3N0EA

Crystal structure of wdr5 mutant (w330y)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
315
Chain Sequence
GGQQMGRGSEFVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLYKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Effect of Asp-His-Ser/Thr-Trp Tetrad on the Thermostability of WD40-Repeat Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
total genus 94
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3n0eA00
3J80g 5C2VB 5GXHA 4GQBB 4CY1A 3L4MD 2Z2PA 2XYIA 1SHYB 3JPXA 4A11B 3SCYA 4X60B 2H9MA 4CZXA 1QNIA 2Z2OA 1B9XA 3EI3A 4CY2A 4ERYA 2H3XA 2XL2A 2IWFA 3N0EA 5C9ZB 3UKRC 3IJ1A 2OK4A 4A2LA 4MK0B 4A0BB 4X63B 5B4WA 2MTAH 3C75H 3F3FA 4FB1D 2CNXA 4GM9A 3EG6A 1GOTB 5FXYA 5SXMA 2PM9A 5HE1B 3MMYA 2YNOA 1MG2A 5I5JA 2AQ5A 4ZOVA 2H6QA 3DWLC 1SQ9A 4LGNA 3FGBA 4KFMB 5H1MA 3RMZD 4LG9A 3I89A 1L0QA 2H9LA 2PM9B 5CXCA 2OK6A 5CXCB 5GXIA 2IUVA 2HKRA 4JT6C 4QL1A 3PSLA 3MKQA 4PBZA 5FQDA 3KRXB 3OKTA 4O45A 4A0BA 3ODTA 2B5MA 3I7PA 1N6FA 2GC4A 4TZ4A 4JXMA 3JRPA 5HE2B 2I0RA 3NVNA 3PSCB 2J57G 4PXWA 5EAMA 1B9YA 1OLZA 4GM8A 2IWKA 5EMKB 2AGLA 2IAAA 4R7AB 5CYKB 4CI1A 2HESX 4N14A 3UVOA 1U2VC 4CY3A 4FA4D 2B4EA 3N0DA 4JD2C 5FKTA 4A2MA 2HKMA 5EALA 3L4OD 3I7OA 5EM2B 3PE7A 2PM7B 1RI6A 2GNQA 3I8EA 2H13A 3UVKA 2YBAA 3ZWLB 3A0FA 4ZOZA 4A09A 3OKYA 4EWRA 3RFGA 2HXCA 4ZN4A 5A2Qg 2H6NA 2HYEA 2H9PA 3BWSA 5EMMB 3FRXA 1ERJA 4A08A 4GGCA 3ULEC 5C2WB 2G99A 4G56B 5HQGA 2AH1A 4A09B 1K8KC 4IA9A 4FAVD 1FWXA 1NEXB 2P9LC 4GZ8A 5IJ7E 1N6DA 3RN0D 4GMBA 5EM2A 3SHFA 3SBRA 2BBKH 4PBYA 3V9FA 4JT5C 4A7JA 3PVUB 5EARA 2CO0C 3OL2B 2OVQB 4U7AA 1PI6A 3HFQA 3ORVD 5IGQA 3EI2B 5I5MA 3F3GA 3EWEA 4CI3A 5AMSA 2H14A 4L1QD 3OW8A 3SXTD 4CZYA 3SMRA 1GG2B 4PC0A 4J78A 5FA5B 4QT8A 3NVXA 4GQ2P 3I7NA 2IUPA 3RFHA 3AL8A 1PGUA 5FKQA 5H14A 2P9UC 2UZXB 5GSAA 3V7DB 3DXMC 2YB8B 2AGXA 3MZKA 3AL8B 2IURA 4XEIC 4O3TB 1GXRA 3UVNA 2B5NA 3JZHA 2I3TA 5IGOA 4L3GD 4L3HD 4D0KA 5GMKn 3I8CA 3E0CA 3EU7A 1JOFA 2IUQA 3PVWB 2CN2A 3VGZA 1TYQC 3UKUC 2OVPB 4J82A 5HYNB 2BCJB 4E54B 3JB9L 4O9DA 4X3EA 4GGDA 2XU7A 3I7KA 2CN3A 5FLXg 4J86A 1MDAH 4ZOYA 4AEZA 4FA5D 4E54A 3W15A 1Q47A 2H9NA 2HJ4A 5TDHB 3PXWD 2P9IC 4A08B 4ZOXA 4H5JA 4FWWA 3JZNA 2HJBA 5JWZA 5K1CC 3OKYB 2PBIB 1OMWB 4A0AB 3C5MA 2YNPA 3J81g 1XIPA 2P9PC 3OTTA 2I3SA 4CZVA 4J81A 4X61B 2I0SA 5K19A 1TBGA 4QQEA 4BUJC 4O3UB 4QRJA 3C99A 4J0WA 5FKSA 4J84A 2H47A 2AGZA 4PNKB 1VYHC 5I5IA 3IJ0A 4ES0A 3CIKB 4PSXB 3BG0A 5FKRA 2AH0A 3VH0A 5IT9g 1SQJA 5EMLB 3EI2A 3VA6A 1K32A 3GFCA 3SBQA 4AOWA 3IJCA 4K3JB 3KRWB 4BH6A 3C9CA 3OL2A 3UVLA 2XL3A 2UZYB 2QXVA 1MG3A 4HDJA 4FA1D 2J55H 4J8BA 1GP2B 2YMUA 4O1QD 4A11A 3JAMg 4FA9D 1R5MA 4A0AA 2OVRB 3JROA 4E5ZA 4XYIA 1PBYB 2Q7QA 3PXTD 1P22A 1JMXB 3AFCA 2CE8A 2B5LA 3B7FA 2O9KA 2W18A 4LG8A 3EI1B 4CY5A 2CO0A 4Y5RD 4I79A 4JSVC 3U4YA 3EMHA 3I7HA 3OKWA 2CE9A 3IKOA 5IC7A 3IIYA 5CXBA 2H68A 1S4UX 4U1EI 5CXBB 2EBSA 1PEVA 5H17A 4PSWB 4J87A 2TRCB 3MZLA 2J56H 4H5IA 4K3ID 1JMZB 4OZUA 1N6EA 2H6KA 1XHMA 5AFU3 4Z8LA 3F3PA 2OIZA 3K27A 4J8GA 4FAND 5EAPA 3CFSB 5THAA 4E5ZB 4JSXC 2G9AA 3EI4B 5CYKA 3V5WB 4XYHA 2GC7A 5KDOB 3IIWA 3DSMA 4GM3A 2AGWA 4CI2A 4J0XA 4CC9A 3RLMD 2Z2NA 4OWRA 3DXKC 2P9KC 4ERQA 5TF2A 1YFQA 3UVMA 4J77A 4JSPC 3RSEC 3P4FA 4BL0A 1XKSA 3PXSD 4J73A 5TEEA 4CI8A 4IMMA 2I0TA 2YNNA 5TEFA 3MXXA 1A0RB 3SWSD 4GQ1A 3K26A 4ERZA 3SN6B 1U4CA 3SJLD 4NSXA 5HE3B 5AJAA 3EI4A 3SVWD 3NVQA 3GREA 2AGYA 4L9OA 4UI9R 2PM6B 3DM0A 3JZGA 4D6VA 3FM0A 5HE0B 3SLED 1NR0A 2QC5A 3SBPA 4FHLA 4YVDA 3CFVA 3I7LA 2P9NC 2OJYA 2P9SC 4ESGA 3UR4A 3MKSB 1JJUB 3RN1D 5IJ8E 3I2NA 5EMJB 4Y7RA 3AL9A 3EI3B 3RRMC 4GGAA 4JSNC 3AH8B 3BG1A 3EI1A 3SFZA 4J79A
chains in the Genus database with same CATH superfamily
3J80g 5M5RA 5C2VB 5GXHA 1I2MB 3IVMA 4GQBB 4CY1A 3L4MD 2Z2PA 2XYIA 1SHYB 3JPXA 4A11B 3OF7A 3SCYA 4DNWA 1GOGA 4X60B 2H9MA 2VDKA 4CZXA 2Z2OA 1B9XA 3EI3A 4AN1A 4CY2A 2QZPA 4ERYA 2H3XA 2XL2A 2HU7A 2IWFA 3N0EA 5C9ZB 3UKRC 3IJ1A 2OK4A 4O02A 4A2LA 1T2XA 4MK0B 4A0BB 4X63B 5B4WA 2MTAH 3C75H 3F3FA 4O2WA 3K6SA 4FB1D 2CNXA 4GM9A 3EG6A 1GOTB 5FXYA 4G1MA 5SXMA 2PM9A 3ZDYA 5HE1B 3MMYA 2YNOA 4BP8A 1MG2A 1H2YA 5I5JA 2AQ5A 1JTDB 4ZOVA 2H6QA 3DWLC 5HDBA 1SQ9A 3ZE1A 4Z7OA 4LGNA 3FGBA 4KFMB 3IURA 4UM8A 5H1MA 3RMZD 4LG9A 3I89A 3K71A 4MMZA 1L0QA 4NBMA 2H9LA 2PM9B 3IUMA 5CXCA 2WQ8A 2OK6A 1UOPA 2VDQA 5CXCB 5GXIA 2IUVA 2HKRA 4JT6C 4QL1A 3PSLA 3IUNA 3MKQA 4PBZA 5FQDA 1C9IA 3KRXB 3OKTA 4O45A 4A0BA 3ODTA 2B5MA 3I7PA 1N6FA 2GC4A 4AN0A 1O6GA 2VZ3A 4TZ4A 4UM9A 4JXMA 3JRPA 5HE2B 1A12A 3NVNA 2I0RA 2XZGA 2EICA 3PSCB 2J57G 4PXWA 5EAMA 1B9YA 1OLZA 4GM8A 2IWKA 5EMKB 4DNVA 2AGLA 2IAAA 4R7AB 5CYKB 4CI1A 2HESX 2VDMA 4N14A 1VE6A 4BCDA 3UVOA 1U2VC 4CY3A 4FA4D 2B4EA 3N0DA 4JD2C 1L5GA 5FKTA 4A2MA 1UOQA 2HKMA 3O4JA 5EALA 1GOHA 5M5TA 2JKXA 2EIDA 3L4OD 3V4PA 3I7OA 5EM2B 5E6UA 4G55A 4L1MA 3PE7A 2PM7B 1RI6A 2GNQA 1VE7A 3O4GA 4DNUA 4J79A 3I8EA 2H13A 3UVKA 2YBAA 3ZWLB 3ZE0A 3A0FA 1U8CA 4ZOZA 1VZ2A 4AX4A 4A09A 3OKYA 3GC3B 4EWRA 3RFGA 2HXCA 4NC4A 4ZN4A 2H6NA 5A2Qg 2H9PA 2HYEA 3BWSA 2VC2A 5EMMB 3FRXA 1H2WA 1ERJA 4A08A 4GGCA 3ULEC 5C2WB 2G99A 4G56B 5HQGA 2AH1A 4A09B 1K8KC 4IA9A 4FAVD 1FWXA 1NEXB 2P9LC 4GZ8A 4WK0A 1N6DA 5IJ7E 3RN0D 4GMBA 5EM2A 3SHFA 3SBRA 2BBKH 4PBYA 3V9FA 4JT5C 2VZ1A 4A7JA 3PVUB 5EARA 3ZE2A 3KCIA 2CO0C 2VDPA 3VI4A 3OL2B 2OVQB 4U7AA 1PI6A 3HFQA 3ORVD 5IGQA 3EI2B 5I5MA 3F3GA 3EWEA 1M1XA 4CI3A 5AMSA 2H14A 1TYEA 4L1QD 3OW8A 3SXTD 4CZYA 3SMRA 1GG2B 4IRZA 4PC0A 4J78A 5E6SA 5FA5B 4QT8A 3NVXA 4GQ2P 3I7NA 2IUPA 3RFHA 3AL8A 1PGUA 5FKQA 5H14A 2P9UC 2UZXB 5GSAA 3V7DB 4JHPC 3DXMC 2YB8B 2AGXA 3MZKA 3AL8B 3EQ7A 2IURA 3QI0A 4XEIC 4O3TB 1GXRA 3UVNA 2B5NA 3IUJA 3JZHA 2I3TA 5IGOA 4L3GD 4L3HD 4D0KA 5GMKn 3I8CA 3E0CA 3EU7A 1JOFA 2IUQA 3PVWB 2CN2A 2VDLA 2VDOA 3VGZA 1TYQC 3UKUC 2OVPB 1BPOA 4J82A 5HYNB 3NIDA 2BCJB 4E54B 3JB9L 4O9DA 3ZDZA 4X3EA 1H2ZA 4Z7QA 4QAMA 4GGDA 2XU7A 3I7KA 2CN3A 5FLXg 3NIGA 4J86A 1MDAH 2VDNA 4ZOYA 4AEZA 4FA5D 4E54A 1GOFA 3W15A 3NIFA 1Q47A 2H9NA 1E8MA 2HJ4A 5TDHB 3PXWD 2P9IC 4A08B 4ZOXA 4H5JA 4FWWA 3JZNA 2HJBA 5JWZA 5K1CC 3OKYB 2PBIB 1OMWB 4A0AB 1UOOA 1VZ3A 3C5MA 2YNPA 3J81g 1XIPA 2P9PC 3OTTA 2I3SA 4CZVA 3K72A 4D9SA 4J81A 4X61B 2I0SA 1E5TA 1E8NA 5K19A 1TBGA 4QQEA 4BUJC 4O3UB 4QRJA 1YR2A 3C99A 4J0WA 5FKSA 3GD1I 4J84A 2AGZA 2H47A 3FCUA 5M5UA 4PNKB 1VYHC 5I5IA 2HU5A 3IJ0A 4ES0A 5C86A 3CIKB 4PSXB 3BG0A 5FKRA 2AH0A 3VH0A 5IT9g 1SQJA 5EMLB 4WK2A 1O6FA 3EI2A 3VA6A 1K32A 4Z7NA 3GFCA 3SBQA 4AOWA 3IJCA 4K3JB 3T3MA 2HU8A 3KRWB 4BH6A 3MUNA 3C9CA 3OL2A 4NAAA 3UVLA 2XL3A 3MVDK 2UZYB 2QXVA 1MG3A 4HDJA 4FA1D 5C92A 2J55H 4J8BA 1GP2B 2YMUA 4O1QD 4A11A 3JAMg 4FA9D 1R5MA 4A0AA 2OVRB 3JROA 4E5ZA 2QR5A 1PBYB 4XYIA 2Q7QA 3PXTD 1P22A 5E6RA 1JMXB 3T3PA 3AFCA 2CE8A 2B5LA 3B7FA 2EIBA 2O9KA 3QHYB 2W18A 4LG8A 3IUQA 3EI1B 4JHNA 4CY5A 4WK4A 2CO0A 4Y5RD 4I79A 4JSVC 3U4YA 3EMHA 3I7HA 3OKWA 2CE9A 3DDUA 3IULA 3IKOA 5IC7A 3IIYA 5CXBA 2H68A 1S4UX 4U1EI 5CXBB 2EBSA 1PEVA 5H17A 4PSWB 4J87A 2TRCB 3MZLA 5M5SA 2J56H 4H5IA 4K3ID 1JV2A 1JMZB 4OZUA 1N6EA 2H6KA 1XHMA 5AFU3 3O4IA 4Z8LA 4BCBA 3F3PA 2OIZA 3V4VA 3K27A 4J8GA 5M61A 3O4HA 4FAND 5EAPA 3CFSB 5THAA 4E5ZB 4JSXC 2XDWA 2G9AA 3EI4B 5CYKA 5FFGA 3V5WB 4XYHA 2GC7A 5KDOB 3IIWA 4AMYA 3DSMA 4GM3A 2AGWA 4MMYA 5FFOA 4CI2A 4J0XA 1K3IA 4CC9A 3RLMD 2Z2NA 4OWRA 4BP9A 2EIEA 3DXKC 2P9KC 4WJKA 4MMXA 4ERQA 1QFSA 1YFQA 5TF2A 3UVMA 4J77A 1H2XA 4JSPC 3RSEC 1C9LA 3P4FA 4BL0A 3EQ9A 1XKSA 3IJEA 3PXSD 4J73A 5M5VA 5TEEA 4CI8A 4IMMA 2I0TA 2YNNA 5TEFA 3MXXA 1A0RB 3SWSD 4GQ1A 3K26A 4ERZA 3SN6B 1UTCA 1U4CA 3SJLD 4NSXA 5HE3B 5AJAA 3EI4A 3SVWD 3NVQA 3GREA 4RE6A 3EQ8A 2AGYA 4L9OA 2BKLA 4UI9R 2PM6B 3DM0A 3JZGA 4D6VA 3FM0A 5HE0B 3SLED 1NR0A 2QC5A 3SBPA 4FHLA 4YVDA 3CFVA 3VI3A 3I7LA 4RE5A 2P9NC 2OJYA 2P9SC 4G1EA 1QFMA 4ESGA 3UR4A 3MKSB 1JJUB 4BCCA 3RN1D 5IJ8E 4NENA 2VDRA 2XE4A 3FCSA 3I2NA 3ZDXA 5EMJB 4AMZA 4Y7RA 3AL9A 3EI3B 3MUOA 4GGAA 3RRMC 4JSNC 3AH8B 3BG1A 3EI1A 3SFZA 1QNIA
chains in the Genus database with same CATH topology
3J80g 5C2VB 5GXHA 4GQBB 4CY1A 3L4MD 2Z2PA 2XYIA 1SHYB 3JPXA 4A11B 3SCYA 4X60B 2H9MA 4CZXA 1QNIA 2Z2OA 1B9XA 3EI3A 4CY2A 4ERYA 2H3XA 2XL2A 2IWFA 3N0EA 5C9ZB 3UKRC 3IJ1A 2OK4A 4A2LA 4MK0B 4A0BB 4X63B 5B4WA 2MTAH 3C75H 3F3FA 4FB1D 2CNXA 4GM9A 3EG6A 1GOTB 5FXYA 5SXMA 2PM9A 5HE1B 3MMYA 2YNOA 1MG2A 5I5JA 2AQ5A 4ZOVA 2H6QA 3DWLC 1SQ9A 4LGNA 3FGBA 4KFMB 5H1MA 3RMZD 4LG9A 3I89A 1L0QA 2H9LA 2PM9B 5CXCA 2OK6A 5CXCB 5GXIA 2IUVA 2HKRA 4JT6C 4QL1A 3PSLA 3MKQA 4PBZA 5FQDA 3KRXB 3OKTA 4O45A 4A0BA 3ODTA 2B5MA 3I7PA 1N6FA 2GC4A 4TZ4A 4JXMA 3JRPA 5HE2B 2I0RA 3NVNA 3PSCB 2J57G 4PXWA 5EAMA 1B9YA 1OLZA 4GM8A 2IWKA 5EMKB 2AGLA 2IAAA 4R7AB 5CYKB 4CI1A 2HESX 4N14A 3UVOA 1U2VC 4CY3A 4FA4D 2B4EA 3N0DA 4JD2C 5FKTA 4A2MA 2HKMA 5EALA 3L4OD 3I7OA 5EM2B 3PE7A 2PM7B 1RI6A 2GNQA 3I8EA 2H13A 3UVKA 2YBAA 3ZWLB 3A0FA 4ZOZA 4A09A 3OKYA 4EWRA 3RFGA 2HXCA 4ZN4A 5A2Qg 2H6NA 2HYEA 2H9PA 3BWSA 5EMMB 3FRXA 1ERJA 4A08A 4GGCA 3ULEC 5C2WB 2G99A 4G56B 5HQGA 2AH1A 4A09B 1K8KC 4IA9A 4FAVD 1FWXA 1NEXB 2P9LC 4GZ8A 5IJ7E 1N6DA 3RN0D 4GMBA 5EM2A 3SHFA 3SBRA 2BBKH 4PBYA 3V9FA 4JT5C 4A7JA 3PVUB 5EARA 2CO0C 3OL2B 2OVQB 4U7AA 1PI6A 3HFQA 3ORVD 5IGQA 3EI2B 5I5MA 3F3GA 3EWEA 4CI3A 5AMSA 2H14A 4L1QD 3OW8A 3SXTD 4CZYA 3SMRA 1GG2B 4PC0A 4J78A 5FA5B 4QT8A 3NVXA 4GQ2P 3I7NA 2IUPA 3RFHA 3AL8A 1PGUA 5FKQA 5H14A 2P9UC 2UZXB 5GSAA 3V7DB 3DXMC 2YB8B 2AGXA 3MZKA 3AL8B 2IURA 4XEIC 4O3TB 1GXRA 3UVNA 2B5NA 3JZHA 2I3TA 5IGOA 4L3GD 4L3HD 4D0KA 5GMKn 3I8CA 3E0CA 3EU7A 1JOFA 2IUQA 3PVWB 2CN2A 3VGZA 1TYQC 3UKUC 2OVPB 4J82A 5HYNB 2BCJB 4E54B 3JB9L 4O9DA 4X3EA 4GGDA 2XU7A 3I7KA 2CN3A 5FLXg 4J86A 1MDAH 4ZOYA 4AEZA 4FA5D 4E54A 3W15A 1Q47A 2H9NA 2HJ4A 5TDHB 3PXWD 2P9IC 4A08B 4ZOXA 4H5JA 4FWWA 3JZNA 2HJBA 5JWZA 5K1CC 3OKYB 2PBIB 1OMWB 4A0AB 3C5MA 2YNPA 3J81g 1XIPA 2P9PC 3OTTA 2I3SA 4CZVA 4J81A 4X61B 2I0SA 5K19A 1TBGA 4QQEA 4BUJC 4O3UB 4QRJA 3C99A 4J0WA 5FKSA 4J84A 2H47A 2AGZA 4PNKB 1VYHC 5I5IA 3IJ0A 4ES0A 3CIKB 4PSXB 3BG0A 5FKRA 2AH0A 3VH0A 5IT9g 1SQJA 5EMLB 3EI2A 3VA6A 1K32A 3GFCA 3SBQA 4AOWA 3IJCA 4K3JB 3KRWB 4BH6A 3C9CA 3OL2A 3UVLA 2XL3A 2UZYB 2QXVA 1MG3A 4HDJA 4FA1D 2J55H 4J8BA 1GP2B 2YMUA 4O1QD 4A11A 3JAMg 4FA9D 1R5MA 4A0AA 2OVRB 3JROA 4E5ZA 4XYIA 1PBYB 2Q7QA 3PXTD 1P22A 1JMXB 3AFCA 2CE8A 2B5LA 3B7FA 2O9KA 2W18A 4LG8A 3EI1B 4CY5A 2CO0A 4Y5RD 4I79A 4JSVC 3U4YA 3EMHA 3I7HA 3OKWA 2CE9A 3IKOA 5IC7A 3IIYA 5CXBA 2H68A 1S4UX 4U1EI 5CXBB 2EBSA 1PEVA 5H17A 4PSWB 4J87A 2TRCB 3MZLA 2J56H 4H5IA 4K3ID 1JMZB 4OZUA 1N6EA 2H6KA 1XHMA 5AFU3 4Z8LA 3F3PA 2OIZA 3K27A 4J8GA 4FAND 5EAPA 3CFSB 5THAA 4E5ZB 4JSXC 2G9AA 3EI4B 5CYKA 3V5WB 4XYHA 2GC7A 5KDOB 3IIWA 3DSMA 4GM3A 2AGWA 4CI2A 4J0XA 4CC9A 3RLMD 2Z2NA 4OWRA 3DXKC 2P9KC 4ERQA 5TF2A 1YFQA 3UVMA 4J77A 4JSPC 3RSEC 3P4FA 4BL0A 1XKSA 3PXSD 4J73A 5TEEA 4CI8A 4IMMA 2I0TA 2YNNA 5TEFA 3MXXA 1A0RB 3SWSD 4GQ1A 3K26A 4ERZA 3SN6B 1U4CA 3SJLD 4NSXA 5HE3B 5AJAA 3EI4A 3SVWD 3NVQA 3GREA 2AGYA 4L9OA 4UI9R 2PM6B 3DM0A 3JZGA 4D6VA 3FM0A 5HE0B 3SLED 1NR0A 2QC5A 3SBPA 4FHLA 4YVDA 3CFVA 3I7LA 2P9NC 2OJYA 2P9SC 4ESGA 3UR4A 3MKSB 1JJUB 3RN1D 5IJ8E 3I2NA 5EMJB 4Y7RA 3AL9A 3EI3B 3RRMC 4GGAA 4JSNC 3AH8B 3BG1A 3EI1A 3SFZA 4J79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 g;  5C2V B;  5GXH A;  4GQB B;  4CY1 A;  3L4M D;  2Z2P A;  2XYI A;  1SHY B;  3JPX A;  4A11 B;  3SCY A;  4X60 B;  2H9M A;  4CZX A;  1QNI A;  2Z2O A;  1B9X A;  3EI3 A;  4CY2 A;  4ERY A;  2H3X A;  2XL2 A;  2IWF A;  3N0E A;  5C9Z B;  3UKR C;  3IJ1 A;  2OK4 A;  4A2L A;  4MK0 B;  4A0B B;  4X63 B;  5B4W A;  2MTA H;  3C75 H;  3F3F A;  4FB1 D;  2CNX A;  4GM9 A;  3EG6 A;  1GOT B;  5FXY A;  5SXM A;  2PM9 A;  5HE1 B;  3MMY A;  2YNO A;  1MG2 A;  5I5J A;  2AQ5 A;  4ZOV A;  2H6Q A;  3DWL C;  1SQ9 A;  4LGN A;  3FGB A;  4KFM B;  5H1M A;  3RMZ D;  4LG9 A;  3I89 A;  1L0Q A;  2H9L A;  2PM9 B;  5CXC A;  2OK6 A;  5CXC B;  5GXI A;  2IUV A;  2HKR A;  4JT6 C;  4QL1 A;  3PSL A;  3MKQ A;  4PBZ A;  5FQD A;  3KRX B;  3OKT A;  4O45 A;  4A0B A;  3ODT A;  2B5M A;  3I7P A;  1N6F A;  2GC4 A;  4TZ4 A;  4JXM A;  3JRP A;  5HE2 B;  2I0R A;  3NVN A;  3PSC B;  2J57 G;  4PXW A;  5EAM A;  1B9Y A;  1OLZ A;  4GM8 A;  2IWK A;  5EMK B;  2AGL A;  2IAA A;  4R7A B;  5CYK B;  4CI1 A;  2HES X;  4N14 A;  3UVO A;  1U2V C;  4CY3 A;  4FA4 D;  2B4E A;  3N0D A;  4JD2 C;  5FKT A;  4A2M A;  2HKM A;  5EAL A;  3L4O D;  3I7O A;  5EM2 B;  3PE7 A;  2PM7 B;  1RI6 A;  2GNQ A;  3I8E A;  2H13 A;  3UVK A;  2YBA A;  3ZWL B;  3A0F A;  4ZOZ A;  4A09 A;  3OKY A;  4EWR A;  3RFG A;  2HXC A;  4ZN4 A;  5A2Q g;  2H6N A;  2HYE A;  2H9P A;  3BWS A;  5EMM B;  3FRX A;  1ERJ A;  4A08 A;  4GGC A;  3ULE C;  5C2W B;  2G99 A;  4G56 B;  5HQG A;  2AH1 A;  4A09 B;  1K8K C;  4IA9 A;  4FAV D;  1FWX A;  1NEX B;  2P9L C;  4GZ8 A;  5IJ7 E;  1N6D A;  3RN0 D;  4GMB A;  5EM2 A;  3SHF A;  3SBR A;  2BBK H;  4PBY A;  3V9F A;  4JT5 C;  4A7J A;  3PVU B;  5EAR A;  2CO0 C;  3OL2 B;  2OVQ B;  4U7A A;  1PI6 A;  3HFQ A;  3ORV D;  5IGQ A;  3EI2 B;  5I5M A;  3F3G A;  3EWE A;  4CI3 A;  5AMS A;  2H14 A;  4L1Q D;  3OW8 A;  3SXT D;  4CZY A;  3SMR A;  1GG2 B;  4PC0 A;  4J78 A;  5FA5 B;  4QT8 A;  3NVX A;  4GQ2 P;  3I7N A;  2IUP A;  3RFH A;  3AL8 A;  1PGU A;  5FKQ A;  5H14 A;  2P9U C;  2UZX B;  5GSA A;  3V7D B;  3DXM C;  2YB8 B;  2AGX A;  3MZK A;  3AL8 B;  2IUR A;  4XEI C;  4O3T B;  1GXR A;  3UVN A;  2B5N A;  3JZH A;  2I3T A;  5IGO A;  4L3G D;  4L3H D;  4D0K A;  5GMK n;  3I8C A;  3E0C A;  3EU7 A;  1JOF A;  2IUQ A;  3PVW B;  2CN2 A;  3VGZ A;  1TYQ C;  3UKU C;  2OVP B;  4J82 A;  5HYN B;  2BCJ B;  4E54 B;  3JB9 L;  4O9D A;  4X3E A;  4GGD A;  2XU7 A;  3I7K A;  2CN3 A;  5FLX g;  4J86 A;  1MDA H;  4ZOY A;  4AEZ A;  4FA5 D;  4E54 A;  3W15 A;  1Q47 A;  2H9N A;  2HJ4 A;  5TDH B;  3PXW D;  2P9I C;  4A08 B;  4ZOX A;  4H5J A;  4FWW A;  3JZN A;  2HJB A;  5JWZ A;  5K1C C;  3OKY B;  2PBI B;  1OMW B;  4A0A B;  3C5M A;  2YNP A;  3J81 g;  1XIP A;  2P9P C;  3OTT A;  2I3S A;  4CZV A;  4J81 A;  4X61 B;  2I0S A;  5K19 A;  1TBG A;  4QQE A;  4BUJ C;  4O3U B;  4QRJ A;  3C99 A;  4J0W A;  5FKS A;  4J84 A;  2H47 A;  2AGZ A;  4PNK B;  1VYH C;  5I5I A;  3IJ0 A;  4ES0 A;  3CIK B;  4PSX B;  3BG0 A;  5FKR A;  2AH0 A;  3VH0 A;  5IT9 g;  1SQJ A;  5EML B;  3EI2 A;  3VA6 A;  1K32 A;  3GFC A;  3SBQ A;  4AOW A;  3IJC A;  4K3J B;  3KRW B;  4BH6 A;  3C9C A;  3OL2 A;  3UVL A;  2XL3 A;  2UZY B;  2QXV A;  1MG3 A;  4HDJ A;  4FA1 D;  2J55 H;  4J8B A;  1GP2 B;  2YMU A;  4O1Q D;  4A11 A;  3JAM g;  4FA9 D;  1R5M A;  4A0A A;  2OVR B;  3JRO A;  4E5Z A;  4XYI A;  1PBY B;  2Q7Q A;  3PXT D;  1P22 A;  1JMX B;  3AFC A;  2CE8 A;  2B5L A;  3B7F A;  2O9K A;  2W18 A;  4LG8 A;  3EI1 B;  4CY5 A;  2CO0 A;  4Y5R D;  4I79 A;  4JSV C;  3U4Y A;  3EMH A;  3I7H A;  3OKW A;  2CE9 A;  3IKO A;  5IC7 A;  3IIY A;  5CXB A;  2H68 A;  1S4U X;  4U1E I;  5CXB B;  2EBS A;  1PEV A;  5H17 A;  4PSW B;  4J87 A;  2TRC B;  3MZL A;  2J56 H;  4H5I A;  4K3I D;  1JMZ B;  4OZU A;  1N6E A;  2H6K A;  1XHM A;  5AFU 3;  4Z8L A;  3F3P A;  2OIZ A;  3K27 A;  4J8G A;  4FAN D;  5EAP A;  3CFS B;  5THA A;  4E5Z B;  4JSX C;  2G9A A;  3EI4 B;  5CYK A;  3V5W B;  4XYH A;  2GC7 A;  5KDO B;  3IIW A;  3DSM A;  4GM3 A;  2AGW A;  4CI2 A;  4J0X A;  4CC9 A;  3RLM D;  2Z2N A;  4OWR A;  3DXK C;  2P9K C;  4ERQ A;  5TF2 A;  1YFQ A;  3UVM A;  4J77 A;  4JSP C;  3RSE C;  3P4F A;  4BL0 A;  1XKS A;  3PXS D;  4J73 A;  5TEE A;  4CI8 A;  4IMM A;  2I0T A;  2YNN A;  5TEF A;  3MXX A;  1A0R B;  3SWS D;  4GQ1 A;  3K26 A;  4ERZ A;  3SN6 B;  1U4C A;  3SJL D;  4NSX A;  5HE3 B;  5AJA A;  3EI4 A;  3SVW D;  3NVQ A;  3GRE A;  2AGY A;  4L9O A;  4UI9 R;  2PM6 B;  3DM0 A;  3JZG A;  4D6V A;  3FM0 A;  5HE0 B;  3SLE D;  1NR0 A;  2QC5 A;  3SBP A;  4FHL A;  4YVD A;  3CFV A;  3I7L A;  2P9N C;  2OJY A;  2P9S C;  4ESG A;  3UR4 A;  3MKS B;  1JJU B;  3RN1 D;  5IJ8 E;  3I2N A;  5EMJ B;  4Y7R A;  3AL9 A;  3EI3 B;  3RRM C;  4GGA A;  4JSN C;  3AH8 B;  3BG1 A;  3EI1 A;  3SFZ A;  4J79 A; 
#chains in the Genus database with same CATH topology
 3J80 g;  5M5R A;  5C2V B;  5GXH A;  1I2M B;  3IVM A;  4GQB B;  4CY1 A;  3L4M D;  2Z2P A;  2XYI A;  1SHY B;  3JPX A;  4A11 B;  3OF7 A;  3SCY A;  4DNW A;  1GOG A;  4X60 B;  2H9M A;  2VDK A;  4CZX A;  2Z2O A;  1B9X A;  3EI3 A;  4AN1 A;  4CY2 A;  2QZP A;  4ERY A;  2H3X A;  2XL2 A;  2HU7 A;  2IWF A;  3N0E A;  5C9Z B;  3UKR C;  3IJ1 A;  2OK4 A;  4O02 A;  4A2L A;  1T2X A;  4MK0 B;  4A0B B;  4X63 B;  5B4W A;  2MTA H;  3C75 H;  3F3F A;  4O2W A;  3K6S A;  4FB1 D;  2CNX A;  4GM9 A;  3EG6 A;  1GOT B;  5FXY A;  4G1M A;  5SXM A;  2PM9 A;  3ZDY A;  5HE1 B;  3MMY A;  2YNO A;  4BP8 A;  1MG2 A;  1H2Y A;  5I5J A;  2AQ5 A;  1JTD B;  4ZOV A;  2H6Q A;  3DWL C;  5HDB A;  1SQ9 A;  3ZE1 A;  4Z7O A;  4LGN A;  3FGB A;  4KFM B;  3IUR A;  4UM8 A;  5H1M A;  3RMZ D;  4LG9 A;  3I89 A;  3K71 A;  4MMZ A;  1L0Q A;  4NBM A;  2H9L A;  2PM9 B;  3IUM A;  5CXC A;  2WQ8 A;  2OK6 A;  1UOP A;  2VDQ A;  5CXC B;  5GXI A;  2IUV A;  2HKR A;  4JT6 C;  4QL1 A;  3PSL A;  3IUN A;  3MKQ A;  4PBZ A;  5FQD A;  1C9I A;  3KRX B;  3OKT A;  4O45 A;  4A0B A;  3ODT A;  2B5M A;  3I7P A;  1N6F A;  2GC4 A;  4AN0 A;  1O6G A;  2VZ3 A;  4TZ4 A;  4UM9 A;  4JXM A;  3JRP A;  5HE2 B;  1A12 A;  3NVN A;  2I0R A;  2XZG A;  2EIC A;  3PSC B;  2J57 G;  4PXW A;  5EAM A;  1B9Y A;  1OLZ A;  4GM8 A;  2IWK A;  5EMK B;  4DNV A;  2AGL A;  2IAA A;  4R7A B;  5CYK B;  4CI1 A;  2HES X;  2VDM A;  4N14 A;  1VE6 A;  4BCD A;  3UVO A;  1U2V C;  4CY3 A;  4FA4 D;  2B4E A;  3N0D A;  4JD2 C;  1L5G A;  5FKT A;  4A2M A;  1UOQ A;  2HKM A;  3O4J A;  5EAL A;  1GOH A;  5M5T A;  2JKX A;  2EID A;  3L4O D;  3V4P A;  3I7O A;  5EM2 B;  5E6U A;  4G55 A;  4L1M A;  3PE7 A;  2PM7 B;  1RI6 A;  2GNQ A;  1VE7 A;  3O4G A;  4DNU A;  4J79 A;  3I8E A;  2H13 A;  3UVK A;  2YBA A;  3ZWL B;  3ZE0 A;  3A0F A;  1U8C A;  4ZOZ A;  1VZ2 A;  4AX4 A;  4A09 A;  3OKY A;  3GC3 B;  4EWR A;  3RFG A;  2HXC A;  4NC4 A;  4ZN4 A;  2H6N A;  5A2Q g;  2H9P A;  2HYE A;  3BWS A;  2VC2 A;  5EMM B;  3FRX A;  1H2W A;  1ERJ A;  4A08 A;  4GGC A;  3ULE C;  5C2W B;  2G99 A;  4G56 B;  5HQG A;  2AH1 A;  4A09 B;  1K8K C;  4IA9 A;  4FAV D;  1FWX A;  1NEX B;  2P9L C;  4GZ8 A;  4WK0 A;  1N6D A;  5IJ7 E;  3RN0 D;  4GMB A;  5EM2 A;  3SHF A;  3SBR A;  2BBK H;  4PBY A;  3V9F A;  4JT5 C;  2VZ1 A;  4A7J A;  3PVU B;  5EAR A;  3ZE2 A;  3KCI A;  2CO0 C;  2VDP A;  3VI4 A;  3OL2 B;  2OVQ B;  4U7A A;  1PI6 A;  3HFQ A;  3ORV D;  5IGQ A;  3EI2 B;  5I5M A;  3F3G A;  3EWE A;  1M1X A;  4CI3 A;  5AMS A;  2H14 A;  1TYE A;  4L1Q D;  3OW8 A;  3SXT D;  4CZY A;  3SMR A;  1GG2 B;  4IRZ A;  4PC0 A;  4J78 A;  5E6S A;  5FA5 B;  4QT8 A;  3NVX A;  4GQ2 P;  3I7N A;  2IUP A;  3RFH A;  3AL8 A;  1PGU A;  5FKQ A;  5H14 A;  2P9U C;  2UZX B;  5GSA A;  3V7D B;  4JHP C;  3DXM C;  2YB8 B;  2AGX A;  3MZK A;  3AL8 B;  3EQ7 A;  2IUR A;  3QI0 A;  4XEI C;  4O3T B;  1GXR A;  3UVN A;  2B5N A;  3IUJ A;  3JZH A;  2I3T A;  5IGO A;  4L3G D;  4L3H D;  4D0K A;  5GMK n;  3I8C A;  3E0C A;  3EU7 A;  1JOF A;  2IUQ A;  3PVW B;  2CN2 A;  2VDL A;  2VDO A;  3VGZ A;  1TYQ C;  3UKU C;  2OVP B;  1BPO A;  4J82 A;  5HYN B;  3NID A;  2BCJ B;  4E54 B;  3JB9 L;  4O9D A;  3ZDZ A;  4X3E A;  1H2Z A;  4Z7Q A;  4QAM A;  4GGD A;  2XU7 A;  3I7K A;  2CN3 A;  5FLX g;  3NIG A;  4J86 A;  1MDA H;  2VDN A;  4ZOY A;  4AEZ A;  4FA5 D;  4E54 A;  1GOF A;  3W15 A;  3NIF A;  1Q47 A;  2H9N A;  1E8M A;  2HJ4 A;  5TDH B;  3PXW D;  2P9I C;  4A08 B;  4ZOX A;  4H5J A;  4FWW A;  3JZN A;  2HJB A;  5JWZ A;  5K1C C;  3OKY B;  2PBI B;  1OMW B;  4A0A B;  1UOO A;  1VZ3 A;  3C5M A;  2YNP A;  3J81 g;  1XIP A;  2P9P C;  3OTT A;  2I3S A;  4CZV A;  3K72 A;  4D9S A;  4J81 A;  4X61 B;  2I0S A;  1E5T A;  1E8N A;  5K19 A;  1TBG A;  4QQE A;  4BUJ C;  4O3U B;  4QRJ A;  1YR2 A;  3C99 A;  4J0W A;  5FKS A;  3GD1 I;  4J84 A;  2AGZ A;  2H47 A;  3FCU A;  5M5U A;  4PNK B;  1VYH C;  5I5I A;  2HU5 A;  3IJ0 A;  4ES0 A;  5C86 A;  3CIK B;  4PSX B;  3BG0 A;  5FKR A;  2AH0 A;  3VH0 A;  5IT9 g;  1SQJ A;  5EML B;  4WK2 A;  1O6F A;  3EI2 A;  3VA6 A;  1K32 A;  4Z7N A;  3GFC A;  3SBQ A;  4AOW A;  3IJC A;  4K3J B;  3T3M A;  2HU8 A;  3KRW B;  4BH6 A;  3MUN A;  3C9C A;  3OL2 A;  4NAA A;  3UVL A;  2XL3 A;  3MVD K;  2UZY B;  2QXV A;  1MG3 A;  4HDJ A;  4FA1 D;  5C92 A;  2J55 H;  4J8B A;  1GP2 B;  2YMU A;  4O1Q D;  4A11 A;  3JAM g;  4FA9 D;  1R5M A;  4A0A A;  2OVR B;  3JRO A;  4E5Z A;  2QR5 A;  1PBY B;  4XYI A;  2Q7Q A;  3PXT D;  1P22 A;  5E6R A;  1JMX B;  3T3P A;  3AFC A;  2CE8 A;  2B5L A;  3B7F A;  2EIB A;  2O9K A;  3QHY B;  2W18 A;  4LG8 A;  3IUQ A;  3EI1 B;  4JHN A;  4CY5 A;  4WK4 A;  2CO0 A;  4Y5R D;  4I79 A;  4JSV C;  3U4Y A;  3EMH A;  3I7H A;  3OKW A;  2CE9 A;  3DDU A;  3IUL A;  3IKO A;  5IC7 A;  3IIY A;  5CXB A;  2H68 A;  1S4U X;  4U1E I;  5CXB B;  2EBS A;  1PEV A;  5H17 A;  4PSW B;  4J87 A;  2TRC B;  3MZL A;  5M5S A;  2J56 H;  4H5I A;  4K3I D;  1JV2 A;  1JMZ B;  4OZU A;  1N6E A;  2H6K A;  1XHM A;  5AFU 3;  3O4I A;  4Z8L A;  4BCB A;  3F3P A;  2OIZ A;  3V4V A;  3K27 A;  4J8G A;  5M61 A;  3O4H A;  4FAN D;  5EAP A;  3CFS B;  5THA A;  4E5Z B;  4JSX C;  2XDW A;  2G9A A;  3EI4 B;  5CYK A;  5FFG A;  3V5W B;  4XYH A;  2GC7 A;  5KDO B;  3IIW A;  4AMY A;  3DSM A;  4GM3 A;  2AGW A;  4MMY A;  5FFO A;  4CI2 A;  4J0X A;  1K3I A;  4CC9 A;  3RLM D;  2Z2N A;  4OWR A;  4BP9 A;  2EIE A;  3DXK C;  2P9K C;  4WJK A;  4MMX A;  4ERQ A;  1QFS A;  1YFQ A;  5TF2 A;  3UVM A;  4J77 A;  1H2X A;  4JSP C;  3RSE C;  1C9L A;  3P4F A;  4BL0 A;  3EQ9 A;  1XKS A;  3IJE A;  3PXS D;  4J73 A;  5M5V A;  5TEE A;  4CI8 A;  4IMM A;  2I0T A;  2YNN A;  5TEF A;  3MXX A;  1A0R B;  3SWS D;  4GQ1 A;  3K26 A;  4ERZ A;  3SN6 B;  1UTC A;  1U4C A;  3SJL D;  4NSX A;  5HE3 B;  5AJA A;  3EI4 A;  3SVW D;  3NVQ A;  3GRE A;  4RE6 A;  3EQ8 A;  2AGY A;  4L9O A;  2BKL A;  4UI9 R;  2PM6 B;  3DM0 A;  3JZG A;  4D6V A;  3FM0 A;  5HE0 B;  3SLE D;  1NR0 A;  2QC5 A;  3SBP A;  4FHL A;  4YVD A;  3CFV A;  3VI3 A;  3I7L A;  4RE5 A;  2P9N C;  2OJY A;  2P9S C;  4G1E A;  1QFM A;  4ESG A;  3UR4 A;  3MKS B;  1JJU B;  4BCC A;  3RN1 D;  5IJ8 E;  4NEN A;  2VDR A;  2XE4 A;  3FCS A;  3I2N A;  3ZDX A;  5EMJ B;  4AMZ A;  4Y7R A;  3AL9 A;  3EI3 B;  3MUO A;  4GGA A;  3RRM C;  4JSN C;  3AH8 B;  3BG1 A;  3EI1 A;  3SFZ A;  1QNI A; 
#chains in the Genus database with same CATH homology
 3J80 g;  5C2V B;  5GXH A;  4GQB B;  4CY1 A;  3L4M D;  2Z2P A;  2XYI A;  1SHY B;  3JPX A;  4A11 B;  3SCY A;  4X60 B;  2H9M A;  4CZX A;  1QNI A;  2Z2O A;  1B9X A;  3EI3 A;  4CY2 A;  4ERY A;  2H3X A;  2XL2 A;  2IWF A;  3N0E A;  5C9Z B;  3UKR C;  3IJ1 A;  2OK4 A;  4A2L A;  4MK0 B;  4A0B B;  4X63 B;  5B4W A;  2MTA H;  3C75 H;  3F3F A;  4FB1 D;  2CNX A;  4GM9 A;  3EG6 A;  1GOT B;  5FXY A;  5SXM A;  2PM9 A;  5HE1 B;  3MMY A;  2YNO A;  1MG2 A;  5I5J A;  2AQ5 A;  4ZOV A;  2H6Q A;  3DWL C;  1SQ9 A;  4LGN A;  3FGB A;  4KFM B;  5H1M A;  3RMZ D;  4LG9 A;  3I89 A;  1L0Q A;  2H9L A;  2PM9 B;  5CXC A;  2OK6 A;  5CXC B;  5GXI A;  2IUV A;  2HKR A;  4JT6 C;  4QL1 A;  3PSL A;  3MKQ A;  4PBZ A;  5FQD A;  3KRX B;  3OKT A;  4O45 A;  4A0B A;  3ODT A;  2B5M A;  3I7P A;  1N6F A;  2GC4 A;  4TZ4 A;  4JXM A;  3JRP A;  5HE2 B;  2I0R A;  3NVN A;  3PSC B;  2J57 G;  4PXW A;  5EAM A;  1B9Y A;  1OLZ A;  4GM8 A;  2IWK A;  5EMK B;  2AGL A;  2IAA A;  4R7A B;  5CYK B;  4CI1 A;  2HES X;  4N14 A;  3UVO A;  1U2V C;  4CY3 A;  4FA4 D;  2B4E A;  3N0D A;  4JD2 C;  5FKT A;  4A2M A;  2HKM A;  5EAL A;  3L4O D;  3I7O A;  5EM2 B;  3PE7 A;  2PM7 B;  1RI6 A;  2GNQ A;  3I8E A;  2H13 A;  3UVK A;  2YBA A;  3ZWL B;  3A0F A;  4ZOZ A;  4A09 A;  3OKY A;  4EWR A;  3RFG A;  2HXC A;  4ZN4 A;  5A2Q g;  2H6N A;  2HYE A;  2H9P A;  3BWS A;  5EMM B;  3FRX A;  1ERJ A;  4A08 A;  4GGC A;  3ULE C;  5C2W B;  2G99 A;  4G56 B;  5HQG A;  2AH1 A;  4A09 B;  1K8K C;  4IA9 A;  4FAV D;  1FWX A;  1NEX B;  2P9L C;  4GZ8 A;  5IJ7 E;  1N6D A;  3RN0 D;  4GMB A;  5EM2 A;  3SHF A;  3SBR A;  2BBK H;  4PBY A;  3V9F A;  4JT5 C;  4A7J A;  3PVU B;  5EAR A;  2CO0 C;  3OL2 B;  2OVQ B;  4U7A A;  1PI6 A;  3HFQ A;  3ORV D;  5IGQ A;  3EI2 B;  5I5M A;  3F3G A;  3EWE A;  4CI3 A;  5AMS A;  2H14 A;  4L1Q D;  3OW8 A;  3SXT D;  4CZY A;  3SMR A;  1GG2 B;  4PC0 A;  4J78 A;  5FA5 B;  4QT8 A;  3NVX A;  4GQ2 P;  3I7N A;  2IUP A;  3RFH A;  3AL8 A;  1PGU A;  5FKQ A;  5H14 A;  2P9U C;  2UZX B;  5GSA A;  3V7D B;  3DXM C;  2YB8 B;  2AGX A;  3MZK A;  3AL8 B;  2IUR A;  4XEI C;  4O3T B;  1GXR A;  3UVN A;  2B5N A;  3JZH A;  2I3T A;  5IGO A;  4L3G D;  4L3H D;  4D0K A;  5GMK n;  3I8C A;  3E0C A;  3EU7 A;  1JOF A;  2IUQ A;  3PVW B;  2CN2 A;  3VGZ A;  1TYQ C;  3UKU C;  2OVP B;  4J82 A;  5HYN B;  2BCJ B;  4E54 B;  3JB9 L;  4O9D A;  4X3E A;  4GGD A;  2XU7 A;  3I7K A;  2CN3 A;  5FLX g;  4J86 A;  1MDA H;  4ZOY A;  4AEZ A;  4FA5 D;  4E54 A;  3W15 A;  1Q47 A;  2H9N A;  2HJ4 A;  5TDH B;  3PXW D;  2P9I C;  4A08 B;  4ZOX A;  4H5J A;  4FWW A;  3JZN A;  2HJB A;  5JWZ A;  5K1C C;  3OKY B;  2PBI B;  1OMW B;  4A0A B;  3C5M A;  2YNP A;  3J81 g;  1XIP A;  2P9P C;  3OTT A;  2I3S A;  4CZV A;  4J81 A;  4X61 B;  2I0S A;  5K19 A;  1TBG A;  4QQE A;  4BUJ C;  4O3U B;  4QRJ A;  3C99 A;  4J0W A;  5FKS A;  4J84 A;  2H47 A;  2AGZ A;  4PNK B;  1VYH C;  5I5I A;  3IJ0 A;  4ES0 A;  3CIK B;  4PSX B;  3BG0 A;  5FKR A;  2AH0 A;  3VH0 A;  5IT9 g;  1SQJ A;  5EML B;  3EI2 A;  3VA6 A;  1K32 A;  3GFC A;  3SBQ A;  4AOW A;  3IJC A;  4K3J B;  3KRW B;  4BH6 A;  3C9C A;  3OL2 A;  3UVL A;  2XL3 A;  2UZY B;  2QXV A;  1MG3 A;  4HDJ A;  4FA1 D;  2J55 H;  4J8B A;  1GP2 B;  2YMU A;  4O1Q D;  4A11 A;  3JAM g;  4FA9 D;  1R5M A;  4A0A A;  2OVR B;  3JRO A;  4E5Z A;  4XYI A;  1PBY B;  2Q7Q A;  3PXT D;  1P22 A;  1JMX B;  3AFC A;  2CE8 A;  2B5L A;  3B7F A;  2O9K A;  2W18 A;  4LG8 A;  3EI1 B;  4CY5 A;  2CO0 A;  4Y5R D;  4I79 A;  4JSV C;  3U4Y A;  3EMH A;  3I7H A;  3OKW A;  2CE9 A;  3IKO A;  5IC7 A;  3IIY A;  5CXB A;  2H68 A;  1S4U X;  4U1E I;  5CXB B;  2EBS A;  1PEV A;  5H17 A;  4PSW B;  4J87 A;  2TRC B;  3MZL A;  2J56 H;  4H5I A;  4K3I D;  1JMZ B;  4OZU A;  1N6E A;  2H6K A;  1XHM A;  5AFU 3;  4Z8L A;  3F3P A;  2OIZ A;  3K27 A;  4J8G A;  4FAN D;  5EAP A;  3CFS B;  5THA A;  4E5Z B;  4JSX C;  2G9A A;  3EI4 B;  5CYK A;  3V5W B;  4XYH A;  2GC7 A;  5KDO B;  3IIW A;  3DSM A;  4GM3 A;  2AGW A;  4CI2 A;  4J0X A;  4CC9 A;  3RLM D;  2Z2N A;  4OWR A;  3DXK C;  2P9K C;  4ERQ A;  5TF2 A;  1YFQ A;  3UVM A;  4J77 A;  4JSP C;  3RSE C;  3P4F A;  4BL0 A;  1XKS A;  3PXS D;  4J73 A;  5TEE A;  4CI8 A;  4IMM A;  2I0T A;  2YNN A;  5TEF A;  3MXX A;  1A0R B;  3SWS D;  4GQ1 A;  3K26 A;  4ERZ A;  3SN6 B;  1U4C A;  3SJL D;  4NSX A;  5HE3 B;  5AJA A;  3EI4 A;  3SVW D;  3NVQ A;  3GRE A;  2AGY A;  4L9O A;  4UI9 R;  2PM6 B;  3DM0 A;  3JZG A;  4D6V A;  3FM0 A;  5HE0 B;  3SLE D;  1NR0 A;  2QC5 A;  3SBP A;  4FHL A;  4YVD A;  3CFV A;  3I7L A;  2P9N C;  2OJY A;  2P9S C;  4ESG A;  3UR4 A;  3MKS B;  1JJU B;  3RN1 D;  5IJ8 E;  3I2N A;  5EMJ B;  4Y7R A;  3AL9 A;  3EI3 B;  3RRM C;  4GGA A;  4JSN C;  3AH8 B;  3BG1 A;  3EI1 A;  3SFZ A;  4J79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...