3N0EA

Crystal structure of wdr5 mutant (w330y)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
315
Chain Sequence
GGQQMGRGSEFVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLYKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
publication title The Effect of Asp-His-Ser/Thr-Trp Tetrad on the Thermostability of WD40-Repeat Proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3n0eA00
1N6DA 3AL9A 4ZN4A 4QQEA 4CC9A 3E0CA 5TDHB 3SN6B 4A7JA 2P9LC 1K8KC 3I2NA 4PSWB 4HDJA 1JMXB 4J73A 4UI9R 1GG2B 3DSMA 3MXXA 4J87A 4E5ZB 3ORVD 3CFVA 4J78A 4O1QD 4FAND 2H9PA 1YFQA 4O3TB 1MG2A 3JROA 2H6QA 4ESGA 4E5ZA 4QL1A 4TZ4A 2BBKH 5FKSA 4L1QD 2YB8B 4IA9A 4E54B 3FGBA 1N6FA 2AGLA 1VYHC 3C9CA 4GGCA 4A08B 4X3EA 5IGQA 4E54A 2AH0A 4D6VA 1XKSA 4ZOYA 3UVNA 4A08A 2IUVA 2OVQB 4H5JA 5IJ8E 3SCYA 2H13A 3VH0A 3CIKB 3PVUB 4PBZA 3I7HA 4GZ8A 4ZOVA 4JSNC 2PM9A 1JJUB 1SHYB 1QNIA 3KRXB 2AGXA 4N14A 2CNXA 3IIWA 5GSAA 5K1CC 5TEEA 3SLED 3AL8B 3MKSB 5CXBB 1P22A 3SBRA 2B4EA 3OL2A 2HYEA 1FWXA 4JT6C 3UKRC 3AL8A 4XEIC 5CXBA 4FAVD 4AEZA 3N0EA 4BUJC 3VA6A 1OMWB 2GC4A 5I5IA 5FKTA 3OKTA 2Z2PA 4LG8A 2BCJB 2YNNA 2GC7A 3DXKC 4MK0B 4U7AA 3UVLA 3N0DA 3PVWB 5FQDA 2MTAH 3EMHA 3MZLA 2CE8A 4GMBA 4J0WA 2J57G 3SXTD 2IUPA 2H14A 3OKYB 4CY5A 2IUQA 3SHFA 4JT5C 3PXWD 1OLZA 2AH1A 3IJ1A 3MMYA 1NEXB 4QRJA 4JSPC 5FKQA 3L4MD 4ERQA 3RN1D 5HYNB 3BWSA 5HQGA 4L9OA 3ODTA 3VGZA 2YMUA 3DXMC 5AMSA 1A0RB 2OK4A 2B5NA 2OIZA 3CFSB 5CXCB 1R5MA 2PM6B 4O45A 4FA1D 3EI1B 5HE3B 1JOFA 1Q47A 5CXCA 3UVMA 3EI3A 3OTTA 3V7DB 3PXSD 3EI1A 2I0RA 4PNKB 3EI2A 3HFQA 4L3HD 3FRXA 4OWRA 2YBAA 1MG3A 2HKMA 3JRPA 4IMMA 3SMRA 4A0AA 2XU7A 2XL3A 1MDAH 3RRMC 2GNQA 4CY1A 3GFCA 2IAAA 3EU7A 4GQBB 4L3GD 4O3UB 2PM9B 3OW8A 4JSXC 4J8BA 4LG9A 4XYIA 1U2VC 2HJ4A 2P9PC 3AH8B 2H9MA 5HE2B 3RFHA 3I8CA 4J86A 2G9AA 5THAA 2Z2OA 4A2LA 3NVXA 2H3XA 1ERJA 3IJCA 3F3FA 2HESX 5EMKB 5FA5B 3RLMD 3OL2B 2YNOA 2Z2NA 3RSEC 5AJAA 2P9IC 5FKRA 4NSXA 5CYKA 3SFZA 5EMJB 5FLXg 3RN0D 5GXHA 4ZOZA 4GM8A 3BG0A 3UKUC 3JZNA 3SVWD 2HKRA 5TF2A 4X60B 4LGNA 3BG1A 4FWWA 1RI6A 2IWKA 4CI3A 4CY2A 3EG6A 5A2Qg 3SBPA 5EM2A 3AFCA 4JD2C 3K27A 2P9SC 2CO0C 4J81A 2H9LA 2O9KA 5GMKn 2PM7B 1NR0A 3PSCB 3UVKA 4J77A 3DM0A 4Z8LA 2IURA 4X63B 4ZOXA 4FA4D 2I3SA 3RMZD 4CZVA 3UR4A 4GQ1A 4JSVC 2OK6A 3W15A 1GOTB 4J79A 4A0BB 4GGDA 5IJ7E 3I7KA 2CN2A 2J55H 2P9UC 4YVDA 4PBYA 4GM9A 3U4YA 4A0BA 1PEVA 5K19A 3EI3B 4GGAA 3F3PA 2UZXB 2B5LA 2OJYA 3IKOA 2YNPA 3EI4B 2H68A 1SQ9A 5HE0B 4A2MA 4O9DA 2CO0A 3EI2B 3JZGA 4KFMB 5C2WB 1PBYB 3RFGA 3EI4A 4H5IA 4A0AB 3I7PA 5TEFA 2CE9A 1S4UX 5EMMB 5IT9g 1SQJA 1PGUA 2XL2A 3C99A 1U4CA 2AQ5A 2QC5A 4FA5D 5H17A 5EARA 3I7LA 4X61B 5JWZA 2H9NA 2H47A 3J80g 4CI1A 3MKQA 3IJ0A 1TBGA 2CN3A 3PXTD 3C5MA 1N6EA 3SBQA 2OVPB 3SJLD 4XYHA 2I0TA 3I8EA 1B9YA 4FA9D 4CZXA 4R7AB 3KRWB 4CY3A 2I3TA 3IIYA 3NVQA 5GXIA 3B7FA 5EALA 1JMZB 4J0XA 1PI6A 4I79A 5I5JA 4EWRA 4ES0A 3JAMg 5FXYA 4CI8A 4Y5RD 1B9XA 5C2VB 3K26A 5IGOA 4FB1D 5CYKB 5EAPA 3A0FA 4A11B 1GP2B 4JXMA 2TRCB 5I5MA 4PXWA 4ERYA 1XIPA 4GQ2P 4A11A 5AFU3 2AGWA 2H6NA 4Y7RA 2AGZA 3ULEC 4PSXB 3I7NA 5SXMA 2J56H 5H14A 4PC0A 2I0SA 3SWSD 3V9FA 3V5WB 2XYIA 3DWLC 2HJBA 5EM2B 3ZWLB 2OVRB 2UZYB 2Q7QA 2G99A 1XHMA 4CI2A 2H6KA 4J8GA 4GM3A 2AGYA 3JZHA 4QT8A 1GXRA 5EMLB 2PBIB 1TYQC 3J81g 3UVOA 4U1EI 5IC7A 4K3JB 2IWFA 2P9NC 4J84A 2EBSA 3EWEA 3PSLA 3FM0A 3JB9L 5HE1B 3C75H 4J82A 3I7OA 1K32A 3GREA 2QXVA 3OKYA 4ERZA 2W18A 4A09B 4D0KA 1L0QA 4BL0A 5C9ZB 3L4OD 4OZUA 3MZKA 3OKWA 3F3GA 5EAMA 4A09A 3I89A 2B5MA 4G56B 4BH6A 5H1MA 3P4FA 4FHLA 4AOWA 3NVNA 2P9KC 5KDOB 2HXCA 3JPXA 3PE7A 5B4WA 4CZYA 4K3ID
chains in the Genus database with same CATH superfamily
1N6DA 3AL9A 1E8MA 4ZN4A 4QQEA 4CC9A 3E0CA 5TDHB 3SN6B 4A7JA 2P9LC 1K8KC 3I2NA 4PSWB 4HDJA 1JMXB 1H2ZA 3EQ9A 4J73A 4UI9R 1GG2B 3ZDZA 5E6UA 3DSMA 3O4JA 3MXXA 4J87A 4E5ZB 3ORVD 3CFVA 2WQ8A 4J78A 4O1QD 4FAND 2H9PA 1YFQA 3ZDXA 4O3TB 4UM9A 3IUMA 1MG2A 3JROA 2H6QA 4ESGA 4E5ZA 4QL1A 4TZ4A 2BBKH 5FKSA 4L1QD 2YB8B 5FFOA 4IA9A 4E54B 4L1MA 3FGBA 1N6FA 2AGLA 1VYHC 2QR5A 3C9CA 4O02A 4GGCA 4A08B 4X3EA 1GOFA 4WK4A 5IGQA 4E54A 3OF7A 2AH0A 4D6VA 1XKSA 4ZOYA 3UVNA 4A08A 2IUVA 2OVQB 4H5JA 5IJ8E 3SCYA 2H13A 3VH0A 3CIKB 5C92A 3PVUB 4PBZA 3I7HA 1QFMA 4GZ8A 3VI4A 4ZOVA 4JSNC 2PM9A 1JJUB 1SHYB 1QNIA 3KRXB 3EQ8A 2AGXA 4N14A 2CNXA 3IIWA 5GSAA 5K1CC 5TEEA 3SLED 4NBMA 3AL8B 3MKSB 5CXBB 1P22A 3SBRA 2B4EA 3OL2A 2HYEA 1FWXA 4JT6C 3UKRC 3AL8A 4XEIC 5CXBA 4FAVD 4AEZA 3N0EA 4RE5A 4BUJC 3GC3B 3VA6A 5M5VA 1O6FA 1OMWB 2GC4A 3IJEA 5I5IA 5FKTA 3OKTA 2Z2PA 1C9LA 4LG8A 2BCJB 2YNNA 2VZ3A 2GC7A 3DXKC 5E6SA 4MK0B 3IUJA 4U7AA 3UVLA 1QFSA 3N0DA 3ZE0A 3PVWB 5FQDA 2MTAH 3EMHA 4NC4A 3MZLA 2CE8A 4GMBA 4J0WA 2J57G 3SXTD 2IUPA 2H14A 5M5RA 3OKYB 4CY5A 2IUQA 3SHFA 4JT5C 3PXWD 1OLZA 2AH1A 4NENA 3IJ1A 3MMYA 1NEXB 4QRJA 2HU5A 4JSPC 5FKQA 3L4MD 4ERQA 3RN1D 5HYNB 2XZGA 3BWSA 4L9OA 5HQGA 3ODTA 3VGZA 1H2YA 2YMUA 1H2WA 3DXMC 5AMSA 1A0RB 2OK4A 2B5NA 2OIZA 3CFSB 1E5TA 5CXCB 1R5MA 2PM6B 4O45A 4FA1D 1A12A 3EI1B 5HE3B 1JOFA 1Q47A 5CXCA 3UVMA 3EI3A 3OTTA 3V7DB 3K6SA 1VE7A 3PXSD 3EI1A 2I0RA 4PNKB 4DNVA 3EI2A 3K71A 3HFQA 1UOQA 4L3HD 3ZE2A 3FRXA 4OWRA 2YBAA 1MG3A 2HKMA 3MUOA 3JRPA 4IMMA 4AMYA 3SMRA 4A0AA 3IULA 1TYEA 2XU7A 1H2XA 2XL3A 4BP9A 1MDAH 2XDWA 3RRMC 2GNQA 4CY1A 3GFCA 2IAAA 3EU7A 2VDOA 4GQBB 3MUNA 4L3GD 4AN0A 5E6RA 4DNUA 4O3UB 2PM9B 3OW8A 1VE6A 4JSXC 1C9IA 4J8BA 4LG9A 2EICA 3IUQA 4AN1A 4XYIA 4AMZA 1U2VC 2HJ4A 2P9PC 3AH8B 2H9MA 5HE2B 3RFHA 3I8CA 4BCCA 4J86A 2G9AA 5THAA 2Z2OA 4A2LA 3NIDA 3NVXA 2H3XA 1ERJA 3IJCA 3F3FA 2HESX 5EMKB 5FA5B 3NIGA 3RLMD 3OL2B 2YNOA 2Z2NA 4WK2A 3ZDYA 3RSEC 1U8CA 4UM8A 4JHPC 5AJAA 5C86A 2P9IC 2VDRA 2VZ1A 4Z7OA 5FKRA 2VDMA 1VZ2A 4NSXA 5CYKA 2XE4A 3SFZA 5M5SA 5EMJB 5M5UA 3RN0D 5FLXg 4DNWA 5GXHA 4ZOZA 4GM8A 3BG0A 3UKUC 3JZNA 3SVWD 2HKRA 4MMYA 5TF2A 4D9SA 5M61A 4X60B 3V4VA 2EIEA 4LGNA 3BG1A 4FWWA 1RI6A 3QI0A 2IWKA 4CI3A 4CY2A 3EG6A 5A2Qg 3SBPA 1UOOA 5EM2A 3AFCA 4JD2C 1JV2A 3K27A 2P9SC 2CO0C 4J81A 2H9LA 2O9KA 5GMKn 2PM7B 1NR0A 3PSCB 3UVKA 4J77A 3DM0A 4Z8LA 2IURA 4X63B 4ZOXA 4FA4D 4WJKA 2I3SA 3RMZD 4CZVA 3UR4A 4GQ1A 4JSVC 2OK6A 3W15A 1GOTB 4J79A 4A0BB 1L5GA 5FFGA 4G1EA 4GGDA 5IJ7E 3I7KA 2CN2A 2J55H 1JTDB 2P9UC 4YVDA 4PBYA 4GM9A 3U4YA 4A0BA 2EIDA 1PEVA 5K19A 3EI3B 4GGAA 4O2WA 3F3PA 2UZXB 5M5TA 2VDQA 2B5LA 1T2XA 3FCUA 2OJYA 3IKOA 2BKLA 3QHYB 2YNPA 3EI4B 2H68A 1SQ9A 5HE0B 4A2MA 4O9DA 2CO0A 3EI2B 3JZGA 4QAMA 4KFMB 5C2WB 1PBYB 3RFGA 3EI4A 4H5IA 4A0AB 3I7PA 5TEFA 2CE9A 3FCSA 3ZE1A 1S4UX 5EMMB 5IT9g 1SQJA 1PGUA 2XL2A 3C99A 1U4CA 2AQ5A 2QC5A 3IVMA 4FA5D 5H17A 5EARA 2QZPA 3I7LA 4X61B 5JWZA 3T3PA 2H9NA 2H47A 3VI3A 1K3IA 3J80g 4CI1A 3MKQA 3IJ0A 1TBGA 2CN3A 3PXTD 3C5MA 1N6EA 3O4GA 3SBQA 2OVPB 4Z7NA 3SJLD 4BCBA 4XYHA 2I0TA 3I8EA 1GOHA 1B9YA 4FA9D 4CZXA 3K72A 4R7AB 3KRWB 4CY3A 2I3TA 3IIYA 3NVQA 5GXIA 3B7FA 5EALA 3O4IA 1JMZB 3NIFA 1PI6A 4J0XA 4I79A 5I5JA 4EWRA 4BCDA 4IRZA 4ES0A 3JAMg 5FXYA 4CI8A 4Y5RD 1B9XA 5C2VB 3K26A 5IGOA 4FB1D 5CYKB 3GD1I 5EAPA 3A0FA 4A11B 1UOPA 1GP2B 2HU8A 4G55A 2TRCB 4JXMA 5I5MA 4PXWA 3V4PA 4ERYA 1XIPA 4GQ2P 4A11A 5AFU3 2AGWA 4AX4A 2H6NA 4Y7RA 2AGZA 2VC2A 3ULEC 4PSXB 3EQ7A 3IUNA 5HDBA 3I7NA 5SXMA 2J56H 5H14A 1VZ3A 1I2MB 4PC0A 2I0SA 3SWSD 1O6GA 3V9FA 3V5WB 2XYIA 3DWLC 2HJBA 3O4HA 5EM2B 3ZWLB 2OVRB 2UZYB 2Q7QA 2G99A 1XHMA 3DDUA 4CI2A 2H6KA 4J8GA 4GM3A 4MMXA 2AGYA 3JZHA 4QT8A 1GXRA 5EMLB 3T3MA 2PBIB 1TYQC 3J81g 3UVOA 4MMZA 4U1EI 5IC7A 3KCIA 3MVDK 4K3JB 2IWFA 1UTCA 2P9NC 4J84A 2EBSA 3EWEA 2EIBA 3PSLA 3FM0A 2VDNA 3IURA 3JB9L 5HE1B 4NAAA 3C75H 4J82A 2HU7A 3I7OA 1K32A 2VDPA 3GREA 2QXVA 4BP8A 2JKXA 3OKYA 1E8NA 4ERZA 2W18A 4JHNA 4A09B 4D0KA 1L0QA 4BL0A 5C9ZB 1BPOA 2VDKA 3L4OD 1YR2A 4OZUA 4Z7QA 2VDLA 3MZKA 3OKWA 1M1XA 3F3GA 5EAMA 4A09A 3I89A 2B5MA 4G56B 4BH6A 4G1MA 5H1MA 3P4FA 4FHLA 4AOWA 3NVNA 2P9KC 5KDOB 2HXCA 4WK0A 3JPXA 3PE7A 4RE6A 5B4WA 4CZYA 4K3ID 1GOGA
chains in the Genus database with same CATH topology
1N6DA 3AL9A 4ZN4A 4QQEA 4CC9A 3E0CA 5TDHB 3SN6B 4A7JA 2P9LC 1K8KC 3I2NA 4PSWB 4HDJA 1JMXB 4J73A 4UI9R 1GG2B 3DSMA 3MXXA 4J87A 4E5ZB 3ORVD 3CFVA 4J78A 4O1QD 4FAND 2H9PA 1YFQA 4O3TB 1MG2A 3JROA 2H6QA 4ESGA 4E5ZA 4QL1A 4TZ4A 2BBKH 5FKSA 4L1QD 2YB8B 4IA9A 4E54B 3FGBA 1N6FA 2AGLA 1VYHC 3C9CA 4GGCA 4A08B 4X3EA 5IGQA 4E54A 2AH0A 4D6VA 1XKSA 4ZOYA 3UVNA 4A08A 2IUVA 2OVQB 4H5JA 5IJ8E 3SCYA 2H13A 3VH0A 3CIKB 3PVUB 4PBZA 3I7HA 4GZ8A 4ZOVA 4JSNC 2PM9A 1JJUB 1SHYB 1QNIA 3KRXB 2AGXA 4N14A 2CNXA 3IIWA 5GSAA 5K1CC 5TEEA 3SLED 3AL8B 3MKSB 5CXBB 1P22A 3SBRA 2B4EA 3OL2A 2HYEA 1FWXA 4JT6C 3UKRC 3AL8A 4XEIC 5CXBA 4FAVD 4AEZA 3N0EA 4BUJC 3VA6A 1OMWB 2GC4A 5I5IA 5FKTA 3OKTA 2Z2PA 4LG8A 2BCJB 2YNNA 2GC7A 3DXKC 4MK0B 4U7AA 3UVLA 3N0DA 3PVWB 5FQDA 2MTAH 3EMHA 3MZLA 2CE8A 4GMBA 4J0WA 2J57G 3SXTD 2IUPA 2H14A 3OKYB 4CY5A 2IUQA 3SHFA 4JT5C 3PXWD 1OLZA 2AH1A 3IJ1A 3MMYA 1NEXB 4QRJA 4JSPC 5FKQA 3L4MD 4ERQA 3RN1D 5HYNB 3BWSA 5HQGA 4L9OA 3ODTA 3VGZA 2YMUA 3DXMC 5AMSA 1A0RB 2OK4A 2B5NA 2OIZA 3CFSB 5CXCB 1R5MA 2PM6B 4O45A 4FA1D 3EI1B 5HE3B 1JOFA 1Q47A 5CXCA 3UVMA 3EI3A 3OTTA 3V7DB 3PXSD 3EI1A 2I0RA 4PNKB 3EI2A 3HFQA 4L3HD 3FRXA 4OWRA 2YBAA 1MG3A 2HKMA 3JRPA 4IMMA 3SMRA 4A0AA 2XU7A 2XL3A 1MDAH 3RRMC 2GNQA 4CY1A 3GFCA 2IAAA 3EU7A 4GQBB 4L3GD 4O3UB 2PM9B 3OW8A 4JSXC 4J8BA 4LG9A 4XYIA 1U2VC 2HJ4A 2P9PC 3AH8B 2H9MA 5HE2B 3RFHA 3I8CA 4J86A 2G9AA 5THAA 2Z2OA 4A2LA 3NVXA 2H3XA 1ERJA 3IJCA 3F3FA 2HESX 5EMKB 5FA5B 3RLMD 3OL2B 2YNOA 2Z2NA 3RSEC 5AJAA 2P9IC 5FKRA 4NSXA 5CYKA 3SFZA 5EMJB 5FLXg 3RN0D 5GXHA 4ZOZA 4GM8A 3BG0A 3UKUC 3JZNA 3SVWD 2HKRA 5TF2A 4X60B 4LGNA 3BG1A 4FWWA 1RI6A 2IWKA 4CI3A 4CY2A 3EG6A 5A2Qg 3SBPA 5EM2A 3AFCA 4JD2C 3K27A 2P9SC 2CO0C 4J81A 2H9LA 2O9KA 5GMKn 2PM7B 1NR0A 3PSCB 3UVKA 4J77A 3DM0A 4Z8LA 2IURA 4X63B 4ZOXA 4FA4D 2I3SA 3RMZD 4CZVA 3UR4A 4GQ1A 4JSVC 2OK6A 3W15A 1GOTB 4J79A 4A0BB 4GGDA 5IJ7E 3I7KA 2CN2A 2J55H 2P9UC 4YVDA 4PBYA 4GM9A 3U4YA 4A0BA 1PEVA 5K19A 3EI3B 4GGAA 3F3PA 2UZXB 2B5LA 2OJYA 3IKOA 2YNPA 3EI4B 2H68A 1SQ9A 5HE0B 4A2MA 4O9DA 2CO0A 3EI2B 3JZGA 4KFMB 5C2WB 1PBYB 3RFGA 3EI4A 4H5IA 4A0AB 3I7PA 5TEFA 2CE9A 1S4UX 5EMMB 5IT9g 1SQJA 1PGUA 2XL2A 3C99A 1U4CA 2AQ5A 2QC5A 4FA5D 5H17A 5EARA 3I7LA 4X61B 5JWZA 2H9NA 2H47A 3J80g 4CI1A 3MKQA 3IJ0A 1TBGA 2CN3A 3PXTD 3C5MA 1N6EA 3SBQA 2OVPB 3SJLD 4XYHA 2I0TA 3I8EA 1B9YA 4FA9D 4CZXA 4R7AB 3KRWB 4CY3A 2I3TA 3IIYA 3NVQA 5GXIA 3B7FA 5EALA 1JMZB 4J0XA 1PI6A 4I79A 5I5JA 4EWRA 4ES0A 3JAMg 5FXYA 4CI8A 4Y5RD 1B9XA 5C2VB 3K26A 5IGOA 4FB1D 5CYKB 5EAPA 3A0FA 4A11B 1GP2B 4JXMA 2TRCB 5I5MA 4PXWA 4ERYA 1XIPA 4GQ2P 4A11A 5AFU3 2AGWA 2H6NA 4Y7RA 2AGZA 3ULEC 4PSXB 3I7NA 5SXMA 2J56H 5H14A 4PC0A 2I0SA 3SWSD 3V9FA 3V5WB 2XYIA 3DWLC 2HJBA 5EM2B 3ZWLB 2OVRB 2UZYB 2Q7QA 2G99A 1XHMA 4CI2A 2H6KA 4J8GA 4GM3A 2AGYA 3JZHA 4QT8A 1GXRA 5EMLB 2PBIB 1TYQC 3J81g 3UVOA 4U1EI 5IC7A 4K3JB 2IWFA 2P9NC 4J84A 2EBSA 3EWEA 3PSLA 3FM0A 3JB9L 5HE1B 3C75H 4J82A 3I7OA 1K32A 3GREA 2QXVA 3OKYA 4ERZA 2W18A 4A09B 4D0KA 1L0QA 4BL0A 5C9ZB 3L4OD 4OZUA 3MZKA 3OKWA 3F3GA 5EAMA 4A09A 3I89A 2B5MA 4G56B 4BH6A 5H1MA 3P4FA 4FHLA 4AOWA 3NVNA 2P9KC 5KDOB 2HXCA 3JPXA 3PE7A 5B4WA 4CZYA 4K3ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6D A;  3AL9 A;  4ZN4 A;  4QQE A;  4CC9 A;  3E0C A;  5TDH B;  3SN6 B;  4A7J A;  2P9L C;  1K8K C;  3I2N A;  4PSW B;  4HDJ A;  1JMX B;  4J73 A;  4UI9 R;  1GG2 B;  3DSM A;  3MXX A;  4J87 A;  4E5Z B;  3ORV D;  3CFV A;  4J78 A;  4O1Q D;  4FAN D;  2H9P A;  1YFQ A;  4O3T B;  1MG2 A;  3JRO A;  2H6Q A;  4ESG A;  4E5Z A;  4QL1 A;  4TZ4 A;  2BBK H;  5FKS A;  4L1Q D;  2YB8 B;  4IA9 A;  4E54 B;  3FGB A;  1N6F A;  2AGL A;  1VYH C;  3C9C A;  4GGC A;  4A08 B;  4X3E A;  5IGQ A;  4E54 A;  2AH0 A;  4D6V A;  1XKS A;  4ZOY A;  3UVN A;  4A08 A;  2IUV A;  2OVQ B;  4H5J A;  5IJ8 E;  3SCY A;  2H13 A;  3VH0 A;  3CIK B;  3PVU B;  4PBZ A;  3I7H A;  4GZ8 A;  4ZOV A;  4JSN C;  2PM9 A;  1JJU B;  1SHY B;  1QNI A;  3KRX B;  2AGX A;  4N14 A;  2CNX A;  3IIW A;  5GSA A;  5K1C C;  5TEE A;  3SLE D;  3AL8 B;  3MKS B;  5CXB B;  1P22 A;  3SBR A;  2B4E A;  3OL2 A;  2HYE A;  1FWX A;  4JT6 C;  3UKR C;  3AL8 A;  4XEI C;  5CXB A;  4FAV D;  4AEZ A;  3N0E A;  4BUJ C;  3VA6 A;  1OMW B;  2GC4 A;  5I5I A;  5FKT A;  3OKT A;  2Z2P A;  4LG8 A;  2BCJ B;  2YNN A;  2GC7 A;  3DXK C;  4MK0 B;  4U7A A;  3UVL A;  3N0D A;  3PVW B;  5FQD A;  2MTA H;  3EMH A;  3MZL A;  2CE8 A;  4GMB A;  4J0W A;  2J57 G;  3SXT D;  2IUP A;  2H14 A;  3OKY B;  4CY5 A;  2IUQ A;  3SHF A;  4JT5 C;  3PXW D;  1OLZ A;  2AH1 A;  3IJ1 A;  3MMY A;  1NEX B;  4QRJ A;  4JSP C;  5FKQ A;  3L4M D;  4ERQ A;  3RN1 D;  5HYN B;  3BWS A;  5HQG A;  4L9O A;  3ODT A;  3VGZ A;  2YMU A;  3DXM C;  5AMS A;  1A0R B;  2OK4 A;  2B5N A;  2OIZ A;  3CFS B;  5CXC B;  1R5M A;  2PM6 B;  4O45 A;  4FA1 D;  3EI1 B;  5HE3 B;  1JOF A;  1Q47 A;  5CXC A;  3UVM A;  3EI3 A;  3OTT A;  3V7D B;  3PXS D;  3EI1 A;  2I0R A;  4PNK B;  3EI2 A;  3HFQ A;  4L3H D;  3FRX A;  4OWR A;  2YBA A;  1MG3 A;  2HKM A;  3JRP A;  4IMM A;  3SMR A;  4A0A A;  2XU7 A;  2XL3 A;  1MDA H;  3RRM C;  2GNQ A;  4CY1 A;  3GFC A;  2IAA A;  3EU7 A;  4GQB B;  4L3G D;  4O3U B;  2PM9 B;  3OW8 A;  4JSX C;  4J8B A;  4LG9 A;  4XYI A;  1U2V C;  2HJ4 A;  2P9P C;  3AH8 B;  2H9M A;  5HE2 B;  3RFH A;  3I8C A;  4J86 A;  2G9A A;  5THA A;  2Z2O A;  4A2L A;  3NVX A;  2H3X A;  1ERJ A;  3IJC A;  3F3F A;  2HES X;  5EMK B;  5FA5 B;  3RLM D;  3OL2 B;  2YNO A;  2Z2N A;  3RSE C;  5AJA A;  2P9I C;  5FKR A;  4NSX A;  5CYK A;  3SFZ A;  5EMJ B;  5FLX g;  3RN0 D;  5GXH A;  4ZOZ A;  4GM8 A;  3BG0 A;  3UKU C;  3JZN A;  3SVW D;  2HKR A;  5TF2 A;  4X60 B;  4LGN A;  3BG1 A;  4FWW A;  1RI6 A;  2IWK A;  4CI3 A;  4CY2 A;  3EG6 A;  5A2Q g;  3SBP A;  5EM2 A;  3AFC A;  4JD2 C;  3K27 A;  2P9S C;  2CO0 C;  4J81 A;  2H9L A;  2O9K A;  5GMK n;  2PM7 B;  1NR0 A;  3PSC B;  3UVK A;  4J77 A;  3DM0 A;  4Z8L A;  2IUR A;  4X63 B;  4ZOX A;  4FA4 D;  2I3S A;  3RMZ D;  4CZV A;  3UR4 A;  4GQ1 A;  4JSV C;  2OK6 A;  3W15 A;  1GOT B;  4J79 A;  4A0B B;  4GGD A;  5IJ7 E;  3I7K A;  2CN2 A;  2J55 H;  2P9U C;  4YVD A;  4PBY A;  4GM9 A;  3U4Y A;  4A0B A;  1PEV A;  5K19 A;  3EI3 B;  4GGA A;  3F3P A;  2UZX B;  2B5L A;  2OJY A;  3IKO A;  2YNP A;  3EI4 B;  2H68 A;  1SQ9 A;  5HE0 B;  4A2M A;  4O9D A;  2CO0 A;  3EI2 B;  3JZG A;  4KFM B;  5C2W B;  1PBY B;  3RFG A;  3EI4 A;  4H5I A;  4A0A B;  3I7P A;  5TEF A;  2CE9 A;  1S4U X;  5EMM B;  5IT9 g;  1SQJ A;  1PGU A;  2XL2 A;  3C99 A;  1U4C A;  2AQ5 A;  2QC5 A;  4FA5 D;  5H17 A;  5EAR A;  3I7L A;  4X61 B;  5JWZ A;  2H9N A;  2H47 A;  3J80 g;  4CI1 A;  3MKQ A;  3IJ0 A;  1TBG A;  2CN3 A;  3PXT D;  3C5M A;  1N6E A;  3SBQ A;  2OVP B;  3SJL D;  4XYH A;  2I0T A;  3I8E A;  1B9Y A;  4FA9 D;  4CZX A;  4R7A B;  3KRW B;  4CY3 A;  2I3T A;  3IIY A;  3NVQ A;  5GXI A;  3B7F A;  5EAL A;  1JMZ B;  4J0X A;  1PI6 A;  4I79 A;  5I5J A;  4EWR A;  4ES0 A;  3JAM g;  5FXY A;  4CI8 A;  4Y5R D;  1B9X A;  5C2V B;  3K26 A;  5IGO A;  4FB1 D;  5CYK B;  5EAP A;  3A0F A;  4A11 B;  1GP2 B;  4JXM A;  2TRC B;  5I5M A;  4PXW A;  4ERY A;  1XIP A;  4GQ2 P;  4A11 A;  5AFU 3;  2AGW A;  2H6N A;  4Y7R A;  2AGZ A;  3ULE C;  4PSX B;  3I7N A;  5SXM A;  2J56 H;  5H14 A;  4PC0 A;  2I0S A;  3SWS D;  3V9F A;  3V5W B;  2XYI A;  3DWL C;  2HJB A;  5EM2 B;  3ZWL B;  2OVR B;  2UZY B;  2Q7Q A;  2G99 A;  1XHM A;  4CI2 A;  2H6K A;  4J8G A;  4GM3 A;  2AGY A;  3JZH A;  4QT8 A;  1GXR A;  5EML B;  2PBI B;  1TYQ C;  3J81 g;  3UVO A;  4U1E I;  5IC7 A;  4K3J B;  2IWF A;  2P9N C;  4J84 A;  2EBS A;  3EWE A;  3PSL A;  3FM0 A;  3JB9 L;  5HE1 B;  3C75 H;  4J82 A;  3I7O A;  1K32 A;  3GRE A;  2QXV A;  3OKY A;  4ERZ A;  2W18 A;  4A09 B;  4D0K A;  1L0Q A;  4BL0 A;  5C9Z B;  3L4O D;  4OZU A;  3MZK A;  3OKW A;  3F3G A;  5EAM A;  4A09 A;  3I89 A;  2B5M A;  4G56 B;  4BH6 A;  5H1M A;  3P4F A;  4FHL A;  4AOW A;  3NVN A;  2P9K C;  5KDO B;  2HXC A;  3JPX A;  3PE7 A;  5B4W A;  4CZY A;  4K3I D; 
#chains in the Genus database with same CATH topology
 1N6D A;  3AL9 A;  1E8M A;  4ZN4 A;  4QQE A;  4CC9 A;  3E0C A;  5TDH B;  3SN6 B;  4A7J A;  2P9L C;  1K8K C;  3I2N A;  4PSW B;  4HDJ A;  1JMX B;  1H2Z A;  3EQ9 A;  4J73 A;  4UI9 R;  1GG2 B;  3ZDZ A;  5E6U A;  3DSM A;  3O4J A;  3MXX A;  4J87 A;  4E5Z B;  3ORV D;  3CFV A;  2WQ8 A;  4J78 A;  4O1Q D;  4FAN D;  2H9P A;  1YFQ A;  3ZDX A;  4O3T B;  4UM9 A;  3IUM A;  1MG2 A;  3JRO A;  2H6Q A;  4ESG A;  4E5Z A;  4QL1 A;  4TZ4 A;  2BBK H;  5FKS A;  4L1Q D;  2YB8 B;  5FFO A;  4IA9 A;  4E54 B;  4L1M A;  3FGB A;  1N6F A;  2AGL A;  1VYH C;  2QR5 A;  3C9C A;  4O02 A;  4GGC A;  4A08 B;  4X3E A;  1GOF A;  4WK4 A;  5IGQ A;  4E54 A;  3OF7 A;  2AH0 A;  4D6V A;  1XKS A;  4ZOY A;  3UVN A;  4A08 A;  2IUV A;  2OVQ B;  4H5J A;  5IJ8 E;  3SCY A;  2H13 A;  3VH0 A;  3CIK B;  5C92 A;  3PVU B;  4PBZ A;  3I7H A;  1QFM A;  4GZ8 A;  3VI4 A;  4ZOV A;  4JSN C;  2PM9 A;  1JJU B;  1SHY B;  1QNI A;  3KRX B;  3EQ8 A;  2AGX A;  4N14 A;  2CNX A;  3IIW A;  5GSA A;  5K1C C;  5TEE A;  3SLE D;  4NBM A;  3AL8 B;  3MKS B;  5CXB B;  1P22 A;  3SBR A;  2B4E A;  3OL2 A;  2HYE A;  1FWX A;  4JT6 C;  3UKR C;  3AL8 A;  4XEI C;  5CXB A;  4FAV D;  4AEZ A;  3N0E A;  4RE5 A;  4BUJ C;  3GC3 B;  3VA6 A;  5M5V A;  1O6F A;  1OMW B;  2GC4 A;  3IJE A;  5I5I A;  5FKT A;  3OKT A;  2Z2P A;  1C9L A;  4LG8 A;  2BCJ B;  2YNN A;  2VZ3 A;  2GC7 A;  3DXK C;  5E6S A;  4MK0 B;  3IUJ A;  4U7A A;  3UVL A;  1QFS A;  3N0D A;  3ZE0 A;  3PVW B;  5FQD A;  2MTA H;  3EMH A;  4NC4 A;  3MZL A;  2CE8 A;  4GMB A;  4J0W A;  2J57 G;  3SXT D;  2IUP A;  2H14 A;  5M5R A;  3OKY B;  4CY5 A;  2IUQ A;  3SHF A;  4JT5 C;  3PXW D;  1OLZ A;  2AH1 A;  4NEN A;  3IJ1 A;  3MMY A;  1NEX B;  4QRJ A;  2HU5 A;  4JSP C;  5FKQ A;  3L4M D;  4ERQ A;  3RN1 D;  5HYN B;  2XZG A;  3BWS A;  4L9O A;  5HQG A;  3ODT A;  3VGZ A;  1H2Y A;  2YMU A;  1H2W A;  3DXM C;  5AMS A;  1A0R B;  2OK4 A;  2B5N A;  2OIZ A;  3CFS B;  1E5T A;  5CXC B;  1R5M A;  2PM6 B;  4O45 A;  4FA1 D;  1A12 A;  3EI1 B;  5HE3 B;  1JOF A;  1Q47 A;  5CXC A;  3UVM A;  3EI3 A;  3OTT A;  3V7D B;  3K6S A;  1VE7 A;  3PXS D;  3EI1 A;  2I0R A;  4PNK B;  4DNV A;  3EI2 A;  3K71 A;  3HFQ A;  1UOQ A;  4L3H D;  3ZE2 A;  3FRX A;  4OWR A;  2YBA A;  1MG3 A;  2HKM A;  3MUO A;  3JRP A;  4IMM A;  4AMY A;  3SMR A;  4A0A A;  3IUL A;  1TYE A;  2XU7 A;  1H2X A;  2XL3 A;  4BP9 A;  1MDA H;  2XDW A;  3RRM C;  2GNQ A;  4CY1 A;  3GFC A;  2IAA A;  3EU7 A;  2VDO A;  4GQB B;  3MUN A;  4L3G D;  4AN0 A;  5E6R A;  4DNU A;  4O3U B;  2PM9 B;  3OW8 A;  1VE6 A;  4JSX C;  1C9I A;  4J8B A;  4LG9 A;  2EIC A;  3IUQ A;  4AN1 A;  4XYI A;  4AMZ A;  1U2V C;  2HJ4 A;  2P9P C;  3AH8 B;  2H9M A;  5HE2 B;  3RFH A;  3I8C A;  4BCC A;  4J86 A;  2G9A A;  5THA A;  2Z2O A;  4A2L A;  3NID A;  3NVX A;  2H3X A;  1ERJ A;  3IJC A;  3F3F A;  2HES X;  5EMK B;  5FA5 B;  3NIG A;  3RLM D;  3OL2 B;  2YNO A;  2Z2N A;  4WK2 A;  3ZDY A;  3RSE C;  1U8C A;  4UM8 A;  4JHP C;  5AJA A;  5C86 A;  2P9I C;  2VDR A;  2VZ1 A;  4Z7O A;  5FKR A;  2VDM A;  1VZ2 A;  4NSX A;  5CYK A;  2XE4 A;  3SFZ A;  5M5S A;  5EMJ B;  5M5U A;  3RN0 D;  5FLX g;  4DNW A;  5GXH A;  4ZOZ A;  4GM8 A;  3BG0 A;  3UKU C;  3JZN A;  3SVW D;  2HKR A;  4MMY A;  5TF2 A;  4D9S A;  5M61 A;  4X60 B;  3V4V A;  2EIE A;  4LGN A;  3BG1 A;  4FWW A;  1RI6 A;  3QI0 A;  2IWK A;  4CI3 A;  4CY2 A;  3EG6 A;  5A2Q g;  3SBP A;  1UOO A;  5EM2 A;  3AFC A;  4JD2 C;  1JV2 A;  3K27 A;  2P9S C;  2CO0 C;  4J81 A;  2H9L A;  2O9K A;  5GMK n;  2PM7 B;  1NR0 A;  3PSC B;  3UVK A;  4J77 A;  3DM0 A;  4Z8L A;  2IUR A;  4X63 B;  4ZOX A;  4FA4 D;  4WJK A;  2I3S A;  3RMZ D;  4CZV A;  3UR4 A;  4GQ1 A;  4JSV C;  2OK6 A;  3W15 A;  1GOT B;  4J79 A;  4A0B B;  1L5G A;  5FFG A;  4G1E A;  4GGD A;  5IJ7 E;  3I7K A;  2CN2 A;  2J55 H;  1JTD B;  2P9U C;  4YVD A;  4PBY A;  4GM9 A;  3U4Y A;  4A0B A;  2EID A;  1PEV A;  5K19 A;  3EI3 B;  4GGA A;  4O2W A;  3F3P A;  2UZX B;  5M5T A;  2VDQ A;  2B5L A;  1T2X A;  3FCU A;  2OJY A;  3IKO A;  2BKL A;  3QHY B;  2YNP A;  3EI4 B;  2H68 A;  1SQ9 A;  5HE0 B;  4A2M A;  4O9D A;  2CO0 A;  3EI2 B;  3JZG A;  4QAM A;  4KFM B;  5C2W B;  1PBY B;  3RFG A;  3EI4 A;  4H5I A;  4A0A B;  3I7P A;  5TEF A;  2CE9 A;  3FCS A;  3ZE1 A;  1S4U X;  5EMM B;  5IT9 g;  1SQJ A;  1PGU A;  2XL2 A;  3C99 A;  1U4C A;  2AQ5 A;  2QC5 A;  3IVM A;  4FA5 D;  5H17 A;  5EAR A;  2QZP A;  3I7L A;  4X61 B;  5JWZ A;  3T3P A;  2H9N A;  2H47 A;  3VI3 A;  1K3I A;  3J80 g;  4CI1 A;  3MKQ A;  3IJ0 A;  1TBG A;  2CN3 A;  3PXT D;  3C5M A;  1N6E A;  3O4G A;  3SBQ A;  2OVP B;  4Z7N A;  3SJL D;  4BCB A;  4XYH A;  2I0T A;  3I8E A;  1GOH A;  1B9Y A;  4FA9 D;  4CZX A;  3K72 A;  4R7A B;  3KRW B;  4CY3 A;  2I3T A;  3IIY A;  3NVQ A;  5GXI A;  3B7F A;  5EAL A;  3O4I A;  1JMZ B;  3NIF A;  1PI6 A;  4J0X A;  4I79 A;  5I5J A;  4EWR A;  4BCD A;  4IRZ A;  4ES0 A;  3JAM g;  5FXY A;  4CI8 A;  4Y5R D;  1B9X A;  5C2V B;  3K26 A;  5IGO A;  4FB1 D;  5CYK B;  3GD1 I;  5EAP A;  3A0F A;  4A11 B;  1UOP A;  1GP2 B;  2HU8 A;  4G55 A;  2TRC B;  4JXM A;  5I5M A;  4PXW A;  3V4P A;  4ERY A;  1XIP A;  4GQ2 P;  4A11 A;  5AFU 3;  2AGW A;  4AX4 A;  2H6N A;  4Y7R A;  2AGZ A;  2VC2 A;  3ULE C;  4PSX B;  3EQ7 A;  3IUN A;  5HDB A;  3I7N A;  5SXM A;  2J56 H;  5H14 A;  1VZ3 A;  1I2M B;  4PC0 A;  2I0S A;  3SWS D;  1O6G A;  3V9F A;  3V5W B;  2XYI A;  3DWL C;  2HJB A;  3O4H A;  5EM2 B;  3ZWL B;  2OVR B;  2UZY B;  2Q7Q A;  2G99 A;  1XHM A;  3DDU A;  4CI2 A;  2H6K A;  4J8G A;  4GM3 A;  4MMX A;  2AGY A;  3JZH A;  4QT8 A;  1GXR A;  5EML B;  3T3M A;  2PBI B;  1TYQ C;  3J81 g;  3UVO A;  4MMZ A;  4U1E I;  5IC7 A;  3KCI A;  3MVD K;  4K3J B;  2IWF A;  1UTC A;  2P9N C;  4J84 A;  2EBS A;  3EWE A;  2EIB A;  3PSL A;  3FM0 A;  2VDN A;  3IUR A;  3JB9 L;  5HE1 B;  4NAA A;  3C75 H;  4J82 A;  2HU7 A;  3I7O A;  1K32 A;  2VDP A;  3GRE A;  2QXV A;  4BP8 A;  2JKX A;  3OKY A;  1E8N A;  4ERZ A;  2W18 A;  4JHN A;  4A09 B;  4D0K A;  1L0Q A;  4BL0 A;  5C9Z B;  1BPO A;  2VDK A;  3L4O D;  1YR2 A;  4OZU A;  4Z7Q A;  2VDL A;  3MZK A;  3OKW A;  1M1X A;  3F3G A;  5EAM A;  4A09 A;  3I89 A;  2B5M A;  4G56 B;  4BH6 A;  4G1M A;  5H1M A;  3P4F A;  4FHL A;  4AOW A;  3NVN A;  2P9K C;  5KDO B;  2HXC A;  4WK0 A;  3JPX A;  3PE7 A;  4RE6 A;  5B4W A;  4CZY A;  4K3I D;  1GOG A; 
#chains in the Genus database with same CATH homology
 1N6D A;  3AL9 A;  4ZN4 A;  4QQE A;  4CC9 A;  3E0C A;  5TDH B;  3SN6 B;  4A7J A;  2P9L C;  1K8K C;  3I2N A;  4PSW B;  4HDJ A;  1JMX B;  4J73 A;  4UI9 R;  1GG2 B;  3DSM A;  3MXX A;  4J87 A;  4E5Z B;  3ORV D;  3CFV A;  4J78 A;  4O1Q D;  4FAN D;  2H9P A;  1YFQ A;  4O3T B;  1MG2 A;  3JRO A;  2H6Q A;  4ESG A;  4E5Z A;  4QL1 A;  4TZ4 A;  2BBK H;  5FKS A;  4L1Q D;  2YB8 B;  4IA9 A;  4E54 B;  3FGB A;  1N6F A;  2AGL A;  1VYH C;  3C9C A;  4GGC A;  4A08 B;  4X3E A;  5IGQ A;  4E54 A;  2AH0 A;  4D6V A;  1XKS A;  4ZOY A;  3UVN A;  4A08 A;  2IUV A;  2OVQ B;  4H5J A;  5IJ8 E;  3SCY A;  2H13 A;  3VH0 A;  3CIK B;  3PVU B;  4PBZ A;  3I7H A;  4GZ8 A;  4ZOV A;  4JSN C;  2PM9 A;  1JJU B;  1SHY B;  1QNI A;  3KRX B;  2AGX A;  4N14 A;  2CNX A;  3IIW A;  5GSA A;  5K1C C;  5TEE A;  3SLE D;  3AL8 B;  3MKS B;  5CXB B;  1P22 A;  3SBR A;  2B4E A;  3OL2 A;  2HYE A;  1FWX A;  4JT6 C;  3UKR C;  3AL8 A;  4XEI C;  5CXB A;  4FAV D;  4AEZ A;  3N0E A;  4BUJ C;  3VA6 A;  1OMW B;  2GC4 A;  5I5I A;  5FKT A;  3OKT A;  2Z2P A;  4LG8 A;  2BCJ B;  2YNN A;  2GC7 A;  3DXK C;  4MK0 B;  4U7A A;  3UVL A;  3N0D A;  3PVW B;  5FQD A;  2MTA H;  3EMH A;  3MZL A;  2CE8 A;  4GMB A;  4J0W A;  2J57 G;  3SXT D;  2IUP A;  2H14 A;  3OKY B;  4CY5 A;  2IUQ A;  3SHF A;  4JT5 C;  3PXW D;  1OLZ A;  2AH1 A;  3IJ1 A;  3MMY A;  1NEX B;  4QRJ A;  4JSP C;  5FKQ A;  3L4M D;  4ERQ A;  3RN1 D;  5HYN B;  3BWS A;  5HQG A;  4L9O A;  3ODT A;  3VGZ A;  2YMU A;  3DXM C;  5AMS A;  1A0R B;  2OK4 A;  2B5N A;  2OIZ A;  3CFS B;  5CXC B;  1R5M A;  2PM6 B;  4O45 A;  4FA1 D;  3EI1 B;  5HE3 B;  1JOF A;  1Q47 A;  5CXC A;  3UVM A;  3EI3 A;  3OTT A;  3V7D B;  3PXS D;  3EI1 A;  2I0R A;  4PNK B;  3EI2 A;  3HFQ A;  4L3H D;  3FRX A;  4OWR A;  2YBA A;  1MG3 A;  2HKM A;  3JRP A;  4IMM A;  3SMR A;  4A0A A;  2XU7 A;  2XL3 A;  1MDA H;  3RRM C;  2GNQ A;  4CY1 A;  3GFC A;  2IAA A;  3EU7 A;  4GQB B;  4L3G D;  4O3U B;  2PM9 B;  3OW8 A;  4JSX C;  4J8B A;  4LG9 A;  4XYI A;  1U2V C;  2HJ4 A;  2P9P C;  3AH8 B;  2H9M A;  5HE2 B;  3RFH A;  3I8C A;  4J86 A;  2G9A A;  5THA A;  2Z2O A;  4A2L A;  3NVX A;  2H3X A;  1ERJ A;  3IJC A;  3F3F A;  2HES X;  5EMK B;  5FA5 B;  3RLM D;  3OL2 B;  2YNO A;  2Z2N A;  3RSE C;  5AJA A;  2P9I C;  5FKR A;  4NSX A;  5CYK A;  3SFZ A;  5EMJ B;  5FLX g;  3RN0 D;  5GXH A;  4ZOZ A;  4GM8 A;  3BG0 A;  3UKU C;  3JZN A;  3SVW D;  2HKR A;  5TF2 A;  4X60 B;  4LGN A;  3BG1 A;  4FWW A;  1RI6 A;  2IWK A;  4CI3 A;  4CY2 A;  3EG6 A;  5A2Q g;  3SBP A;  5EM2 A;  3AFC A;  4JD2 C;  3K27 A;  2P9S C;  2CO0 C;  4J81 A;  2H9L A;  2O9K A;  5GMK n;  2PM7 B;  1NR0 A;  3PSC B;  3UVK A;  4J77 A;  3DM0 A;  4Z8L A;  2IUR A;  4X63 B;  4ZOX A;  4FA4 D;  2I3S A;  3RMZ D;  4CZV A;  3UR4 A;  4GQ1 A;  4JSV C;  2OK6 A;  3W15 A;  1GOT B;  4J79 A;  4A0B B;  4GGD A;  5IJ7 E;  3I7K A;  2CN2 A;  2J55 H;  2P9U C;  4YVD A;  4PBY A;  4GM9 A;  3U4Y A;  4A0B A;  1PEV A;  5K19 A;  3EI3 B;  4GGA A;  3F3P A;  2UZX B;  2B5L A;  2OJY A;  3IKO A;  2YNP A;  3EI4 B;  2H68 A;  1SQ9 A;  5HE0 B;  4A2M A;  4O9D A;  2CO0 A;  3EI2 B;  3JZG A;  4KFM B;  5C2W B;  1PBY B;  3RFG A;  3EI4 A;  4H5I A;  4A0A B;  3I7P A;  5TEF A;  2CE9 A;  1S4U X;  5EMM B;  5IT9 g;  1SQJ A;  1PGU A;  2XL2 A;  3C99 A;  1U4C A;  2AQ5 A;  2QC5 A;  4FA5 D;  5H17 A;  5EAR A;  3I7L A;  4X61 B;  5JWZ A;  2H9N A;  2H47 A;  3J80 g;  4CI1 A;  3MKQ A;  3IJ0 A;  1TBG A;  2CN3 A;  3PXT D;  3C5M A;  1N6E A;  3SBQ A;  2OVP B;  3SJL D;  4XYH A;  2I0T A;  3I8E A;  1B9Y A;  4FA9 D;  4CZX A;  4R7A B;  3KRW B;  4CY3 A;  2I3T A;  3IIY A;  3NVQ A;  5GXI A;  3B7F A;  5EAL A;  1JMZ B;  4J0X A;  1PI6 A;  4I79 A;  5I5J A;  4EWR A;  4ES0 A;  3JAM g;  5FXY A;  4CI8 A;  4Y5R D;  1B9X A;  5C2V B;  3K26 A;  5IGO A;  4FB1 D;  5CYK B;  5EAP A;  3A0F A;  4A11 B;  1GP2 B;  4JXM A;  2TRC B;  5I5M A;  4PXW A;  4ERY A;  1XIP A;  4GQ2 P;  4A11 A;  5AFU 3;  2AGW A;  2H6N A;  4Y7R A;  2AGZ A;  3ULE C;  4PSX B;  3I7N A;  5SXM A;  2J56 H;  5H14 A;  4PC0 A;  2I0S A;  3SWS D;  3V9F A;  3V5W B;  2XYI A;  3DWL C;  2HJB A;  5EM2 B;  3ZWL B;  2OVR B;  2UZY B;  2Q7Q A;  2G99 A;  1XHM A;  4CI2 A;  2H6K A;  4J8G A;  4GM3 A;  2AGY A;  3JZH A;  4QT8 A;  1GXR A;  5EML B;  2PBI B;  1TYQ C;  3J81 g;  3UVO A;  4U1E I;  5IC7 A;  4K3J B;  2IWF A;  2P9N C;  4J84 A;  2EBS A;  3EWE A;  3PSL A;  3FM0 A;  3JB9 L;  5HE1 B;  3C75 H;  4J82 A;  3I7O A;  1K32 A;  3GRE A;  2QXV A;  3OKY A;  4ERZ A;  2W18 A;  4A09 B;  4D0K A;  1L0Q A;  4BL0 A;  5C9Z B;  3L4O D;  4OZU A;  3MZK A;  3OKW A;  3F3G A;  5EAM A;  4A09 A;  3I89 A;  2B5M A;  4G56 B;  4BH6 A;  5H1M A;  3P4F A;  4FHL A;  4AOW A;  3NVN A;  2P9K C;  5KDO B;  2HXC A;  3JPX A;  3PE7 A;  5B4W A;  4CZY A;  4K3I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...