5H14A 3DSMA 2HYEA 1MG3A 2O9KA 3RFGA 3PVWB 4IRZA 4R7AB 5CXCA 4Y7RA 1YR2A 2H9NA 3ODTA 3DDUA 5EMJB 3V5WB 2H14A 1GOHA 4XYIA 3BWSA 5FA5B 3DXMC 2IUPA 1K3IA 4X63B 5FKTA 2P9UC 5C2VB 4A0BB 2OK4A 5AFU3 2EICA 5EALA 4CZVA 5FLXg 4L3HD 2VC2A 2J57G 3HFQA 4Z8LA 4J73A 3DWLC 5TF2A 5E6UA 3QI0A 4X61B 3SBRA 3V9FA 5K1CC 3MXXA 3C5MA 5CXBB 4BCCA 1O6FA 2VDKA 3FM0A 3PSLA 4WK0A 2I0RA 3T3PA 5CXBA 1P22A 3J80g 2YNOA 4JHNA 4J0XA 5JWZA 2VDMA 1SHYB 4J0WA 1UOQA 3EQ9A 3PXTD 5I5JA 1JMZB 3SN6B 2J55H 2XL2A 3UKUC 2QXVA 3ZDXA 3IUNA 4FWWA 5GXHA 3AH8B 4ES0A 2OVPB 1I2MB 5AMSA 3K26A 3UVMA 2VZ1A 4CZXA 3MVDK 2PM9A 5M5SA 1PGUA 3EMHA 3OKTA 1YFQA 4MMZA 3UVLA 3BG1A 3JB9L 2XYIA 5FKRA 1OLZA 3JZGA 3O4GA 4G55A 5FXYA 3RMZD 1N6EA 5TDHB 4K3ID 4FAND 3K71A 4DNUA 2B5LA 4I79A 4GM3A 3IJ1A 4ESGA 3JROA 1VZ2A 3UVNA 3EU7A 2JKXA 2P9IC 2VZ3A 4JSXC 3OF7A 3GD1I 3O4HA 4O1QD 3L4MD 4BCDA 4NAAA 3IUJA 3BG0A 2H3XA 3EI4B
chains in the Genus database with same CATH topology
3MKSB 3OKYB 5SXMA 3EI2A 3I7LA 1GXRA 2I0SA 5HE1B 3I7KA 3EI4A 3OKYA 4XEIC 3CFVA 3FGBA 2AGXA 5H17A 4AEZA 2OJYA 4QT8A 3DM0A 3IIYA 1JJUB 3EI1B 4GM9A 5CYKA 5EAPA 2IWFA 2GNQA 4UI9R 2OIZA 3PSCB 3KRWB 4A7JA 1XHMA 5IT9g 1TBGA 4GQ2P 2P9PC 3NVNA 5EMLB 2B5MA 4X3EA 2PBIB 5GXIA 2Z2PA 4O9DA 3SWSD 3UR4A 2CN3A 4BH6A 5FKQA 4CY5A 3MZKA 1RI6A 1N6FA 1FWXA 3K27A 4E5ZA 1TYQC 5HQGA 1SQJA 2PM6B 3GREA 4FA5D 2PM7B 3RRMC 2AH1A 4L9OA 1K8KC 4U7AA 3PVUB 5HE2B 4ZOYA 1PEVA 2CE8A 5I5IA 1ERJA 2HKRA 4FHLA 4GQBB 1QNIA 3JZNA 3F3GA 2H6KA 2J56H 4A2MA 4QQEA 3MMYA 4CI1A 3N0EA 2CN2A 4X60B 2QC5A 4PC0A 2OVQB 4A08B 5HE0B 2AGLA 3UKRC 3AFCA 1NEXB 4A08A 1GOTB 4AOWA 4GGDA 2IWKA 3SHFA 4ERQA 2HJ4A 2AGYA 4H5JA 3I8CA 3I7PA 1SQ9A 4JXMA 2AH0A 3C9CA 1NR0A 4L1QD 4J79A 2PM9B 1OMWB 2XL3A 3I7OA 5K19A 2P9LC 1MG2A 4J82A 1JOFA 4MK0B 5FKSA 2YB8B 2YNNA 2HESX 4HDJA 4JT5C 5HE3B 1JMXB 4PNKB 5C9ZB 4J77A 4OWRA 2B5NA 3SLED 3OKWA 3PE7A 4L3GD 3I7HA 3P4FA 3ZWLB 1S4UX 3SVWD 3SJLD 4ZOXA 3SBQA 2I0TA 2H47A 4O45A 3EI2B 4U1EI 2UZXB 5KDOB 3ULEC 1Q47A 4IMMA 2CE9A 3IKOA 3JRPA 4A2LA 3VH0A 2OK6A 3MZLA 3MKQA 3SCYA 4CY3A 4GGCA 5EM2B 3IJCA 2H6QA 4JT6C 5CYKB 4EWRA 3CFSB 3OW8A 4JSPC 3JAMg 4CY2A 5EM2A 1B9XA 2HKMA 4FA1D 4FAVD 2TRCB 5EMKB 4GM8A 3A0FA 4IA9A 2BCJB 3L4OD 3FRXA 3NVQA 3UVKA 4E5ZB 3EI3B 3E0CA 5I5MA 2G9AA 4GZ8A 2AQ5A 2MTAH 4J8GA 5IC7A 3EI3A 4CC9A 4PXWA 2YBAA 4LGNA 4ZN4A 4D6VA 3CIKB 4ZOVA 3IJ0A 1XIPA 3RN0D 3OL2A 1MDAH 4TZ4A 5IGOA 4JSNC 2H13A 5H1MA 3RFHA 3GFCA 4JSVC 3I89A 4Y5RD 5B4WA 4A09A 2Z2OA 2XU7A 5C2WB 1A0RB 1L0QA 3VGZA 1U4CA 4A0AB 4CI3A 3B7FA 4N14A 4NSXA 5TEFA 4K3JB 4PBYA 1XKSA 2IUQA 2HJBA 2I3SA 4A0AA 1R5MA 3I7NA 2BBKH 1GP2B 2EBSA 3F3FA 4PSXB 3SXTD 2H9LA 4ZOZA 3JPXA 2IUVA 4JD2C 2H6NA 4J87A 3AL8B 2UZYB 2YMUA 3EWEA 4CI2A 2CO0A 4A0BA 1N6DA 3AL8A 4O3UB 3VA6A 4FA9D 4FA4D 3U4YA 5HYNB 1VYHC 1PBYB 4PSWB 1K32A 4CY1A 3C99A 5TEEA 2AGZA 3JZHA 2YNPA 5IGQA 5AJAA 4GQ1A 2H68A 5THAA 4GGAA 4D0KA 4J78A 3OTTA 1B9YA 2Z2NA 3PXWD 2OVRB 4J84A 3J81g 3PXSD 2B4EA 2P9KC 4LG9A 3RN1D 3EG6A 3I2NA 4G56B 2IAAA 4OZUA 2GC4A 4J81A 5EAMA 2AGWA 2IURA 4BUJC 3N0DA 4CZYA 5IJ8E 5A2Qg 4CI8A 4PBZA 1GG2B 4QL1A 3SMRA 2HXCA 5EMMB 4BL0A 1U2VC 2H9PA 1PI6A 2P9SC 3UVOA 3W15A 2G99A 4YVDA 4ERZA 5IJ7E 3SFZA 4KFMB 3IIWA 2CNXA 5GSAA 3DXKC 3ORVD 4E54B 4H5IA 3RSEC 2P9NC 5EARA 2H9MA 3SBPA 4J86A 2Q7QA 4E54A 4XYHA 2W18A 4QRJA 3F3PA 4LG8A 4A11B 3AL9A 3OL2B 4A11A 4FB1D 4O3TB 4GMBA 5GMKn 4A09B 4ERYA 3C75H 3EI1A 2I3TA 2GC7A 3NVXA 3I8EA 3RLMD 3V7DB 5FQDA 5CXCB 3KRXB 4J8BA 2CO0C 5H14A 2HYEA 3DSMA 1MG3A 2O9KA 3RFGA 3PVWB 4R7AB 5CXCA 4Y7RA 2H9NA 3ODTA 5EMJB 3V5WB 2H14A 4XYIA 3BWSA 5FA5B 3DXMC 2IUPA 4X63B 5FKTA 2P9UC 5C2VB 4A0BB 2OK4A 5AFU3 5EALA 4CZVA 5FLXg 4L3HD 2J57G 3HFQA 4Z8LA 4J73A 3DWLC 5TF2A 4X61B 3SBRA 3V9FA 5K1CC 3MXXA 3C5MA 5CXBB 3FM0A 3PSLA 2I0RA 5CXBA 1P22A 3J80g 2YNOA 4J0XA 5JWZA 1SHYB 4J0WA 5I5JA 3PXTD 1JMZB 3SN6B 2J55H 2XL2A 3UKUC 2QXVA 4FWWA 5GXHA 3AH8B 4ES0A 2OVPB 5AMSA 3K26A 3UVMA 4CZXA 2PM9A 1PGUA 3EMHA 3OKTA 1YFQA 3UVLA 3BG1A 3JB9L 2XYIA 5FKRA 1OLZA 3JZGA 5FXYA 3RMZD 1N6EA 5TDHB 4K3ID 4FAND 2B5LA 4I79A 4GM3A 3IJ1A 4ESGA 3JROA 3UVNA 3EU7A 2P9IC 4JSXC 4O1QD 3L4MD 3BG0A 2H3XA 3EI4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKS B;  3OKY B;  5SXM A;  3EI2 A;  3I7L A;  1GXR A;  2I0S A;  5HE1 B;  3I7K A;  3EI4 A;  3OKY A;  4XEI C;  3CFV A;  3FGB A;  2AGX A;  5H17 A;  4AEZ A;  2OJY A;  4QT8 A;  3DM0 A;  3IIY A;  1JJU B;  3EI1 B;  4GM9 A;  5CYK A;  5EAP A;  2IWF A;  2GNQ A;  4UI9 R;  2OIZ A;  3PSC B;  3KRW B;  4A7J A;  1XHM A;  5IT9 g;  1TBG A;  4GQ2 P;  2P9P C;  3NVN A;  5EML B;  2B5M A;  4X3E A;  2PBI B;  5GXI A;  2Z2P A;  4O9D A;  3SWS D;  3UR4 A;  2CN3 A;  4BH6 A;  5FKQ A;  4CY5 A;  3MZK A;  1RI6 A;  1N6F A;  1FWX A;  3K27 A;  4E5Z A;  1TYQ C;  5HQG A;  1SQJ A;  2PM6 B;  3GRE A;  4FA5 D;  2PM7 B;  3RRM C;  2AH1 A;  4L9O A;  1K8K C;  4U7A A;  3PVU B;  5HE2 B;  4ZOY A;  1PEV A;  2CE8 A;  5I5I A;  1ERJ A;  2HKR A;  4FHL A;  4GQB B;  1QNI A;  3JZN A;  3F3G A;  2H6K A;  2J56 H;  4A2M A;  4QQE A;  3MMY A;  4CI1 A;  3N0E A;  2CN2 A;  4X60 B;  2QC5 A;  4PC0 A;  2OVQ B;  4A08 B;  5HE0 B;  2AGL A;  3UKR C;  3AFC A;  1NEX B;  4A08 A;  1GOT B;  4AOW A;  4GGD A;  2IWK A;  3SHF A;  4ERQ A;  2HJ4 A;  2AGY A;  4H5J A;  3I8C A;  3I7P A;  1SQ9 A;  4JXM A;  2AH0 A;  3C9C A;  1NR0 A;  4L1Q D;  4J79 A;  2PM9 B;  1OMW B;  2XL3 A;  3I7O A;  5K19 A;  2P9L C;  1MG2 A;  4J82 A;  1JOF A;  4MK0 B;  5FKS A;  2YB8 B;  2YNN A;  2HES X;  4HDJ A;  4JT5 C;  5HE3 B;  1JMX B;  4PNK B;  5C9Z B;  4J77 A;  4OWR A;  2B5N A;  3SLE D;  3OKW A;  3PE7 A;  4L3G D;  3I7H A;  3P4F A;  3ZWL B;  1S4U X;  3SVW D;  3SJL D;  4ZOX A;  3SBQ A;  2I0T A;  2H47 A;  4O45 A;  3EI2 B;  4U1E I;  2UZX B;  5KDO B;  3ULE C;  1Q47 A;  4IMM A;  2CE9 A;  3IKO A;  3JRP A;  4A2L A;  3VH0 A;  2OK6 A;  3MZL A;  3MKQ A;  3SCY A;  4CY3 A;  4GGC A;  5EM2 B;  3IJC A;  2H6Q A;  4JT6 C;  5CYK B;  4EWR A;  3CFS B;  3OW8 A;  4JSP C;  3JAM g;  4CY2 A;  5EM2 A;  1B9X A;  2HKM A;  4FA1 D;  4FAV D;  2TRC B;  5EMK B;  4GM8 A;  3A0F A;  4IA9 A;  2BCJ B;  3L4O D;  3FRX A;  3NVQ A;  3UVK A;  4E5Z B;  3EI3 B;  3E0C A;  5I5M A;  2G9A A;  4GZ8 A;  2AQ5 A;  2MTA H;  4J8G A;  5IC7 A;  3EI3 A;  4CC9 A;  4PXW A;  2YBA A;  4LGN A;  4ZN4 A;  4D6V A;  3CIK B;  4ZOV A;  3IJ0 A;  1XIP A;  3RN0 D;  3OL2 A;  1MDA H;  4TZ4 A;  5IGO A;  4JSN C;  2H13 A;  5H1M A;  3RFH A;  3GFC A;  4JSV C;  3I89 A;  4Y5R D;  5B4W A;  4A09 A;  2Z2O A;  2XU7 A;  5C2W B;  1A0R B;  1L0Q A;  3VGZ A;  1U4C A;  4A0A B;  4CI3 A;  3B7F A;  4N14 A;  4NSX A;  5TEF A;  4K3J B;  4PBY A;  1XKS A;  2IUQ A;  2HJB A;  2I3S A;  4A0A A;  1R5M A;  3I7N A;  2BBK H;  1GP2 B;  2EBS A;  3F3F A;  4PSX B;  3SXT D;  2H9L A;  4ZOZ A;  3JPX A;  2IUV A;  4JD2 C;  2H6N A;  4J87 A;  3AL8 B;  2UZY B;  2YMU A;  3EWE A;  4CI2 A;  2CO0 A;  4A0B A;  1N6D A;  3AL8 A;  4O3U B;  3VA6 A;  4FA9 D;  4FA4 D;  3U4Y A;  5HYN B;  1VYH C;  1PBY B;  4PSW B;  1K32 A;  4CY1 A;  3C99 A;  5TEE A;  2AGZ A;  3JZH A;  2YNP A;  5IGQ A;  5AJA A;  4GQ1 A;  2H68 A;  5THA A;  4GGA A;  4D0K A;  4J78 A;  3OTT A;  1B9Y A;  2Z2N A;  3PXW D;  2OVR B;  4J84 A;  3J81 g;  3PXS D;  2B4E A;  2P9K C;  4LG9 A;  3RN1 D;  3EG6 A;  3I2N A;  4G56 B;  2IAA A;  4OZU A;  2GC4 A;  4J81 A;  5EAM A;  2AGW A;  2IUR A;  4BUJ C;  3N0D A;  4CZY A;  5IJ8 E;  5A2Q g;  4CI8 A;  4PBZ A;  1GG2 B;  4QL1 A;  3SMR A;  2HXC A;  5EMM B;  4BL0 A;  1U2V C;  2H9P A;  1PI6 A;  2P9S C;  3UVO A;  3W15 A;  2G99 A;  4YVD A;  4ERZ A;  5IJ7 E;  3SFZ A;  4KFM B;  3IIW A;  2CNX A;  5GSA A;  3DXK C;  3ORV D;  4E54 B;  4H5I A;  3RSE C;  2P9N C;  5EAR A;  2H9M A;  3SBP A;  4J86 A;  2Q7Q A;  4E54 A;  4XYH A;  2W18 A;  4QRJ A;  3F3P A;  4LG8 A;  4A11 B;  3AL9 A;  3OL2 B;  4A11 A;  4FB1 D;  4O3T B;  4GMB A;  5GMK n;  4A09 B;  4ERY A;  3C75 H;  3EI1 A;  2I3T A;  2GC7 A;  3NVX A;  3I8E A;  3RLM D;  3V7D B;  5FQD A;  5CXC B;  3KRX B;  4J8B A;  2CO0 C;  5H14 A;  2HYE A;  3DSM A;  1MG3 A;  2O9K A;  3RFG A;  3PVW B;  4R7A B;  5CXC A;  4Y7R A;  2H9N A;  3ODT A;  5EMJ B;  3V5W B;  2H14 A;  4XYI A;  3BWS A;  5FA5 B;  3DXM C;  2IUP A;  4X63 B;  5FKT A;  2P9U C;  5C2V B;  4A0B B;  2OK4 A;  5AFU 3;  5EAL A;  4CZV A;  5FLX g;  4L3H D;  2J57 G;  3HFQ A;  4Z8L A;  4J73 A;  3DWL C;  5TF2 A;  4X61 B;  3SBR A;  3V9F A;  5K1C C;  3MXX A;  3C5M A;  5CXB B;  3FM0 A;  3PSL A;  2I0R A;  5CXB A;  1P22 A;  3J80 g;  2YNO A;  4J0X A;  5JWZ A;  1SHY B;  4J0W A;  5I5J A;  3PXT D;  1JMZ B;  3SN6 B;  2J55 H;  2XL2 A;  3UKU C;  2QXV A;  4FWW A;  5GXH A;  3AH8 B;  4ES0 A;  2OVP B;  5AMS A;  3K26 A;  3UVM A;  4CZX A;  2PM9 A;  1PGU A;  3EMH A;  3OKT A;  1YFQ A;  3UVL A;  3BG1 A;  3JB9 L;  2XYI A;  5FKR A;  1OLZ A;  3JZG A;  5FXY A;  3RMZ D;  1N6E A;  5TDH B;  4K3I D;  4FAN D;  2B5L A;  4I79 A;  4GM3 A;  3IJ1 A;  4ESG A;  3JRO A;  3UVN A;  3EU7 A;  2P9I C;  4JSX C;  4O1Q D;  3L4M D;  3BG0 A;  2H3X A;  3EI4 B; 
#chains in the Genus database with same CATH topology
 4DNV A;  3MKS B;  1A12 A;  1VZ3 A;  1VE7 A;  3OKY B;  5SXM A;  3EI2 A;  3I7L A;  1GXR A;  2I0S A;  5HE1 B;  3I7K A;  3EI4 A;  3OKY A;  2WQ8 A;  4XEI C;  3CFV A;  3FGB A;  2AGX A;  5H17 A;  1H2Z A;  4AEZ A;  3ZE0 A;  2QZP A;  2OJY A;  4QT8 A;  3DM0 A;  3IIY A;  1JJU B;  3EI1 B;  3NIG A;  4GM9 A;  4NC4 A;  5CYK A;  5EAP A;  4Z7Q A;  2IWF A;  2GNQ A;  4UI9 R;  2OIZ A;  1E5T A;  3PSC B;  3KRW B;  4A7J A;  1XHM A;  5IT9 g;  1TBG A;  4GQ2 P;  2P9P C;  3NVN A;  5EML B;  2B5M A;  4X3E A;  3IUL A;  2PBI B;  5GXI A;  2Z2P A;  4O9D A;  3SWS D;  3UR4 A;  2CN3 A;  4NEN A;  5FKQ A;  4BH6 A;  3MZK A;  4CY5 A;  1GOG A;  1RI6 A;  1N6F A;  1FWX A;  3K27 A;  4E5Z A;  1TYQ C;  3NIF A;  5HQG A;  4L1M A;  1SQJ A;  2PM6 B;  4DNW A;  3GRE A;  4FA5 D;  2PM7 B;  3RRM C;  2AH1 A;  3FCS A;  4L9O A;  1K8K C;  4U7A A;  3PVU B;  4O02 A;  5HE2 B;  2EIB A;  4ZOY A;  3IJE A;  1PEV A;  1H2W A;  2CE8 A;  5I5I A;  1ERJ A;  3EQ8 A;  2HKR A;  4FHL A;  4GQB B;  1QNI A;  4NBM A;  3JZN A;  3F3G A;  3V4P A;  2H6K A;  2J56 H;  4A2M A;  4QQE A;  3IUR A;  3MMY A;  4CI1 A;  3N0E A;  2CN2 A;  2VDL A;  3O4J A;  4X60 B;  2QC5 A;  4PC0 A;  2OVQ B;  4A08 B;  5HE0 B;  2AGL A;  3UKR C;  4QAM A;  3AFC A;  1QFS A;  1NEX B;  4A08 A;  1GOT B;  4AOW A;  4GGD A;  2IWK A;  3SHF A;  4BP9 A;  2HJ4 A;  3IUM A;  4ERQ A;  2AGY A;  4H5J A;  3I8C A;  3I7P A;  3VI3 A;  1SQ9 A;  4JXM A;  2AH0 A;  3C9C A;  1NR0 A;  2EIE A;  4L1Q D;  4J79 A;  2PM9 B;  1OMW B;  4UM9 A;  2XL3 A;  3I7O A;  5K19 A;  2P9L C;  1MG2 A;  3QHY B;  4J82 A;  1JOF A;  5FFG A;  4MK0 B;  4MMX A;  5FKS A;  2YB8 B;  2YNN A;  2HES X;  5M5V A;  4HDJ A;  4JT5 C;  5HE3 B;  1JMX B;  4PNK B;  5C9Z B;  3KCI A;  4J77 A;  4OWR A;  2B5N A;  3MUO A;  3SLE D;  2QR5 A;  3OKW A;  3PE7 A;  1TYE A;  4L3G D;  3I7H A;  3P4F A;  4WK4 A;  3ZWL B;  1S4U X;  3SVW D;  3SJL D;  4ZOX A;  3SBQ A;  2I0T A;  5FFO A;  2H47 A;  4AN1 A;  4O45 A;  3EI2 B;  1U8C A;  4U1E I;  2UZX B;  5KDO B;  3ULE C;  4O2W A;  2VDQ A;  1Q47 A;  4IMM A;  2CE9 A;  3IKO A;  1O6G A;  3JRP A;  3O4I A;  4G1M A;  4JHP C;  4A2L A;  3VH0 A;  2OK6 A;  5C86 A;  3MZL A;  3MKQ A;  3SCY A;  4CY3 A;  4GGC A;  5EM2 B;  3IJC A;  1UTC A;  2H6Q A;  4JT6 C;  5CYK B;  3GC3 B;  4EWR A;  1VE6 A;  3CFS B;  3OW8 A;  4JSP C;  3JAM g;  3MUN A;  4CY2 A;  5EM2 A;  1B9X A;  3ZE2 A;  2HKM A;  4FA1 D;  4FAV D;  2TRC B;  5EMK B;  4GM8 A;  3A0F A;  4IA9 A;  2BCJ B;  2XE4 A;  4Z7N A;  4WK2 A;  1L5G A;  3L4O D;  3FRX A;  3NVQ A;  3UVK A;  3K72 A;  4E5Z B;  3EI3 B;  3E0C A;  5I5M A;  2G9A A;  4GZ8 A;  2AQ5 A;  2MTA H;  4J8G A;  5IC7 A;  3EI3 A;  2XDW A;  4CC9 A;  4PXW A;  1QFM A;  2YBA A;  4LGN A;  4ZN4 A;  4BP8 A;  4D6V A;  3CIK B;  1M1X A;  4ZOV A;  3FCU A;  3IJ0 A;  1XIP A;  3RN0 D;  3OL2 A;  4AN0 A;  1MDA H;  2VDO A;  4TZ4 A;  5IGO A;  4JSN C;  2H13 A;  5H1M A;  3RFH A;  1C9I A;  2VDR A;  3ZDZ A;  3GFC A;  4JSV C;  3I89 A;  4Y5R D;  5B4W A;  4A09 A;  2Z2O A;  1H2X A;  2XU7 A;  5C2W B;  1A0R B;  1L0Q A;  4UM8 A;  3VGZ A;  1U4C A;  4A0A B;  3VI4 A;  4CI3 A;  3B7F A;  4N14 A;  4NSX A;  5TEF A;  3V4V A;  4K3J B;  5HDB A;  4PBY A;  1XKS A;  2IUQ A;  2HJB A;  5C92 A;  5M5U A;  2I3S A;  4A0A A;  1R5M A;  3I7N A;  2BBK H;  2HU7 A;  1GP2 B;  2EBS A;  2HU8 A;  3F3F A;  4PSX B;  3SXT D;  5M5R A;  2H9L A;  2VDP A;  4ZOZ A;  3JPX A;  2IUV A;  4JD2 C;  2H6N A;  4J87 A;  3AL8 B;  2UZY B;  2YMU A;  3EWE A;  3IUQ A;  4CI2 A;  2CO0 A;  4A0B A;  1C9L A;  3EQ7 A;  1N6D A;  3AL8 A;  4O3U B;  3VA6 A;  2VDN A;  4FA9 D;  4FA4 D;  3U4Y A;  3ZDY A;  1JV2 A;  5HYN B;  1VYH C;  1PBY B;  4PSW B;  5M5T A;  3IVM A;  1K32 A;  4CY1 A;  3C99 A;  5TEE A;  2AGZ A;  3JZH A;  2YNP A;  5IGQ A;  5AJA A;  4GQ1 A;  2H68 A;  5THA A;  4GGA A;  4D0K A;  4J78 A;  3OTT A;  4G1E A;  1B9Y A;  1E8M A;  2Z2N A;  4BCB A;  3ZE1 A;  3PXW D;  1JTD B;  2OVR B;  4J84 A;  3J81 g;  3PXS D;  2B4E A;  2P9K C;  4LG9 A;  3RN1 D;  3EG6 A;  3I2N A;  4G56 B;  2IAA A;  4OZU A;  2GC4 A;  4J81 A;  5EAM A;  2BKL A;  5M61 A;  3K6S A;  1UOO A;  2AGW A;  2HU5 A;  2IUR A;  4BUJ C;  3N0D A;  4CZY A;  5IJ8 E;  3NID A;  4AX4 A;  5A2Q g;  1T2X A;  2XZG A;  4CI8 A;  4Z7O A;  4WJK A;  4PBZ A;  1GG2 B;  4QL1 A;  3SMR A;  2HXC A;  4RE5 A;  5EMM B;  4BL0 A;  1U2V C;  2H9P A;  1PI6 A;  2P9S C;  3UVO A;  3W15 A;  2G99 A;  4AMY A;  1E8N A;  4YVD A;  4ERZ A;  5IJ7 E;  3SFZ A;  1UOP A;  1H2Y A;  3IIW A;  2CNX A;  4KFM B;  4AMZ A;  5GSA A;  3DXK C;  3ORV D;  4E54 B;  2EID A;  4H5I A;  3RSE C;  2P9N C;  1BPO A;  5EAR A;  2H9M A;  3SBP A;  4J86 A;  2Q7Q A;  4E54 A;  4XYH A;  2W18 A;  3T3M A;  4QRJ A;  3F3P A;  4LG8 A;  5E6S A;  4A11 B;  1GOF A;  3AL9 A;  3OL2 B;  4A11 A;  4RE6 A;  4FB1 D;  4O3T B;  4GMB A;  5GMK n;  4A09 B;  4ERY A;  3C75 H;  3EI1 A;  2I3T A;  4MMY A;  2GC7 A;  3I8E A;  3NVX A;  3RLM D;  4D9S A;  3V7D B;  5FQD A;  5CXC B;  3KRX B;  4J8B A;  2CO0 C;  5E6R A;  5H14 A;  3DSM A;  2HYE A;  1MG3 A;  2O9K A;  3RFG A;  3PVW B;  4IRZ A;  4R7A B;  5CXC A;  4Y7R A;  1YR2 A;  2H9N A;  3ODT A;  3DDU A;  5EMJ B;  3V5W B;  2H14 A;  1GOH A;  4XYI A;  3BWS A;  5FA5 B;  3DXM C;  2IUP A;  1K3I A;  4X63 B;  5FKT A;  2P9U C;  5C2V B;  4A0B B;  2OK4 A;  5AFU 3;  2EIC A;  5EAL A;  4CZV A;  5FLX g;  4L3H D;  2VC2 A;  2J57 G;  3HFQ A;  4Z8L A;  4J73 A;  3DWL C;  5TF2 A;  5E6U A;  3QI0 A;  4X61 B;  3SBR A;  3V9F A;  5K1C C;  3MXX A;  3C5M A;  5CXB B;  4BCC A;  1O6F A;  2VDK A;  3FM0 A;  3PSL A;  4WK0 A;  2I0R A;  3T3P A;  5CXB A;  1P22 A;  3J80 g;  2YNO A;  4JHN A;  4J0X A;  5JWZ A;  2VDM A;  1SHY B;  4J0W A;  1UOQ A;  3EQ9 A;  3PXT D;  5I5J A;  1JMZ B;  3SN6 B;  2J55 H;  2XL2 A;  3UKU C;  2QXV A;  3ZDX A;  3IUN A;  4FWW A;  5GXH A;  3AH8 B;  4ES0 A;  2OVP B;  1I2M B;  5AMS A;  3K26 A;  3UVM A;  2VZ1 A;  4CZX A;  3MVD K;  2PM9 A;  5M5S A;  1PGU A;  3EMH A;  3OKT A;  1YFQ A;  4MMZ A;  3UVL A;  3BG1 A;  3JB9 L;  2XYI A;  5FKR A;  1OLZ A;  3JZG A;  3O4G A;  4G55 A;  5FXY A;  3RMZ D;  1N6E A;  5TDH B;  4K3I D;  4FAN D;  3K71 A;  4DNU A;  2B5L A;  4I79 A;  4GM3 A;  3IJ1 A;  4ESG A;  3JRO A;  1VZ2 A;  3UVN A;  3EU7 A;  2JKX A;  2P9I C;  2VZ3 A;  4JSX C;  3OF7 A;  3GD1 I;  3O4H A;  4O1Q D;  3L4M D;  4BCD A;  4NAA A;  3IUJ A;  3BG0 A;  2H3X A;  3EI4 B; 
#chains in the Genus database with same CATH homology
 3MKS B;  3OKY B;  5SXM A;  3EI2 A;  3I7L A;  1GXR A;  2I0S A;  5HE1 B;  3I7K A;  3EI4 A;  3OKY A;  4XEI C;  3CFV A;  3FGB A;  2AGX A;  5H17 A;  4AEZ A;  2OJY A;  4QT8 A;  3DM0 A;  3IIY A;  1JJU B;  3EI1 B;  4GM9 A;  5CYK A;  5EAP A;  2IWF A;  2GNQ A;  4UI9 R;  2OIZ A;  3PSC B;  3KRW B;  4A7J A;  1XHM A;  5IT9 g;  1TBG A;  4GQ2 P;  2P9P C;  3NVN A;  5EML B;  2B5M A;  4X3E A;  2PBI B;  5GXI A;  2Z2P A;  4O9D A;  3SWS D;  3UR4 A;  2CN3 A;  4BH6 A;  5FKQ A;  4CY5 A;  3MZK A;  1RI6 A;  1N6F A;  1FWX A;  3K27 A;  4E5Z A;  1TYQ C;  5HQG A;  1SQJ A;  2PM6 B;  3GRE A;  4FA5 D;  2PM7 B;  3RRM C;  2AH1 A;  4L9O A;  1K8K C;  4U7A A;  3PVU B;  5HE2 B;  4ZOY A;  1PEV A;  2CE8 A;  5I5I A;  1ERJ A;  2HKR A;  4FHL A;  4GQB B;  1QNI A;  3JZN A;  3F3G A;  2H6K A;  2J56 H;  4A2M A;  4QQE A;  3MMY A;  4CI1 A;  3N0E A;  2CN2 A;  4X60 B;  2QC5 A;  4PC0 A;  2OVQ B;  4A08 B;  5HE0 B;  2AGL A;  3UKR C;  3AFC A;  1NEX B;  4A08 A;  1GOT B;  4AOW A;  4GGD A;  2IWK A;  3SHF A;  4ERQ A;  2HJ4 A;  2AGY A;  4H5J A;  3I8C A;  3I7P A;  1SQ9 A;  4JXM A;  2AH0 A;  3C9C A;  1NR0 A;  4L1Q D;  4J79 A;  2PM9 B;  1OMW B;  2XL3 A;  3I7O A;  5K19 A;  2P9L C;  1MG2 A;  4J82 A;  1JOF A;  4MK0 B;  5FKS A;  2YB8 B;  2YNN A;  2HES X;  4HDJ A;  4JT5 C;  5HE3 B;  1JMX B;  4PNK B;  5C9Z B;  4J77 A;  4OWR A;  2B5N A;  3SLE D;  3OKW A;  3PE7 A;  4L3G D;  3I7H A;  3P4F A;  3ZWL B;  1S4U X;  3SVW D;  3SJL D;  4ZOX A;  3SBQ A;  2I0T A;  2H47 A;  4O45 A;  3EI2 B;  4U1E I;  2UZX B;  5KDO B;  3ULE C;  1Q47 A;  4IMM A;  2CE9 A;  3IKO A;  3JRP A;  4A2L A;  3VH0 A;  2OK6 A;  3MZL A;  3MKQ A;  3SCY A;  4CY3 A;  4GGC A;  5EM2 B;  3IJC A;  2H6Q A;  4JT6 C;  5CYK B;  4EWR A;  3CFS B;  3OW8 A;  4JSP C;  3JAM g;  4CY2 A;  5EM2 A;  1B9X A;  2HKM A;  4FA1 D;  4FAV D;  2TRC B;  5EMK B;  4GM8 A;  3A0F A;  4IA9 A;  2BCJ B;  3L4O D;  3FRX A;  3NVQ A;  3UVK A;  4E5Z B;  3EI3 B;  3E0C A;  5I5M A;  2G9A A;  4GZ8 A;  2AQ5 A;  2MTA H;  4J8G A;  5IC7 A;  3EI3 A;  4CC9 A;  4PXW A;  2YBA A;  4LGN A;  4ZN4 A;  4D6V A;  3CIK B;  4ZOV A;  3IJ0 A;  1XIP A;  3RN0 D;  3OL2 A;  1MDA H;  4TZ4 A;  5IGO A;  4JSN C;  2H13 A;  5H1M A;  3RFH A;  3GFC A;  4JSV C;  3I89 A;  4Y5R D;  5B4W A;  4A09 A;  2Z2O A;  2XU7 A;  5C2W B;  1A0R B;  1L0Q A;  3VGZ A;  1U4C A;  4A0A B;  4CI3 A;  3B7F A;  4N14 A;  4NSX A;  5TEF A;  4K3J B;  4PBY A;  1XKS A;  2IUQ A;  2HJB A;  2I3S A;  4A0A A;  1R5M A;  3I7N A;  2BBK H;  1GP2 B;  2EBS A;  3F3F A;  4PSX B;  3SXT D;  2H9L A;  4ZOZ A;  3JPX A;  2IUV A;  4JD2 C;  2H6N A;  4J87 A;  3AL8 B;  2UZY B;  2YMU A;  3EWE A;  4CI2 A;  2CO0 A;  4A0B A;  1N6D A;  3AL8 A;  4O3U B;  3VA6 A;  4FA9 D;  4FA4 D;  3U4Y A;  5HYN B;  1VYH C;  1PBY B;  4PSW B;  1K32 A;  4CY1 A;  3C99 A;  5TEE A;  2AGZ A;  3JZH A;  2YNP A;  5IGQ A;  5AJA A;  4GQ1 A;  2H68 A;  5THA A;  4GGA A;  4D0K A;  4J78 A;  3OTT A;  1B9Y A;  2Z2N A;  3PXW D;  2OVR B;  4J84 A;  3J81 g;  3PXS D;  2B4E A;  2P9K C;  4LG9 A;  3RN1 D;  3EG6 A;  3I2N A;  4G56 B;  2IAA A;  4OZU A;  2GC4 A;  4J81 A;  5EAM A;  2AGW A;  2IUR A;  4BUJ C;  3N0D A;  4CZY A;  5IJ8 E;  5A2Q g;  4CI8 A;  4PBZ A;  1GG2 B;  4QL1 A;  3SMR A;  2HXC A;  5EMM B;  4BL0 A;  1U2V C;  2H9P A;  1PI6 A;  2P9S C;  3UVO A;  3W15 A;  2G99 A;  4YVD A;  4ERZ A;  5IJ7 E;  3SFZ A;  4KFM B;  3IIW A;  2CNX A;  5GSA A;  3DXK C;  3ORV D;  4E54 B;  4H5I A;  3RSE C;  2P9N C;  5EAR A;  2H9M A;  3SBP A;  4J86 A;  2Q7Q A;  4E54 A;  4XYH A;  2W18 A;  4QRJ A;  3F3P A;  4LG8 A;  4A11 B;  3AL9 A;  3OL2 B;  4A11 A;  4FB1 D;  4O3T B;  4GMB A;  5GMK n;  4A09 B;  4ERY A;  3C75 H;  3EI1 A;  2I3T A;  2GC7 A;  3NVX A;  3I8E A;  3RLM D;  3V7D B;  5FQD A;  5CXC B;  3KRX B;  4J8B A;  2CO0 C;  5H14 A;  2HYE A;  3DSM A;  1MG3 A;  2O9K A;  3RFG A;  3PVW B;  4R7A B;  5CXC A;  4Y7R A;  2H9N A;  3ODT A;  5EMJ B;  3V5W B;  2H14 A;  4XYI A;  3BWS A;  5FA5 B;  3DXM C;  2IUP A;  4X63 B;  5FKT A;  2P9U C;  5C2V B;  4A0B B;  2OK4 A;  5AFU 3;  5EAL A;  4CZV A;  5FLX g;  4L3H D;  2J57 G;  3HFQ A;  4Z8L A;  4J73 A;  3DWL C;  5TF2 A;  4X61 B;  3SBR A;  3V9F A;  5K1C C;  3MXX A;  3C5M A;  5CXB B;  3FM0 A;  3PSL A;  2I0R A;  5CXB A;  1P22 A;  3J80 g;  2YNO A;  4J0X A;  5JWZ A;  1SHY B;  4J0W A;  5I5J A;  3PXT D;  1JMZ B;  3SN6 B;  2J55 H;  2XL2 A;  3UKU C;  2QXV A;  4FWW A;  5GXH A;  3AH8 B;  4ES0 A;  2OVP B;  5AMS A;  3K26 A;  3UVM A;  4CZX A;  2PM9 A;  1PGU A;  3EMH A;  3OKT A;  1YFQ A;  3UVL A;  3BG1 A;  3JB9 L;  2XYI A;  5FKR A;  1OLZ A;  3JZG A;  5FXY A;  3RMZ D;  1N6E A;  5TDH B;  4K3I D;  4FAN D;  2B5L A;  4I79 A;  4GM3 A;  3IJ1 A;  4ESG A;  3JRO A;  3UVN A;  3EU7 A;  2P9I C;  4JSX C;  4O1Q D;  3L4M D;  3BG0 A;  2H3X A;  3EI4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...