3EWEA

Crystal structure of the nup85/seh1 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
337
structure length
255
Chain Sequence
VHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVSDFCLSWCPSPEKLAVSALEQAIIYQRLHVAAKLPGHKSLIRSISWAPSYQLIATGCKDGRIRIFKITENLQVELLSGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport,structural protein
molecule keywords Nucleoporin SEH1
publication title Structural evidence for common ancestry of the nuclear pore complex and vesicle coats.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 31
structure length 255
sequence length 337
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3eweA01
4ZOYA 3SJLD 3K26A 4PXWA 2AGZA 3IIYA 3EI4B 3OKYB 4TZ4A 2Z2NA 5HYNB 4J87A 3I7NA 3SHFA 1XHMA 3UVNA 4A0BA 4LG9A 2PM7B 2XL3A 3L4MD 2I0RA 4GGAA 3SXTD 3CIKB 4J8GA 3ORVD 4LGNA 2CO0A 2P9PC 3HFQA 2IWFA 3MXXA 2I3SA 3AL8A 3EMHA 1XIPA 4BL0A 4J0WA 1VYHC 3L4OD 4E54A 4E5ZA 2UZYB 3I8EA 4JSNC 4X60B 4ERYA 3VH0A 2OK6A 1K32A 4X61B 3EI2A 2XL2A 3EI3A 2G99A 4L3GD 5CXCA 1P22A 5GXIA 3V9FA 4XEIC 2BBKH 3SBPA 5B4WA 3EG6A 3N0EA 2J57G 3C9CA 3B7FA 5HE3B 3PXWD 5GXHA 2H6NA 2UZXB 4A0BB 3OL2B 4PC0A 2I0SA 3RLMD 5EMLB 5AMSA 2P9KC 2IAAA 4JSPC 3J81g 3P4FA 3AL8B 4BUJC 3F3GA 1N6FA 1GG2B 4BH6A 4U7AA 4H5IA 4A7JA 4ES0A 2IUVA 2HKMA 4E54B 4GGCA 2HXCA 2J56H 4J82A 2P9NC 4JD2C 4CY1A 1U4CA 4A2LA 5AJAA 4J77A 4YVDA 2P9LC 3UKUC 2YBAA 2IURA 2OVRB 3UKRC 5SXMA 2IUPA 1R5MA 3EI3B 2OVQB 4A11B 3SCYA 2H68A 5IC7A 5CXCB 2B5NA 3MMYA 3I7PA 1QNIA 5EM2A 2H3XA 3A0FA 5HE2B 4PSWB 1OMWB 1TYQC 5FKTA 5FXYA 5JWZA 1JMXB 1JOFA 3PSLA 3VGZA 1PBYB 3AL9A 4FWWA 5FQDA 4NSXA 3C99A 3JPXA 5H17A 4A0AA 3NVNA 5HE1B 2YNOA 2Z2OA 4ZN4A 1N6DA 4CI8A 1B9XA 2AH1A 3FM0A 4A2MA 4Z8LA 4J86A 1S4UX 3AFCA 4L3HD 2AGXA 3SN6B 3SWSD 3KRXB 2H9NA 2GNQA 2HESX 4GGDA 4JXMA 1GOTB 4CZYA 4K3JB 4PBZA 4OWRA 4OZUA 3DM0A 4PBYA 1YFQA 2AQ5A 5THAA 3PXTD 2QXVA 4GM3A 5AFU3 1RI6A 2I3TA 5EM2B 4A08A 5GMKn 3PVUB 3OL2A 1PEVA 4O3UB 4J81A 3UR4A 5H1MA 3SVWD 3IJ1A 1OLZA 1L0QA 3JZGA 3RN1D 2OVPB 3DSMA 4GQ1A 4A0AB 3DXMC 1FWXA 3SMRA 2AGWA 2B5LA 4A09B 5KDOB 3RSEC 4QRJA 3PE7A 3GREA 5EARA 5TEFA 4XYHA 4A11A 3AH8B 2QC5A 5HE0B 2B4EA 2CNXA 4IA9A 3J80g 3SFZA 4KFMB 3KRWB 3E0CA 4A08B 4X3EA 3NVXA 2YNPA 5I5JA 2H14A 2Q7QA 3C75H 5K19A 2OK4A 4CZXA 3RMZD 2EBSA 1Q47A 2Z2PA 4J0XA 2TRCB 3VA6A 4O1QD 4Y7RA 4FA4D 5FA5B 4J8BA 3ULEC 2PM9B 2CE9A 1NR0A 3EU7A 5FKRA 2H9LA 4J79A 4JT5C 5GSAA 1JMZB 3F3PA 2H47A 1B9YA 3SBQA 4ERQA 1SQ9A 5C2WB 4Y5RD 3I89A 4GMBA 3I2NA 4ESGA 4G56B 5I5MA 4U1EI 5IGQA 3BG1A 4L9OA 4PSXB 3IJCA 5EAMA 2AGYA 4XYIA 1XKSA 4LG8A 4AOWA 3F3FA 3MZLA 4JT6C 4A09A 3GFCA 4I79A 2HJ4A 1N6EA 2XYIA 4O45A 3V5WB 3JAMg 4J73A 2HJBA 3RFGA 4GZ8A 4J78A 4ZOVA 4FA1D 4JSVC 4CC9A 4ERZA 4O3TB 3N0DA 5TF2A 5EMKB 3V7DB 2CN2A 2AH0A 1MG3A 2H13A 2OIZA 3K27A 3RRMC 3NVQA 4JSXC 3EI1A 1ERJA 4CI2A 3IJ0A 5K1CC 4FB1D 3W15A 5I5IA 4FAND 3RN0D 3UVOA 3CFVA 2YB8B 5TDHB 1MDAH 2IWKA 3OW8A 2BCJB 1PI6A 2W18A 5EMMB 4FA5D 5EMJB 3UVKA 3I7LA 1SHYB 1GXRA 4D6VA 5A2Qg 3JZNA 4O9DA 5EAPA 5IJ8E 2PM9A 3U4YA 3FRXA 2YNNA 2MTAH 2H9PA 4GM9A 4QT8A 4CI3A 3ODTA 3JROA 4J84A 2B5MA 5EALA 1K8KC 3MKSB 1SQJA 2YMUA 5FKSA 1PGUA 5CXBA 4GM8A 4IMMA 5FLXg 3JRPA 4R7AB 4EWRA 3CFSB 3EI1B 3SLED 3FGBA 4UI9R 4QQEA 2CO0C 1MG2A 2H9MA 2GC4A 2H6QA 1U2VC 4MK0B 5IT9g 4CY3A 4FA9D 2HKRA 3OKTA 3C5MA 5IGOA 4H5JA 2O9KA 2J55H 2PBIB 5CYKA 5C2VB 5IJ7E 5HQGA 2PM6B 5C9ZB 4GQBB 2HYEA 4HDJA 4QL1A 3PXSD 3RFHA 5H14A 3BG0A 3UVLA 4CY2A 5FKQA 4E5ZB 1TBGA 2P9UC 4N14A 2GC7A 2IUQA 5CXBB 4AEZA 4CY5A 3IKOA 2I0TA 3PVWB 4K3ID 4PNKB 3IIWA 3EWEA 3EI2B 1GP2B 3ZWLB 3BWSA 4FHLA 3MZKA 2G9AA 1NEXB 3SBRA 5TEEA 3I7HA 2CE8A 3EI4A 3OKYA 3OTTA 2AGLA 2OJYA 3JB9L 3DWLC 1JJUB 4ZOXA 4ZOZA 4FAVD 2P9IC 4CI1A 3I8CA 3DXKC 1A0RB 2P9SC 5CYKB 4GQ2P 2CN3A 4X63B 2H6KA 3MKQA 3I7KA 3PSCB 2XU7A 3UVMA 3I7OA 4D0KA 3OKWA 4CZVA 3JZHA 4L1QD
chains in the Genus database with same CATH superfamily
1VE7A 4ZOYA 5HDBA 3SJLD 2VDNA 1VZ3A 3K26A 4WK0A 4PXWA 2AGZA 4G1EA 1I2MB 3IIYA 3EI4B 1H2YA 3OKYB 4Z7QA 4Z7OA 4TZ4A 2Z2NA 1O6GA 4J87A 5HYNB 4Z7NA 3I7NA 3SHFA 1XHMA 1E5TA 3UVNA 4A0BA 3V4VA 4LG9A 5FFGA 1C9IA 2PM7B 2XL3A 2I0RA 3L4MD 4GGAA 3SXTD 3CIKB 4J8GA 3ORVD 4LGNA 2CO0A 2P9PC 3HFQA 2IWFA 3MXXA 2I3SA 3AL8A 3EMHA 1XIPA 2EICA 4BL0A 2WQ8A 4J0WA 1VYHC 3L4OD 4E54A 4E5ZA 2UZYB 3I8EA 4JSNC 4X60B 3T3PA 4ERYA 3VH0A 5C86A 2OK6A 1K32A 4X61B 3EI2A 2XL2A 3EI3A 2G99A 2HU7A 5E6RA 4L3GD 5CXCA 5E6SA 1P22A 5GXIA 3V9FA 4XEIC 4DNVA 2BBKH 3NIDA 3SBPA 5B4WA 3EG6A 3N0EA 2J57G 3C9CA 3FCUA 1UOQA 3B7FA 5HE3B 3PXWD 5GXHA 2H6NA 2UZXB 4A0BB 3OL2B 4PC0A 2I0SA 3RLMD 5EMLB 5AMSA 5M61A 3VI3A 2P9KC 2IAAA 1GOHA 4JSPC 3J81g 3P4FA 3AL8B 4BUJC 3F3GA 1N6FA 1GG2B 4BH6A 4U7AA 4H5IA 4A7JA 4ES0A 3O4IA 2IUVA 1K3IA 2HKMA 4BCBA 3IUMA 4E54B 4GGCA 2HXCA 2J56H 3NIFA 4J82A 2P9NC 4JD2C 4CY1A 1U4CA 4A2LA 5AJAA 4J77A 3T3MA 4YVDA 2P9LC 3UKUC 2YBAA 1UOOA 2IURA 2OVRB 3UKRC 5SXMA 2IUPA 1R5MA 3EI3B 2OVQB 5C92A 4A11B 3EQ8A 3SCYA 2H68A 5IC7A 5CXCB 2B5NA 3MMYA 3I7PA 1QNIA 5EM2A 3EQ7A 2H3XA 3MVDK 1M1XA 3A0FA 5HE2B 4PSWB 1OMWB 1TYQC 5FKTA 5FXYA 5JWZA 1JMXB 1JOFA 3IUJA 1C9LA 3PSLA 3VGZA 1PBYB 3AL9A 4FWWA 5FQDA 4NSXA 3C99A 5E6UA 3JPXA 5H17A 4D9SA 4A0AA 3NVNA 5HE1B 2YNOA 2Z2OA 3IUQA 1N6DA 4ZN4A 4CI8A 1B9XA 2AH1A 3FM0A 4A2MA 4RE6A 4Z8LA 4J86A 1S4UX 3AFCA 3ZDZA 4L3HD 1VE6A 2AGXA 3SN6B 3SWSD 3KRXB 2H9NA 2GNQA 2HESX 4GGDA 4JXMA 1GOTB 4CZYA 1BPOA 4NENA 4K3JB 4PBZA 1H2ZA 4OWRA 4NAAA 4OZUA 3DM0A 4PBYA 1YFQA 4AN1A 2AQ5A 5THAA 3PXTD 2QXVA 4GM3A 5AFU3 1RI6A 2I3TA 5EM2B 4A08A 5GMKn 3PVUB 1H2WA 3OL2A 1PEVA 4MMXA 1A12A 4O3UB 1GOFA 4J81A 3UR4A 5M5SA 5H1MA 3SVWD 3IJ1A 1OLZA 3QHYB 1L0QA 2XDWA 3JZGA 3RN1D 2OVPB 3IURA 3DSMA 2VC2A 4GQ1A 3V4PA 4WJKA 4A0AB 3DXMC 1FWXA 3SMRA 3KCIA 2AGWA 4BCCA 2B5LA 4A09B 5KDOB 3RSEC 4QRJA 3PE7A 3GREA 3ZE1A 5EARA 5TEFA 2HU5A 4XYHA 1JV2A 4A11A 3AH8B 3IVMA 2QC5A 2VDLA 5HE0B 1GOGA 1QFMA 2B4EA 2CNXA 2XE4A 3ZE2A 3OF7A 4IA9A 3J80g 3SFZA 4KFMB 3KRWB 3E0CA 5M5UA 4DNWA 4A08B 4X3EA 3NVXA 1E8MA 1O6FA 2YNPA 3MUNA 5I5JA 1QFSA 3DDUA 2H14A 2Q7QA 3O4GA 3C75H 5K19A 2OK4A 4CZXA 3RMZD 2EBSA 1Q47A 2Z2PA 4JHNA 3IULA 4J0XA 2TRCB 2VZ3A 3VA6A 4O1QD 4Y7RA 4FA4D 4G55A 5FA5B 4J8BA 3ULEC 3ZDXA 2PM9B 2CE9A 1NR0A 3EU7A 5FKRA 2H9LA 1T2XA 4J79A 4JT5C 5GSAA 1JMZB 3F3PA 2H47A 1B9YA 3SBQA 4ERQA 1SQ9A 5C2WB 4Y5RD 4WK2A 2VDPA 3I89A 4GMBA 4MMZA 4WK4A 3I2NA 4AX4A 4ESGA 4G56B 5I5MA 4U1EI 5IGQA 3BG1A 4BP8A 2VDKA 1TYEA 4L9OA 4PSXB 3IJCA 5EAMA 2AGYA 2EIEA 4XYIA 1XKSA 3K71A 4LG8A 4AOWA 3F3FA 3MZLA 4JT6C 4A09A 3GFCA 4I79A 2HJ4A 3EQ9A 1N6EA 2XYIA 4O45A 5M5VA 3V5WB 3JAMg 3K72A 4J73A 2HJBA 3RFGA 4GZ8A 2XZGA 4J78A 4ZOVA 4FA1D 4JSVC 4CC9A 4ERZA 4O3TB 3N0DA 5TF2A 5EMKB 3V7DB 2CN2A 4BCDA 4BP9A 2AH0A 2VDMA 1MG3A 2H13A 2OIZA 3MUOA 3K27A 3RRMC 3NVQA 3K6SA 4JSXC 3EI1A 1ERJA 5M5TA 4AMYA 4CI2A 3IJ0A 5K1CC 4UM9A 3W15A 4FB1D 5I5IA 3NIGA 4FAND 3RN0D 3UVOA 3CFVA 2YB8B 5TDHB 1MDAH 2EIBA 2IWKA 3OW8A 2BCJB 1PI6A 2W18A 5EMMB 3GC3B 2HU8A 4FA5D 1VZ2A 5EMJB 3UVKA 3I7LA 1SHYB 1GXRA 4D6VA 5A2Qg 3JZNA 4O9DA 5EAPA 5IJ8E 2PM9A 3U4YA 4O2WA 3ZDYA 3ZE0A 3FRXA 2YNNA 2MTAH 2H9PA 4GM9A 4QT8A 4CI3A 3ODTA 3JROA 4J84A 2B5MA 5EALA 1K8KC 3MKSB 1SQJA 2YMUA 3GD1I 5FKSA 3IJEA 1PGUA 5CXBA 4GM8A 4IMMA 5FLXg 1E8NA 3JRPA 4R7AB 1U8CA 4EWRA 3CFSB 4AN0A 1UTCA 3EI1B 3SLED 3FGBA 4UI9R 1H2XA 4QQEA 2CO0C 1MG2A 2H9MA 2VZ1A 2GC4A 3VI4A 2H6QA 2VDOA 1U2VC 4MK0B 4L1MA 5IT9g 4CY3A 4FA9D 2HKRA 3OKTA 3C5MA 2VDRA 4NC4A 5IGOA 2JKXA 4H5JA 4RE5A 2O9KA 3IUNA 2J55H 2PBIB 5CYKA 5C2VB 5IJ7E 5FFOA 5HQGA 2PM6B 4NBMA 5C9ZB 4GQBB 2HYEA 4AMZA 2EIDA 4HDJA 2QR5A 1JTDB 4QL1A 3PXSD 3RFHA 5H14A 3BG0A 3UVLA 4CY2A 5FKQA 4G1MA 4E5ZB 1TBGA 2P9UC 4N14A 2GC7A 2IUQA 5CXBB 4AEZA 4CY5A 3IKOA 2I0TA 3PVWB 4K3ID 4PNKB 3IIWA 3EWEA 5M5RA 3EI2B 1GP2B 3ZWLB 3BWSA 4FHLA 3MZKA 2G9AA 1NEXB 3SBRA 3FCSA 3QI0A 5TEEA 3I7HA 2CE8A 3EI4A 3OKYA 3OTTA 2VDQA 2AGLA 4IRZA 4DNUA 2OJYA 3JB9L 3DWLC 1UOPA 1JJUB 3O4HA 4ZOXA 2BKLA 4ZOZA 4FAVD 2P9IC 4CI1A 3I8CA 3DXKC 1A0RB 2P9SC 4JHPC 4MMYA 5CYKB 4GQ2P 2CN3A 4UM8A 4X63B 4QAMA 2H6KA 3MKQA 3O4JA 3I7KA 3PSCB 1YR2A 2XU7A 2QZPA 3UVMA 3I7OA 4D0KA 4O02A 3OKWA 4CZVA 3JZHA 4L1QD 1L5GA
chains in the Genus database with same CATH topology
4ZOYA 3SJLD 3K26A 4PXWA 2AGZA 3IIYA 3EI4B 3OKYB 4TZ4A 2Z2NA 5HYNB 4J87A 3I7NA 3SHFA 1XHMA 3UVNA 4A0BA 4LG9A 2PM7B 2XL3A 3L4MD 2I0RA 4GGAA 3SXTD 3CIKB 4J8GA 3ORVD 4LGNA 2CO0A 2P9PC 3HFQA 2IWFA 3MXXA 2I3SA 3AL8A 3EMHA 1XIPA 4BL0A 4J0WA 1VYHC 3L4OD 4E54A 4E5ZA 2UZYB 3I8EA 4JSNC 4X60B 4ERYA 3VH0A 2OK6A 1K32A 4X61B 3EI2A 2XL2A 3EI3A 2G99A 4L3GD 5CXCA 1P22A 5GXIA 3V9FA 4XEIC 2BBKH 3SBPA 5B4WA 3EG6A 3N0EA 2J57G 3C9CA 3B7FA 5HE3B 3PXWD 5GXHA 2H6NA 2UZXB 4A0BB 3OL2B 4PC0A 2I0SA 3RLMD 5EMLB 5AMSA 2P9KC 2IAAA 4JSPC 3J81g 3P4FA 3AL8B 4BUJC 3F3GA 1N6FA 1GG2B 4BH6A 4U7AA 4H5IA 4A7JA 4ES0A 2IUVA 2HKMA 4E54B 4GGCA 2HXCA 2J56H 4J82A 2P9NC 4JD2C 4CY1A 1U4CA 4A2LA 5AJAA 4J77A 4YVDA 2P9LC 3UKUC 2YBAA 2IURA 2OVRB 3UKRC 5SXMA 2IUPA 1R5MA 3EI3B 2OVQB 4A11B 3SCYA 2H68A 5IC7A 5CXCB 2B5NA 3MMYA 3I7PA 1QNIA 5EM2A 2H3XA 3A0FA 5HE2B 4PSWB 1OMWB 1TYQC 5FKTA 5FXYA 5JWZA 1JMXB 1JOFA 3PSLA 3VGZA 1PBYB 3AL9A 4FWWA 5FQDA 4NSXA 3C99A 3JPXA 5H17A 4A0AA 3NVNA 5HE1B 2YNOA 2Z2OA 4ZN4A 1N6DA 4CI8A 1B9XA 2AH1A 3FM0A 4A2MA 4Z8LA 4J86A 1S4UX 3AFCA 4L3HD 2AGXA 3SN6B 3SWSD 3KRXB 2H9NA 2GNQA 2HESX 4GGDA 4JXMA 1GOTB 4CZYA 4K3JB 4PBZA 4OWRA 4OZUA 3DM0A 4PBYA 1YFQA 2AQ5A 5THAA 3PXTD 2QXVA 4GM3A 5AFU3 1RI6A 2I3TA 5EM2B 4A08A 5GMKn 3PVUB 3OL2A 1PEVA 4O3UB 4J81A 3UR4A 5H1MA 3SVWD 3IJ1A 1OLZA 1L0QA 3JZGA 3RN1D 2OVPB 3DSMA 4GQ1A 4A0AB 3DXMC 1FWXA 3SMRA 2AGWA 2B5LA 4A09B 5KDOB 3RSEC 4QRJA 3PE7A 3GREA 5EARA 5TEFA 4XYHA 4A11A 3AH8B 2QC5A 5HE0B 2B4EA 2CNXA 4IA9A 3J80g 3SFZA 4KFMB 3KRWB 3E0CA 4A08B 4X3EA 3NVXA 2YNPA 5I5JA 2H14A 2Q7QA 3C75H 5K19A 2OK4A 4CZXA 3RMZD 2EBSA 1Q47A 2Z2PA 4J0XA 2TRCB 3VA6A 4O1QD 4Y7RA 4FA4D 5FA5B 4J8BA 3ULEC 2PM9B 2CE9A 1NR0A 3EU7A 5FKRA 2H9LA 4J79A 4JT5C 5GSAA 1JMZB 3F3PA 2H47A 1B9YA 3SBQA 4ERQA 1SQ9A 5C2WB 4Y5RD 3I89A 4GMBA 3I2NA 4ESGA 4G56B 5I5MA 4U1EI 5IGQA 3BG1A 4L9OA 4PSXB 3IJCA 5EAMA 2AGYA 4XYIA 1XKSA 4LG8A 4AOWA 3F3FA 3MZLA 4JT6C 4A09A 3GFCA 4I79A 2HJ4A 1N6EA 2XYIA 4O45A 3V5WB 3JAMg 4J73A 2HJBA 3RFGA 4GZ8A 4J78A 4ZOVA 4FA1D 4JSVC 4CC9A 4ERZA 4O3TB 3N0DA 5TF2A 5EMKB 3V7DB 2CN2A 2AH0A 1MG3A 2H13A 2OIZA 3K27A 3RRMC 3NVQA 4JSXC 3EI1A 1ERJA 4CI2A 3IJ0A 5K1CC 4FB1D 3W15A 5I5IA 4FAND 3RN0D 3UVOA 3CFVA 2YB8B 5TDHB 1MDAH 2IWKA 3OW8A 2BCJB 1PI6A 2W18A 5EMMB 4FA5D 5EMJB 3UVKA 3I7LA 1SHYB 1GXRA 4D6VA 5A2Qg 3JZNA 4O9DA 5EAPA 5IJ8E 2PM9A 3U4YA 3FRXA 2YNNA 2MTAH 2H9PA 4GM9A 4QT8A 4CI3A 3ODTA 3JROA 4J84A 2B5MA 5EALA 1K8KC 3MKSB 1SQJA 2YMUA 5FKSA 1PGUA 5CXBA 4GM8A 4IMMA 5FLXg 3JRPA 4R7AB 4EWRA 3CFSB 3EI1B 3SLED 3FGBA 4UI9R 4QQEA 2CO0C 1MG2A 2H9MA 2GC4A 2H6QA 1U2VC 4MK0B 5IT9g 4CY3A 4FA9D 2HKRA 3OKTA 3C5MA 5IGOA 4H5JA 2O9KA 2J55H 2PBIB 5CYKA 5C2VB 5IJ7E 5HQGA 2PM6B 5C9ZB 4GQBB 2HYEA 4HDJA 4QL1A 3PXSD 3RFHA 5H14A 3BG0A 3UVLA 4CY2A 5FKQA 4E5ZB 1TBGA 2P9UC 4N14A 2GC7A 2IUQA 5CXBB 4AEZA 4CY5A 3IKOA 2I0TA 3PVWB 4K3ID 4PNKB 3IIWA 3EWEA 3EI2B 1GP2B 3ZWLB 3BWSA 4FHLA 3MZKA 2G9AA 1NEXB 3SBRA 5TEEA 3I7HA 2CE8A 3EI4A 3OKYA 3OTTA 2AGLA 2OJYA 3JB9L 3DWLC 1JJUB 4ZOXA 4ZOZA 4FAVD 2P9IC 4CI1A 3I8CA 3DXKC 1A0RB 2P9SC 5CYKB 4GQ2P 2CN3A 4X63B 2H6KA 3MKQA 3I7KA 3PSCB 2XU7A 3UVMA 3I7OA 4D0KA 3OKWA 4CZVA 3JZHA 4L1QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZOY A;  3SJL D;  3K26 A;  4PXW A;  2AGZ A;  3IIY A;  3EI4 B;  3OKY B;  4TZ4 A;  2Z2N A;  5HYN B;  4J87 A;  3I7N A;  3SHF A;  1XHM A;  3UVN A;  4A0B A;  4LG9 A;  2PM7 B;  2XL3 A;  3L4M D;  2I0R A;  4GGA A;  3SXT D;  3CIK B;  4J8G A;  3ORV D;  4LGN A;  2CO0 A;  2P9P C;  3HFQ A;  2IWF A;  3MXX A;  2I3S A;  3AL8 A;  3EMH A;  1XIP A;  4BL0 A;  4J0W A;  1VYH C;  3L4O D;  4E54 A;  4E5Z A;  2UZY B;  3I8E A;  4JSN C;  4X60 B;  4ERY A;  3VH0 A;  2OK6 A;  1K32 A;  4X61 B;  3EI2 A;  2XL2 A;  3EI3 A;  2G99 A;  4L3G D;  5CXC A;  1P22 A;  5GXI A;  3V9F A;  4XEI C;  2BBK H;  3SBP A;  5B4W A;  3EG6 A;  3N0E A;  2J57 G;  3C9C A;  3B7F A;  5HE3 B;  3PXW D;  5GXH A;  2H6N A;  2UZX B;  4A0B B;  3OL2 B;  4PC0 A;  2I0S A;  3RLM D;  5EML B;  5AMS A;  2P9K C;  2IAA A;  4JSP C;  3J81 g;  3P4F A;  3AL8 B;  4BUJ C;  3F3G A;  1N6F A;  1GG2 B;  4BH6 A;  4U7A A;  4H5I A;  4A7J A;  4ES0 A;  2IUV A;  2HKM A;  4E54 B;  4GGC A;  2HXC A;  2J56 H;  4J82 A;  2P9N C;  4JD2 C;  4CY1 A;  1U4C A;  4A2L A;  5AJA A;  4J77 A;  4YVD A;  2P9L C;  3UKU C;  2YBA A;  2IUR A;  2OVR B;  3UKR C;  5SXM A;  2IUP A;  1R5M A;  3EI3 B;  2OVQ B;  4A11 B;  3SCY A;  2H68 A;  5IC7 A;  5CXC B;  2B5N A;  3MMY A;  3I7P A;  1QNI A;  5EM2 A;  2H3X A;  3A0F A;  5HE2 B;  4PSW B;  1OMW B;  1TYQ C;  5FKT A;  5FXY A;  5JWZ A;  1JMX B;  1JOF A;  3PSL A;  3VGZ A;  1PBY B;  3AL9 A;  4FWW A;  5FQD A;  4NSX A;  3C99 A;  3JPX A;  5H17 A;  4A0A A;  3NVN A;  5HE1 B;  2YNO A;  2Z2O A;  4ZN4 A;  1N6D A;  4CI8 A;  1B9X A;  2AH1 A;  3FM0 A;  4A2M A;  4Z8L A;  4J86 A;  1S4U X;  3AFC A;  4L3H D;  2AGX A;  3SN6 B;  3SWS D;  3KRX B;  2H9N A;  2GNQ A;  2HES X;  4GGD A;  4JXM A;  1GOT B;  4CZY A;  4K3J B;  4PBZ A;  4OWR A;  4OZU A;  3DM0 A;  4PBY A;  1YFQ A;  2AQ5 A;  5THA A;  3PXT D;  2QXV A;  4GM3 A;  5AFU 3;  1RI6 A;  2I3T A;  5EM2 B;  4A08 A;  5GMK n;  3PVU B;  3OL2 A;  1PEV A;  4O3U B;  4J81 A;  3UR4 A;  5H1M A;  3SVW D;  3IJ1 A;  1OLZ A;  1L0Q A;  3JZG A;  3RN1 D;  2OVP B;  3DSM A;  4GQ1 A;  4A0A B;  3DXM C;  1FWX A;  3SMR A;  2AGW A;  2B5L A;  4A09 B;  5KDO B;  3RSE C;  4QRJ A;  3PE7 A;  3GRE A;  5EAR A;  5TEF A;  4XYH A;  4A11 A;  3AH8 B;  2QC5 A;  5HE0 B;  2B4E A;  2CNX A;  4IA9 A;  3J80 g;  3SFZ A;  4KFM B;  3KRW B;  3E0C A;  4A08 B;  4X3E A;  3NVX A;  2YNP A;  5I5J A;  2H14 A;  2Q7Q A;  3C75 H;  5K19 A;  2OK4 A;  4CZX A;  3RMZ D;  2EBS A;  1Q47 A;  2Z2P A;  4J0X A;  2TRC B;  3VA6 A;  4O1Q D;  4Y7R A;  4FA4 D;  5FA5 B;  4J8B A;  3ULE C;  2PM9 B;  2CE9 A;  1NR0 A;  3EU7 A;  5FKR A;  2H9L A;  4J79 A;  4JT5 C;  5GSA A;  1JMZ B;  3F3P A;  2H47 A;  1B9Y A;  3SBQ A;  4ERQ A;  1SQ9 A;  5C2W B;  4Y5R D;  3I89 A;  4GMB A;  3I2N A;  4ESG A;  4G56 B;  5I5M A;  4U1E I;  5IGQ A;  3BG1 A;  4L9O A;  4PSX B;  3IJC A;  5EAM A;  2AGY A;  4XYI A;  1XKS A;  4LG8 A;  4AOW A;  3F3F A;  3MZL A;  4JT6 C;  4A09 A;  3GFC A;  4I79 A;  2HJ4 A;  1N6E A;  2XYI A;  4O45 A;  3V5W B;  3JAM g;  4J73 A;  2HJB A;  3RFG A;  4GZ8 A;  4J78 A;  4ZOV A;  4FA1 D;  4JSV C;  4CC9 A;  4ERZ A;  4O3T B;  3N0D A;  5TF2 A;  5EMK B;  3V7D B;  2CN2 A;  2AH0 A;  1MG3 A;  2H13 A;  2OIZ A;  3K27 A;  3RRM C;  3NVQ A;  4JSX C;  3EI1 A;  1ERJ A;  4CI2 A;  3IJ0 A;  5K1C C;  4FB1 D;  3W15 A;  5I5I A;  4FAN D;  3RN0 D;  3UVO A;  3CFV A;  2YB8 B;  5TDH B;  1MDA H;  2IWK A;  3OW8 A;  2BCJ B;  1PI6 A;  2W18 A;  5EMM B;  4FA5 D;  5EMJ B;  3UVK A;  3I7L A;  1SHY B;  1GXR A;  4D6V A;  5A2Q g;  3JZN A;  4O9D A;  5EAP A;  5IJ8 E;  2PM9 A;  3U4Y A;  3FRX A;  2YNN A;  2MTA H;  2H9P A;  4GM9 A;  4QT8 A;  4CI3 A;  3ODT A;  3JRO A;  4J84 A;  2B5M A;  5EAL A;  1K8K C;  3MKS B;  1SQJ A;  2YMU A;  5FKS A;  1PGU A;  5CXB A;  4GM8 A;  4IMM A;  5FLX g;  3JRP A;  4R7A B;  4EWR A;  3CFS B;  3EI1 B;  3SLE D;  3FGB A;  4UI9 R;  4QQE A;  2CO0 C;  1MG2 A;  2H9M A;  2GC4 A;  2H6Q A;  1U2V C;  4MK0 B;  5IT9 g;  4CY3 A;  4FA9 D;  2HKR A;  3OKT A;  3C5M A;  5IGO A;  4H5J A;  2O9K A;  2J55 H;  2PBI B;  5CYK A;  5C2V B;  5IJ7 E;  5HQG A;  2PM6 B;  5C9Z B;  4GQB B;  2HYE A;  4HDJ A;  4QL1 A;  3PXS D;  3RFH A;  5H14 A;  3BG0 A;  3UVL A;  4CY2 A;  5FKQ A;  4E5Z B;  1TBG A;  2P9U C;  4N14 A;  2GC7 A;  2IUQ A;  5CXB B;  4AEZ A;  4CY5 A;  3IKO A;  2I0T A;  3PVW B;  4K3I D;  4PNK B;  3IIW A;  3EWE A;  3EI2 B;  1GP2 B;  3ZWL B;  3BWS A;  4FHL A;  3MZK A;  2G9A A;  1NEX B;  3SBR A;  5TEE A;  3I7H A;  2CE8 A;  3EI4 A;  3OKY A;  3OTT A;  2AGL A;  2OJY A;  3JB9 L;  3DWL C;  1JJU B;  4ZOX A;  4ZOZ A;  4FAV D;  2P9I C;  4CI1 A;  3I8C A;  3DXK C;  1A0R B;  2P9S C;  5CYK B;  4GQ2 P;  2CN3 A;  4X63 B;  2H6K A;  3MKQ A;  3I7K A;  3PSC B;  2XU7 A;  3UVM A;  3I7O A;  4D0K A;  3OKW A;  4CZV A;  3JZH A;  4L1Q D; 
#chains in the Genus database with same CATH topology
 1VE7 A;  4ZOY A;  5HDB A;  3SJL D;  2VDN A;  1VZ3 A;  3K26 A;  4WK0 A;  4PXW A;  2AGZ A;  4G1E A;  1I2M B;  3IIY A;  3EI4 B;  1H2Y A;  3OKY B;  4Z7Q A;  4Z7O A;  4TZ4 A;  2Z2N A;  1O6G A;  4J87 A;  5HYN B;  4Z7N A;  3I7N A;  3SHF A;  1XHM A;  1E5T A;  3UVN A;  4A0B A;  3V4V A;  4LG9 A;  5FFG A;  1C9I A;  2PM7 B;  2XL3 A;  2I0R A;  3L4M D;  4GGA A;  3SXT D;  3CIK B;  4J8G A;  3ORV D;  4LGN A;  2CO0 A;  2P9P C;  3HFQ A;  2IWF A;  3MXX A;  2I3S A;  3AL8 A;  3EMH A;  1XIP A;  2EIC A;  4BL0 A;  2WQ8 A;  4J0W A;  1VYH C;  3L4O D;  4E54 A;  4E5Z A;  2UZY B;  3I8E A;  4JSN C;  4X60 B;  3T3P A;  4ERY A;  3VH0 A;  5C86 A;  2OK6 A;  1K32 A;  4X61 B;  3EI2 A;  2XL2 A;  3EI3 A;  2G99 A;  2HU7 A;  5E6R A;  4L3G D;  5CXC A;  5E6S A;  1P22 A;  5GXI A;  3V9F A;  4XEI C;  4DNV A;  2BBK H;  3NID A;  3SBP A;  5B4W A;  3EG6 A;  3N0E A;  2J57 G;  3C9C A;  3FCU A;  1UOQ A;  3B7F A;  5HE3 B;  3PXW D;  5GXH A;  2H6N A;  2UZX B;  4A0B B;  3OL2 B;  4PC0 A;  2I0S A;  3RLM D;  5EML B;  5AMS A;  5M61 A;  3VI3 A;  2P9K C;  2IAA A;  1GOH A;  4JSP C;  3J81 g;  3P4F A;  3AL8 B;  4BUJ C;  3F3G A;  1N6F A;  1GG2 B;  4BH6 A;  4U7A A;  4H5I A;  4A7J A;  4ES0 A;  3O4I A;  2IUV A;  1K3I A;  2HKM A;  4BCB A;  3IUM A;  4E54 B;  4GGC A;  2HXC A;  2J56 H;  3NIF A;  4J82 A;  2P9N C;  4JD2 C;  4CY1 A;  1U4C A;  4A2L A;  5AJA A;  4J77 A;  3T3M A;  4YVD A;  2P9L C;  3UKU C;  2YBA A;  1UOO A;  2IUR A;  2OVR B;  3UKR C;  5SXM A;  2IUP A;  1R5M A;  3EI3 B;  2OVQ B;  5C92 A;  4A11 B;  3EQ8 A;  3SCY A;  2H68 A;  5IC7 A;  5CXC B;  2B5N A;  3MMY A;  3I7P A;  1QNI A;  5EM2 A;  3EQ7 A;  2H3X A;  3MVD K;  1M1X A;  3A0F A;  5HE2 B;  4PSW B;  1OMW B;  1TYQ C;  5FKT A;  5FXY A;  5JWZ A;  1JMX B;  1JOF A;  3IUJ A;  1C9L A;  3PSL A;  3VGZ A;  1PBY B;  3AL9 A;  4FWW A;  5FQD A;  4NSX A;  3C99 A;  5E6U A;  3JPX A;  5H17 A;  4D9S A;  4A0A A;  3NVN A;  5HE1 B;  2YNO A;  2Z2O A;  3IUQ A;  1N6D A;  4ZN4 A;  4CI8 A;  1B9X A;  2AH1 A;  3FM0 A;  4A2M A;  4RE6 A;  4Z8L A;  4J86 A;  1S4U X;  3AFC A;  3ZDZ A;  4L3H D;  1VE6 A;  2AGX A;  3SN6 B;  3SWS D;  3KRX B;  2H9N A;  2GNQ A;  2HES X;  4GGD A;  4JXM A;  1GOT B;  4CZY A;  1BPO A;  4NEN A;  4K3J B;  4PBZ A;  1H2Z A;  4OWR A;  4NAA A;  4OZU A;  3DM0 A;  4PBY A;  1YFQ A;  4AN1 A;  2AQ5 A;  5THA A;  3PXT D;  2QXV A;  4GM3 A;  5AFU 3;  1RI6 A;  2I3T A;  5EM2 B;  4A08 A;  5GMK n;  3PVU B;  1H2W A;  3OL2 A;  1PEV A;  4MMX A;  1A12 A;  4O3U B;  1GOF A;  4J81 A;  3UR4 A;  5M5S A;  5H1M A;  3SVW D;  3IJ1 A;  1OLZ A;  3QHY B;  1L0Q A;  2XDW A;  3JZG A;  3RN1 D;  2OVP B;  3IUR A;  3DSM A;  2VC2 A;  4GQ1 A;  3V4P A;  4WJK A;  4A0A B;  3DXM C;  1FWX A;  3SMR A;  3KCI A;  2AGW A;  4BCC A;  2B5L A;  4A09 B;  5KDO B;  3RSE C;  4QRJ A;  3PE7 A;  3GRE A;  3ZE1 A;  5EAR A;  5TEF A;  2HU5 A;  4XYH A;  1JV2 A;  4A11 A;  3AH8 B;  3IVM A;  2QC5 A;  2VDL A;  5HE0 B;  1GOG A;  1QFM A;  2B4E A;  2CNX A;  2XE4 A;  3ZE2 A;  3OF7 A;  4IA9 A;  3J80 g;  3SFZ A;  4KFM B;  3KRW B;  3E0C A;  5M5U A;  4DNW A;  4A08 B;  4X3E A;  3NVX A;  1E8M A;  1O6F A;  2YNP A;  3MUN A;  5I5J A;  1QFS A;  3DDU A;  2H14 A;  2Q7Q A;  3O4G A;  3C75 H;  5K19 A;  2OK4 A;  4CZX A;  3RMZ D;  2EBS A;  1Q47 A;  2Z2P A;  4JHN A;  3IUL A;  4J0X A;  2TRC B;  2VZ3 A;  3VA6 A;  4O1Q D;  4Y7R A;  4FA4 D;  4G55 A;  5FA5 B;  4J8B A;  3ULE C;  3ZDX A;  2PM9 B;  2CE9 A;  1NR0 A;  3EU7 A;  5FKR A;  2H9L A;  1T2X A;  4J79 A;  4JT5 C;  5GSA A;  1JMZ B;  3F3P A;  2H47 A;  1B9Y A;  3SBQ A;  4ERQ A;  1SQ9 A;  5C2W B;  4Y5R D;  4WK2 A;  2VDP A;  3I89 A;  4GMB A;  4MMZ A;  4WK4 A;  3I2N A;  4AX4 A;  4ESG A;  4G56 B;  5I5M A;  4U1E I;  5IGQ A;  3BG1 A;  4BP8 A;  2VDK A;  1TYE A;  4L9O A;  4PSX B;  3IJC A;  5EAM A;  2AGY A;  2EIE A;  4XYI A;  1XKS A;  3K71 A;  4LG8 A;  4AOW A;  3F3F A;  3MZL A;  4JT6 C;  4A09 A;  3GFC A;  4I79 A;  2HJ4 A;  3EQ9 A;  1N6E A;  2XYI A;  4O45 A;  5M5V A;  3V5W B;  3JAM g;  3K72 A;  4J73 A;  2HJB A;  3RFG A;  4GZ8 A;  2XZG A;  4J78 A;  4ZOV A;  4FA1 D;  4JSV C;  4CC9 A;  4ERZ A;  4O3T B;  3N0D A;  5TF2 A;  5EMK B;  3V7D B;  2CN2 A;  4BCD A;  4BP9 A;  2AH0 A;  2VDM A;  1MG3 A;  2H13 A;  2OIZ A;  3MUO A;  3K27 A;  3RRM C;  3NVQ A;  3K6S A;  4JSX C;  3EI1 A;  1ERJ A;  5M5T A;  4AMY A;  4CI2 A;  3IJ0 A;  5K1C C;  4UM9 A;  3W15 A;  4FB1 D;  5I5I A;  3NIG A;  4FAN D;  3RN0 D;  3UVO A;  3CFV A;  2YB8 B;  5TDH B;  1MDA H;  2EIB A;  2IWK A;  3OW8 A;  2BCJ B;  1PI6 A;  2W18 A;  5EMM B;  3GC3 B;  2HU8 A;  4FA5 D;  1VZ2 A;  5EMJ B;  3UVK A;  3I7L A;  1SHY B;  1GXR A;  4D6V A;  5A2Q g;  3JZN A;  4O9D A;  5EAP A;  5IJ8 E;  2PM9 A;  3U4Y A;  4O2W A;  3ZDY A;  3ZE0 A;  3FRX A;  2YNN A;  2MTA H;  2H9P A;  4GM9 A;  4QT8 A;  4CI3 A;  3ODT A;  3JRO A;  4J84 A;  2B5M A;  5EAL A;  1K8K C;  3MKS B;  1SQJ A;  2YMU A;  3GD1 I;  5FKS A;  3IJE A;  1PGU A;  5CXB A;  4GM8 A;  4IMM A;  5FLX g;  1E8N A;  3JRP A;  4R7A B;  1U8C A;  4EWR A;  3CFS B;  4AN0 A;  1UTC A;  3EI1 B;  3SLE D;  3FGB A;  4UI9 R;  1H2X A;  4QQE A;  2CO0 C;  1MG2 A;  2H9M A;  2VZ1 A;  2GC4 A;  3VI4 A;  2H6Q A;  2VDO A;  1U2V C;  4MK0 B;  4L1M A;  5IT9 g;  4CY3 A;  4FA9 D;  2HKR A;  3OKT A;  3C5M A;  2VDR A;  4NC4 A;  5IGO A;  2JKX A;  4H5J A;  4RE5 A;  2O9K A;  3IUN A;  2J55 H;  2PBI B;  5CYK A;  5C2V B;  5IJ7 E;  5FFO A;  5HQG A;  2PM6 B;  4NBM A;  5C9Z B;  4GQB B;  2HYE A;  4AMZ A;  2EID A;  4HDJ A;  2QR5 A;  1JTD B;  4QL1 A;  3PXS D;  3RFH A;  5H14 A;  3BG0 A;  3UVL A;  4CY2 A;  5FKQ A;  4G1M A;  4E5Z B;  1TBG A;  2P9U C;  4N14 A;  2GC7 A;  2IUQ A;  5CXB B;  4AEZ A;  4CY5 A;  3IKO A;  2I0T A;  3PVW B;  4K3I D;  4PNK B;  3IIW A;  3EWE A;  5M5R A;  3EI2 B;  1GP2 B;  3ZWL B;  3BWS A;  4FHL A;  3MZK A;  2G9A A;  1NEX B;  3SBR A;  3FCS A;  3QI0 A;  5TEE A;  3I7H A;  2CE8 A;  3EI4 A;  3OKY A;  3OTT A;  2VDQ A;  2AGL A;  4IRZ A;  4DNU A;  2OJY A;  3JB9 L;  3DWL C;  1UOP A;  1JJU B;  3O4H A;  4ZOX A;  2BKL A;  4ZOZ A;  4FAV D;  2P9I C;  4CI1 A;  3I8C A;  3DXK C;  1A0R B;  2P9S C;  4JHP C;  4MMY A;  5CYK B;  4GQ2 P;  2CN3 A;  4UM8 A;  4X63 B;  4QAM A;  2H6K A;  3MKQ A;  3O4J A;  3I7K A;  3PSC B;  1YR2 A;  2XU7 A;  2QZP A;  3UVM A;  3I7O A;  4D0K A;  4O02 A;  3OKW A;  4CZV A;  3JZH A;  4L1Q D;  1L5G A; 
#chains in the Genus database with same CATH homology
 4ZOY A;  3SJL D;  3K26 A;  4PXW A;  2AGZ A;  3IIY A;  3EI4 B;  3OKY B;  4TZ4 A;  2Z2N A;  5HYN B;  4J87 A;  3I7N A;  3SHF A;  1XHM A;  3UVN A;  4A0B A;  4LG9 A;  2PM7 B;  2XL3 A;  3L4M D;  2I0R A;  4GGA A;  3SXT D;  3CIK B;  4J8G A;  3ORV D;  4LGN A;  2CO0 A;  2P9P C;  3HFQ A;  2IWF A;  3MXX A;  2I3S A;  3AL8 A;  3EMH A;  1XIP A;  4BL0 A;  4J0W A;  1VYH C;  3L4O D;  4E54 A;  4E5Z A;  2UZY B;  3I8E A;  4JSN C;  4X60 B;  4ERY A;  3VH0 A;  2OK6 A;  1K32 A;  4X61 B;  3EI2 A;  2XL2 A;  3EI3 A;  2G99 A;  4L3G D;  5CXC A;  1P22 A;  5GXI A;  3V9F A;  4XEI C;  2BBK H;  3SBP A;  5B4W A;  3EG6 A;  3N0E A;  2J57 G;  3C9C A;  3B7F A;  5HE3 B;  3PXW D;  5GXH A;  2H6N A;  2UZX B;  4A0B B;  3OL2 B;  4PC0 A;  2I0S A;  3RLM D;  5EML B;  5AMS A;  2P9K C;  2IAA A;  4JSP C;  3J81 g;  3P4F A;  3AL8 B;  4BUJ C;  3F3G A;  1N6F A;  1GG2 B;  4BH6 A;  4U7A A;  4H5I A;  4A7J A;  4ES0 A;  2IUV A;  2HKM A;  4E54 B;  4GGC A;  2HXC A;  2J56 H;  4J82 A;  2P9N C;  4JD2 C;  4CY1 A;  1U4C A;  4A2L A;  5AJA A;  4J77 A;  4YVD A;  2P9L C;  3UKU C;  2YBA A;  2IUR A;  2OVR B;  3UKR C;  5SXM A;  2IUP A;  1R5M A;  3EI3 B;  2OVQ B;  4A11 B;  3SCY A;  2H68 A;  5IC7 A;  5CXC B;  2B5N A;  3MMY A;  3I7P A;  1QNI A;  5EM2 A;  2H3X A;  3A0F A;  5HE2 B;  4PSW B;  1OMW B;  1TYQ C;  5FKT A;  5FXY A;  5JWZ A;  1JMX B;  1JOF A;  3PSL A;  3VGZ A;  1PBY B;  3AL9 A;  4FWW A;  5FQD A;  4NSX A;  3C99 A;  3JPX A;  5H17 A;  4A0A A;  3NVN A;  5HE1 B;  2YNO A;  2Z2O A;  4ZN4 A;  1N6D A;  4CI8 A;  1B9X A;  2AH1 A;  3FM0 A;  4A2M A;  4Z8L A;  4J86 A;  1S4U X;  3AFC A;  4L3H D;  2AGX A;  3SN6 B;  3SWS D;  3KRX B;  2H9N A;  2GNQ A;  2HES X;  4GGD A;  4JXM A;  1GOT B;  4CZY A;  4K3J B;  4PBZ A;  4OWR A;  4OZU A;  3DM0 A;  4PBY A;  1YFQ A;  2AQ5 A;  5THA A;  3PXT D;  2QXV A;  4GM3 A;  5AFU 3;  1RI6 A;  2I3T A;  5EM2 B;  4A08 A;  5GMK n;  3PVU B;  3OL2 A;  1PEV A;  4O3U B;  4J81 A;  3UR4 A;  5H1M A;  3SVW D;  3IJ1 A;  1OLZ A;  1L0Q A;  3JZG A;  3RN1 D;  2OVP B;  3DSM A;  4GQ1 A;  4A0A B;  3DXM C;  1FWX A;  3SMR A;  2AGW A;  2B5L A;  4A09 B;  5KDO B;  3RSE C;  4QRJ A;  3PE7 A;  3GRE A;  5EAR A;  5TEF A;  4XYH A;  4A11 A;  3AH8 B;  2QC5 A;  5HE0 B;  2B4E A;  2CNX A;  4IA9 A;  3J80 g;  3SFZ A;  4KFM B;  3KRW B;  3E0C A;  4A08 B;  4X3E A;  3NVX A;  2YNP A;  5I5J A;  2H14 A;  2Q7Q A;  3C75 H;  5K19 A;  2OK4 A;  4CZX A;  3RMZ D;  2EBS A;  1Q47 A;  2Z2P A;  4J0X A;  2TRC B;  3VA6 A;  4O1Q D;  4Y7R A;  4FA4 D;  5FA5 B;  4J8B A;  3ULE C;  2PM9 B;  2CE9 A;  1NR0 A;  3EU7 A;  5FKR A;  2H9L A;  4J79 A;  4JT5 C;  5GSA A;  1JMZ B;  3F3P A;  2H47 A;  1B9Y A;  3SBQ A;  4ERQ A;  1SQ9 A;  5C2W B;  4Y5R D;  3I89 A;  4GMB A;  3I2N A;  4ESG A;  4G56 B;  5I5M A;  4U1E I;  5IGQ A;  3BG1 A;  4L9O A;  4PSX B;  3IJC A;  5EAM A;  2AGY A;  4XYI A;  1XKS A;  4LG8 A;  4AOW A;  3F3F A;  3MZL A;  4JT6 C;  4A09 A;  3GFC A;  4I79 A;  2HJ4 A;  1N6E A;  2XYI A;  4O45 A;  3V5W B;  3JAM g;  4J73 A;  2HJB A;  3RFG A;  4GZ8 A;  4J78 A;  4ZOV A;  4FA1 D;  4JSV C;  4CC9 A;  4ERZ A;  4O3T B;  3N0D A;  5TF2 A;  5EMK B;  3V7D B;  2CN2 A;  2AH0 A;  1MG3 A;  2H13 A;  2OIZ A;  3K27 A;  3RRM C;  3NVQ A;  4JSX C;  3EI1 A;  1ERJ A;  4CI2 A;  3IJ0 A;  5K1C C;  4FB1 D;  3W15 A;  5I5I A;  4FAN D;  3RN0 D;  3UVO A;  3CFV A;  2YB8 B;  5TDH B;  1MDA H;  2IWK A;  3OW8 A;  2BCJ B;  1PI6 A;  2W18 A;  5EMM B;  4FA5 D;  5EMJ B;  3UVK A;  3I7L A;  1SHY B;  1GXR A;  4D6V A;  5A2Q g;  3JZN A;  4O9D A;  5EAP A;  5IJ8 E;  2PM9 A;  3U4Y A;  3FRX A;  2YNN A;  2MTA H;  2H9P A;  4GM9 A;  4QT8 A;  4CI3 A;  3ODT A;  3JRO A;  4J84 A;  2B5M A;  5EAL A;  1K8K C;  3MKS B;  1SQJ A;  2YMU A;  5FKS A;  1PGU A;  5CXB A;  4GM8 A;  4IMM A;  5FLX g;  3JRP A;  4R7A B;  4EWR A;  3CFS B;  3EI1 B;  3SLE D;  3FGB A;  4UI9 R;  4QQE A;  2CO0 C;  1MG2 A;  2H9M A;  2GC4 A;  2H6Q A;  1U2V C;  4MK0 B;  5IT9 g;  4CY3 A;  4FA9 D;  2HKR A;  3OKT A;  3C5M A;  5IGO A;  4H5J A;  2O9K A;  2J55 H;  2PBI B;  5CYK A;  5C2V B;  5IJ7 E;  5HQG A;  2PM6 B;  5C9Z B;  4GQB B;  2HYE A;  4HDJ A;  4QL1 A;  3PXS D;  3RFH A;  5H14 A;  3BG0 A;  3UVL A;  4CY2 A;  5FKQ A;  4E5Z B;  1TBG A;  2P9U C;  4N14 A;  2GC7 A;  2IUQ A;  5CXB B;  4AEZ A;  4CY5 A;  3IKO A;  2I0T A;  3PVW B;  4K3I D;  4PNK B;  3IIW A;  3EWE A;  3EI2 B;  1GP2 B;  3ZWL B;  3BWS A;  4FHL A;  3MZK A;  2G9A A;  1NEX B;  3SBR A;  5TEE A;  3I7H A;  2CE8 A;  3EI4 A;  3OKY A;  3OTT A;  2AGL A;  2OJY A;  3JB9 L;  3DWL C;  1JJU B;  4ZOX A;  4ZOZ A;  4FAV D;  2P9I C;  4CI1 A;  3I8C A;  3DXK C;  1A0R B;  2P9S C;  5CYK B;  4GQ2 P;  2CN3 A;  4X63 B;  2H6K A;  3MKQ A;  3I7K A;  3PSC B;  2XU7 A;  3UVM A;  3I7O A;  4D0K A;  3OKW A;  4CZV A;  3JZH A;  4L1Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...