3MUNA

Appep_pepclose closed state
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
684
structure length
684
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFWWGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDQRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGYWWDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Prolyl endopeptidase
publication title Route of Substrate Entry in Prolyl Endopeptidase
rcsb
source organism Aeromonas punctata
total genus 219
structure length 684
sequence length 684
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3munA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3munA01
5EIAA 1DX6A 1XZCA 1ACJA 3PUIA 1R3DA 3G0BA 4K6HA 5AK4A 1WPRA 4RGYA 4AQDA 1LPOA 3R3YA 2WG0A 5HZGA 1OXMA 3O95A 3L1IA 1TCAA 4U2CA 2Y6UA 3F98A 2XUKA 5DYTA 5K5EA 4IQ4A 2PU5A 4PSCA 2WFLB 3G9UA 1QFSA 3PF9A 4DNQA 4QDZA 4DLNA 4M0FA 5AKJA 3C8DA 4J0GA 4H7JA 3RLIA 1TCBA 5HF6A 5CT9A 4J0CA 3HXKA 1K8QA 3DQZA 2QUAA 3S2ZA 5LKAA 1VA4A 1DINA 1ZIXA 5K3EA 1XRQA 2QTBA 4QWWA 4ZREA 2BAGA 3Q8WA 4AN1A 3G0GA 2WIJA 5JZSA 1DWPA 5CBKA 3H0CA 4BAUA 2GBIA 3I6ZA 1ZOIA 2O7VA 1CUVA 4WY8A 1R88A 5EIEA 5C8XA 3BDIA 1GQSA 1ZD5A 1XZAA 2VAVA 4IHAA 3MUOA 1DTEA 3WKDA 4Y2YA 4Z49A 5JARA 1QONA 1KEZA 2XUPA 3VISA 3OURA 4UHCA 5HF8A 1QIFA 1U8EA 1TKRA 2I78A 4GW3A 4Y2QA 2XUJA 4NS4A 4X7BA 1DWQA 2VQ6A 5JAOA 5IVHA 2XMDA 2B4KA 4C87A 3LIIA 1W75A 3SC2A 4J0JA 2RGUA 2ONCA 4BTLA 5AI8A 3V1KA 3QM1A 3C5WP 3Q0TA 1X2BA 4DMKA 3MGAA 1ZI6A 5AIBA 5LYYA 2XT0A 2OCIA 5T4BA 2J3DA 4Q1VA 3EQ7A 4UFOA 1L7QA 3M83A 1F0NA 3SX4A 3KOOA 5AKIA 2HM7A 5EHNA 2FUKA 2O7RA 4J0HA 1H2ZA 4X3CA 1CV2A 3ESCA 3HI4A 2XQGA 2J3QA 4A16A 4GLBA 1XRPA 3F96A 1YS1X 4FDMA 3STWA 3CCCA 1MNAA 1BEEA 5FV4A 1QJ4A 4YASA 4ZV7A 1UKAA 2PSDA 3IIIA 3IB3A 3K2IA 3FLBA 4Y9SA 1LNSA 2FX5A 3R41A 3ILSA 5E4JA 5FP0A 4FMPA 5FKJA 4QWMA 2HRRA 3DOIA 1DQZA 2H9YA 2HADA 5JZBA 1Q0ZA 4E11A 5AI9A 2XUIA 4UBNA 2OQVA 3I6MA 2PSJA 2QOEA 2BUAA 3IURA 1E66A 3WWCA 1ZJ5A 2YYSA 5AHXA 4EY7A 3H2JA 1QOZA 5FDFA 3KD2A 4BATA 1QIGA 4QA9A 4J7AA 4ARAA 3PF8A 2G5TA 4C6HA 3DDUA 1BE0A 2ZYSA 5D3ZA 2HL6A 1WM1A 2R8BA 5EHXA 3S8YA 1AURA 4I19A 1UZAA 4G4GA 3DL7A 5ALFA 1MPXA 2V97A 4L3WA 1ZI9A 4S0XA 2CBGA 3VDXA 4MQLA 4UHHA 3AZPA 2WU3A 1J2EA 5FXMA 1LLFA 4NMWA 1W6RA 2WHQA 1LBTA 1JJBA 3C5VA 4F0JA 1K5PA 2WIKA 3WZLA 4INZA 1KU0A 1XRRA 5AI4A 3HSSA 3ZLVA 3C6ZA 4EA6A 1Q0RA 4TVKA 3NGMA 2WQZA 5ALZA 4J0DA 3U0VA 5LZ4A 4G8DA 2DHEA 4DYHA 1JFRA 5BWBA 1H2WA 2HFJA 3R3ZA 1CUIA 4L9AA 1THGA 4IH9A 2JBWA 2XUQA 1YB7A 1UK8A 2C5GA 1ODTC 2RHTA 2G5PA 1LZLA 1ORVA 1G5FA 2RI6A 3H2HA 1XQVA 5FPQA 4Q3LA 1G4HA 1UK6A 2VAXA 5DWDA 3GZJA 4X97A 4QLOA 2PM8A 4KAJA 2XLCA 4DTCA 2WHRA 2JGIA 1XKTA 3IULA 1JI3A 5A62A 5LLSA 1L7AA 1JMYA 4EUSA 2JEYA 2VJCA 4W1RA 3I28A 5HF9A 3ESDA 5ALLA 4JNCA 3STYA 4L0CA 1YCDA 5ALEA 5AI6A 1BCRA 3RARA 4Y2JA 1QTIA 3WL7A 3C6BA 4NZZA 2C0QA 2OCKA 3BWXA 1ZD4A 2XUHA 1DX4A 5AKLA 4UHFA 5ALSA 4FTWA 4LYEA 3G8YA 2WJ4A 2Y6VA 2VJDA 2PL5A 4B83A 3GUUA 1H23A 4CG3A 4ZI5A 2QXTA 2BFNA 3I2JA 1XZBA 1W4LA 4H18A 5K3DA 3FSGA 5DNWA 4X6UA 1CUHA 2XUDA 5LIPA 3AILA 1HPLA 2Z8XA 5I7UA 5JAHA 1JU3A 4JH0A 3GFFA 5ALGA 1EINA 5ALJA 3T4UA 1TRHA 1HBJA 4AN0A 4QNNA 4Y7DA 3MUNA 3HABA 4KRYA 3G7NA 2WTMA 5C7YA 1QZ3A 4QLAA 3KSRA 1HLGA 1FSSA 1SCIA 2WUDA 4FOLA 4EY4A 3OPMA 2ECFA 5I9IA 2JGKA 4YX9A 5AKXA 4X90A 3B12A 4B85A 4B80A 3O4IA 2HU8A 2V96A 4MEAA 1SCQA 3DKRA 4MWTA 1O6FA 2OQIA 3WWEA 2OAGA 2QKYA 5CXXA 3V1MA 4LYDA 3WQHA 4DGQA 4CIAA 3ESAA 3DNMA 2XDWA 1XLWA 1YAHA 4KE8A 5AKGA 1BN6A 1IUPA 2HA4A 5DLPA 3HRHA 2EEPA 4ETWA 1ISPA 2WG1A 5JAUA 1NU6A 5AK6A 2EDCA 4JYPA 1XLVA 3C6YA 4B81A 5JADA 4YK7A 1QIDA 2X8BA 4HRYA 5LZ8A 4BAZA 4BZZA 2Y2VA 3I2KA 2YASA 2GBCA 1CUEA 1E8MA 2B9VA 2OG1A 4UHDA 5C8ZA 5IKXA 4FNMA 4G8BA 5A7GA 2VJAA 3JWEA 3TEJA 5FLKA 4WDRA 1U65A 3H17A 2RIPA 3BF8A 3V9AA 4P08A 2WJ6A 4MWSA 5ALIA 1VOTA 1WB5A 4X94A 1A88A 5E4YA 3BF7A 4U2BA 4U2GA 1VXOA 4C89A 3AFIA 1CUFA 2WKWA 1EX9A 1UWCA 2C0PA 2EDAA 2GYVA 3BL8A 3H19A 3W06A 1ZGCA 3VVLA 3GBSA 5CTAA 4UFPA 4QDXA 3CCBA 3O0DA 2PVSA 1VE7A 1NX9A 4CG1A 3A70A 4GWLA 3W04A 2K2QB 2H1IA 2V98A 3O9VA 2QJWA 5HQ3A 2ZVDA 4LHEA 4BCDA 1EDDA 4CCYA 3YASA 1LBSA 1DT3A 5AKKA 2HA2A 1LPPA 2XQJA 4V2IA 5KREA 3V48A 3F8SA 3WYDA 2OCGA 1AQLA 1QIKA 4G5XA 2GBGA 4M0EA 4P9NA 2I3ZA 4PO3X 4KACA 1PJAA 1CLEA 1MO2A 1ETHA 2ZYRA 4XJVA 4G8CA 2GYWA 4X93A 4HXEB 3WWOA 1TCCA 3AUKA 3BIXA 1F8UA 3H1AA 3FOBA 3M3DA 3P2MA 5BWCA 2AXEA 4GHWA 5AM4A 4H7EA 3DD5A 3FSGD 3OC0A 1XZFA 4FBLA 3I2HA 5AKEA 4W9RA 4H35A 1EK2A 3FBWA 1FFDA 3LP5A 4RE5A 3D4LA 5ALMA 5JD6A 4B6GA 1H2XA 2XMBA 3DL4A 2VA9A 3QPCA 3L1JA 1LPMA 4X91A 5CT5A 3WI7A 3BIWA 3G0DA 4IO0A 2PSEA 2X76A 3HLKA 1PFQA 3AZOA 3C70A 3MVEA 1QGED 5CH3A 1XZLA 3KDAA 5DYWA 5DNUA 3ZLUA 5A6VA 3EF3A 4OYYA 5AOCA 1THTA 5HKBA 3DJYA 2O2IA 1EXWA 1VA5A 2Z3ZA 5DTJA 4AZ0A 5IVDA 2OXEA 1TIBA 4WFKA 1R9NA 5LP1A 4Q34A 1MX1A 1UXOA 4AB1A 2PBLA 1E8DA 3O4JA 3ICWA 1J06A 4BVJA 4L72A 4DIUA 4Y2RA 5AOAA 3PE6A 2XQFA 3WK7A 4DSAA 3AZQA 2BGNA 5AM0A 1WOMA 3O4GA 5A7HA 7YASA 5AH0A 3D2CA 4KAAA 3VJLA 5AKYA 1E89A 2C58A 3VVMA 4B0PA 1T4MA 1CUUA 4B84A 1CQZA 4XIIA 4M0MA 2IX9A 2WIDA 2BCEA 3HEAA 4G4IA 3I1YA 1R9MA 1JT2A 3W9BA 2OPHA 3D2BA 1RYYA 4QE3A 2FJPA 1CUJA 4BRZA 4JUIA 1JMKC 3STTA 3ZPXA 1E3QA 5C8VA 3G02A 2O2HA 4AO8A 4B9EA 1T2NA 3HACA 5K3FA 3I2IA 5LZ7A 1HDEA 3G0IA 4IH1A 2HA7A 3QH4A 3LIPA 3CN9A 3W9UA 2BUCA 4E46A 1SCKA 4H7DA 2BUBA 2WFMA 2VT6A 5AM1A 3WMRA 3PICA 4N5HX 2DHDA 5HK8A 5JD5A 3D5EA 2HA3A 4BZWA 3B3QA 5ALTA 2I03A 4ZWNA 3AIKA 4QDUA 3H18A 1CUAA 4E14A 3WJ1A 3M81A 1QFMA 4HRXA 1W1IA 4FNGA 2VSQA 3DKKA 2V9ZA 3IUQA 1YB6A 2AJBA 4W1PA 5CH8A 5JANA 1GT6A 4G9GA 3WKAA 2OGTA 4W63A 4Y2TA 1MJ5A 4AMZA 1QIMA 3WL6A 1BU8A 3F9CA 2WUFA 1VE6A 4I4CA 5AO9A 5AK3A 4EY8A 4I3FA 1P0PA 1XZGA 2WUGA 3WL8A 1TAHA 1ZI8A 1QIIA 1SOMA 5HFNA 4CI9A 1VLQA 3OM8A 5CW2A 5JD4A 3IA2A 1XZIA 2E3JA 4KYVA 1R50A 3PFCA 1GQRA 3LCRA 3QMVA 5ALHA 5ALRA 1XZDA 2JGEA 1R4ZA 2WSLA 3SK0A 2AJDA 1Y7IA 5J3JA 3I6YA 4RNCA 4HAIA 1VXRA 1JJIA 1WCYA 2QVBA 5ALQA 2WIFA 5D7BA 5CH5A 4F5ZA 2WLSA 5FPPA 2BJHA 2AJ8A 1MAHA 3IUNA 3E0XA 3A2LA 4KRXA 3ZI7A 1HL7A 4H7HA 1CUGA 1M33A 3FVTA 3STVA 5CT4A 2WJ3A 1BN7A 1DWOA 4GEGA 3WKEA 4YPVA 4F60A 1EDEA 1CPYA 2HRQA 5YASA 5LZ2A 4WJLA 3VKFA 4KE6A 5SYNA 4FLMA 4K6GA 5T4EA 2QZPA 1DQYA 5AK5A 1EDBA 2O2GA 5DTIA 1YASA 1X2EA 4HTAA 2ORYA 1UOOA 4H7IA 2QS9A 5JAPA 3JYHA 3KWFA 3QBJA 4RE6A 3DOHA 5FRDA 1QTRA 5EFZA 4N8SA 4PV7A 3ESBA 1XRLA 3DLTA 1N5RA 2D0DA 4G9EA 4K2AA 2CUTA 3W05A 2CB9A 3FYUA 1P0QA 1R1DA 1SC9A 2QM0A 3I2GA 1ODCA 5CT8A 2AJCA 3QMMA 4KAFA 4UHEA 3CN7A 3DS8A 2HIHA 1EVQA 4HVTA 4KE7A 4N8EA 2QJRA 4OD0A 4ROTA 5C81A 1ZICA 4B0OA 1GZ7A 1XQWA 3A6ZA 4J0KA 3FLAA 3DEAA 4QZVA 1UK9A 3R3XA 3TGLA 1UOPA 2DSNA 5D3KA 3AINA 2Z3WA 1EB8A 1UKCA 3VJMA 4GI1A 1MX9A 2Z8ZA 4BRSA 2IIVA 5AM5A 5ESRA 4EHBA 5BOVA 2R11A 1J07A 3WWPA 1CRLA 2BGRA 5EGNA 4XVCA 1LPSA 3OG9A 5K3CA 2OLEA 1USWA 4KEAA 1QLWA 3WYNA 1U2EA 2DQYA 4EZIA 3R3VA 4UBIA 2HHAA 4QEKA 4MJ3A 1CIJA 4EB0A 2ZJ6A 4GBGA 1QO9A 2P8SA 3HZOA 2ZSIA 5AKHA 4AMYA 2XE4A 2JIDA 1BROA 1QIJA 3EIOA 4A23A 2HA6A 5HQ3B 1GKLA 3AJAA 4ZV9A 1XZJA 3STUA 4BP9A 1XZHA 2ACEA 4PSUA 2XMZA 1LPNA 4W1SA 3UUFA 2XMRA 2W22A 3I2FA 1EI9A 1EK1A 2YH2A 1A8QA 4N5IX 1AZWA 1VKHA 2NW6A 3HJUA 3QITA 1VZ3A 4W1QA 2JGFA 4LXHA 2QR5A 3QPDA 1A8UA 1GPKA 2JF0A 1LPAB 2OGSA 4LIPD 3I1IA 4ZXFA 4FLEA 1Q83A 1IVYA 3QYJA 1EVEA 3FVRA 4OPMA 3R3UA 2J4CA 1C7IA 5ALVA 4UBLA 3FYUC 3H2GA 3T52A 4B7ZA 2QT9A 1B6GA 5ALNA 1FFEA 1MTZA 1UFOA 2WG2A 4C01A 2DQZA 5AI0A 5JIBA 1ZD2P 3WK5A 2HA0A 3C43A 3R0VA 3O4HA 2WTNA 2LIPA 1AC5A 2PSFA 1CQWA 1YS2X 4U2DA 5LZ5A 2OGZA 3W2TA 3HYSA 4FFWA 3FCYA 4Y2VA 1UT6A 4OYLA 5A71A 3FWHA 2QMQA 5HKAA 3STXA 2XUAA 1AX9A 4PSDA 4DNFA 1BRTA 5JATA 5AP9A 4ZGBA 3BJRA 4Q3KA 1GKKA 3R3WA 2HU5A 4X6YA 4X85A 4P93A 4X00A 5CMLA 1IUOA 2H7YA 4FBMA 4DMHA 5CXUA 1WPXA 1XRNA 2GBFA 1WB6A 3C87A 4PW0A 3O9MA 3R40A 4OSEA 1EB9A 1ACLA 3C6XA 3BDVA 3CXUA 2XI4A 3M82A 3G9ZA 1ODSA 3QMWA 4UBJA 5HF5A 4A5SA 1AKNA 2VATA 3D3NA 3L1HA 3FYTA 5ALKA 1K4YA 4Y2XA 4FHZA 1IUNA 3RK4A 2VTVA 3VXKA 2AJLI 2WFZA 2RHWA 3WK4A 1CUBA 3WWDA 1K6EA 4OB6A 2XLBA 4WY5A 5ISMA 1A7UA 1PV1A 5ALDA 4AZ3A 4DM7A 3WKBA 2WU4A 3PUHA 5K3FB 3ZLTA 4JYMA 2HFKA 4MYDA 4MEBA 1MNQA 4EBBA 3WA7A 2DCMA 3G9XA 1CUDA 1ZGBA 4BE4A 4IH4A 3WJ2A 4BE9A 1AUOA 4DSZA 1UK7A 1JKMA 3FNBA 3PI6A 2CJPA 2ZJFA 2OCLA 5AOBA 4BCBA 4XWGA 2WHPA 2DHCA 5E4TA 5LZ9A 4CG2A 1YA4A 4N8DA 4BAGA 4H0CA 2X5XA 2YXPX 2PKYX 3OTQA 2UZ0A 5JZ9A 1UKBA 3N0TA 2PUHA 3C8HA 4JEIA 2HA5A 4BYMA 1Y7HA 3X3HA 5A2GA 1J1IA 2HU7A 5HFAA 3D2AA 4LXIA 5CT6A 4WFJA 4X92A 5A7FA 5BV7A 3LS2A 2PUJA 1CUZA 3EQ8A 4BDSA 1Z68A 4K5QA 3WK8A 3UUEA 1JJFA 1RP1A 1LZKA 1WB4A 1XKLA 3A2MA 1AGYA 3NOXA 2PX6A 2WFLA 5EHQA 4B82A 4F21A 3TRDA 4AX4A 3IUJA 3BJMA 1G66A 5ALOA 3WL5A 3QZUA 4AO7A 1HKHA 1F0PA 5JASA 2XQIA 3ED1A 1MU0A 1X70A 5ALYA 3KWJA 3E3AA 3WKCA 4HXGA 3E4DA 2Y1KA 5FUMA 1IMJA 4UUQA 5I8PA 3EQ9A 4MYSA 5KWIA 2GZSA 1JU4A 1XZMA 1ZJ4A 2C7BA 5DJ5A 1E5TA 4H7KA 1CUWA 1FJ2A 4LKOA 1IZ8A 2RAUA 3RKSA 3H2KA 4FKBA 5AM3A 4H77A 4WDQA 5JYCA 2CZQA 4PF1A 4MQMA 4HXFB 5FOQA 1EA5A 3UMJA 3TJMA 3EBLA 3HC7A 2JGJA 1XLUA 3ZWQA 4AO6A 1RWQA 2XUFA 4J0IA 2WM2A 5HK9A 1ZD3A 3FYUB 3AIOA 4G1FA 3U1TA 4C88A 1SFRA 4DMCA 4X6XA 4BC1A 1H2YA 3GA7A 1CEXA 4C4YA 1P0IA 3DYIA 1CUCA 1GGVA 5AIAA 2ZYHA 1VJ5A 2WIGA 2GYUA 4GXNA 3FCXA 3GROA 2B61A 1EHYA 3ZV7A 1DT5A 1XFDA 4WCVA 3NWOA 2C5FA 4CFSA 3BXPA 5KWJA 2Q0XA 1FFBA 2C4HA 4XX1A 1QO7A 4KJXA 1P0MA 4UBMA 4U2FA 1CUSA 2XUOA 5ALUA 3PFBA 4DMFA 1XRMA 2JGLA 1LPBB 1EH5A 1FFAA 4BC0A 1XQXA 5AICA 6YASA 2PPLA 1H22A 3G9TA 4ITVA 5AJHA 4GECA 4B9AA 4Y2UA 1IZ7A 5SYMA 4OUKX 2J4FA 3F67A 4P92A 1D07A 1NU8A 5T4HA 2D5LA 5EIHA 4X95A 1CR6A 4U2EA 2G4LA 1U4NA 1C4XA 4Q3OA 4ARBA 1W52X 2PU7A 4TGLA 2QXUA 4BVLA 2CKMA 1YR2A 2ROQA 4G4JA 1ZIYA 4FWBA 4UHBA 4BCCA 4UPDA 1BS9A 1DU4A 3D59A 1MAAA 3AIMA 4Q82A 3KXPA 3N2ZB 4OB8A 5K3AA 5EHZA 3B5EA 3DCNA 1FFCA 2WILA 5K3BA 1CVLA 3RM3A 1WHTA 3FAKA 2VEOA 3DYVA 1I6WA 2QRUA 2DFPA 4OCZA 2VF2A 1XQYA 3IBTA 2IITA 4RPCA 3WK9A 2CMFA 1MX5A 5AI5A 1YAJA 3H1BA 4K6KA 1Y37A 2XUGA 4H7FA 3ANTA 5F4ZA 3WIOA 3H2IA 3OOSA 5ALPA 2RONA 4BBZA 1W76A 1C7JA 5IVIA 4PNZA 1OILA 4LXGA 2Y2UA 1N5MA 4OU5A 2ZJ7A 4DNPA 1AMNA 5AM2A 4GDMA 2WUEA 5H3HA 2FJ0A 3IVMA 5JALA 4J3JA 5D6OA 1N1MA 4X71A 1OCEA 3A2NA 2ACKA 1XZKA 3WA6A 1GPLA 4MXDA 4BDTA 1HQDA 4NVRA 1N8SA 1LGYA 1TQHA 3NUZA 2JGMA 1GPNA 4CIBA 1YSCA 4QDOA 1E8NA 3E1GA 3WIBA 3WLAA 4FLFA 3D0KA 4QDTA 5DNVA 5AKZA 4O08A 4UBKA 5E2IA 2CEKA 3QVMA 2QUBA 4TPKA 4EY5A 5EI5A 3LLCA 1WHSA 5IH7A 1CUXA 2HDWA 4PQEA 3FLEA 1BEZA 5CRIA 4BP8A 4CCYB 4BB0A 2G63A 3PDCA 3K6KA 2H7CA 4E15A 4J03A 1B41A 4Q05A 1MN6A 1K63A 2B20A 5KBYA 1TK3A 4HS9A 2ES4A 3G0CA 4OB7A 4DNOA 3ANSA 4HZGA 4OU4A 3IUMA 4Y2PA 3F97A 2JEZA 4KE9A 3ICVA 1MT3A 2GZRA 4CCWA 3V1LA 2XB6A 4FFVA 4C4XA 3GELA 2DR0A 2Z5GA 2XMGA 2VJBA 4C4ZA 4D9JA 3K9BA 1F6WA 2PSHA 2VT7A 1QIEA 4AXBA 1QE3A 1GXSA 3WZMA 3V1NA 2H7XA 4KR0A 1XZEA 2XMSA 2XMQA 1VZ2A 3SWWA 4UBOA 1L7RA 1S8OA 1QIHA 5ALWA 1XROA 3VJKA 3JW8A 3QPAA 4Y2SA 2OAEA 5IVKA 2W6CX 4UFNA 5HCUA 1A8SA 3BE8A 3D7RA 2WHPB 5T4FA 1UOQA 5CURA 1BCSA 1Q84A 5LKRA 1G42A 1KU6A 2ZYIA 1O6GA 2XQKA 3C45A 1CFJA 5DYYA 3IDAA 2I3DA 2ZSHA 3WK6A 1YA8A 4ZRDA 1ORWA 2XMCA 3H04A 4BTVA 2BKLA 4BVKA 4EY6A 1CUYA 5ALXA 4WFIA
chains in the Genus database with same CATH superfamily
5EIAA 1DX6A 5HE8A 5DMHA 4GDFA 1AQIA 3FPSA 1SKYE 1GLVA 3L1VA 1KFEB 3W2FA 4FDLA 3RT1A 2ARKA 5E6UA 3CW9A 4U2CA 3FCSA 3NJRA 3A31A 2FW9A 3VSCA 3D8BA 3AVXA 3ZLJA 3ANLA 2X5NA 4IQ4A 5F12A 1G0OA 2FW7A 4R2KA 1E0SA 4QDZA 4DLNA 3TMAA 3BSFA 4Y98A 5GGXA 3ZHYA 4J0GA 2VC2B 3B7PA 1ERJA 1ZP6A 1E5VA 2RHHA 5LKAA 1E1RD 3IUYA 4OQPA 4QT4A 5ERGB 1U11A 3EI4B 1JN0A 5DHPA 3TWOA 1W5SA 5EIEA 2VAMA 3HKCB 3PXUA 1YC5A 2C2GA 2HUNA 1DTEA 1OBOA 2ZBVA 5KPDA 5A0VA 3GEPA 1WU8A 2V7UA 1LW7A 2DWQA 4MI1A 1QIFA 1KFBB 2YN0A 1I7QB 4L5AA 3ZZUA 1V26A 4Q9NA 4EA7A 3JTMA 4J0JA 2RGUA 4JBLA 5LMCA 2PVCA 4PONA 1OV6A 4L4XA 1H9BA 4KWIA 4M8LA 1VLLA 1YIAA 1YR7A 1SG0A 4Q03A 3BH0A 1OU0A 4CTKA 5AKIA 4B3JA 4HMOA 3NXSA 3TVTA 2AYXA 4MJ7A 4OOFA 3UH1A 1EFVA 3ZBPA 1WKBA 2BM8A 3I37X 4X1YB 3TQFA 1WZIA 2Q5QA 4MTCA 4RTPA 3EOBI 4JD5A 3O8QB 2HRRA 3SVLA 3ZBTA 4M1MA 1PYGA 5JZBA 2W93A 3DDHA 4E11A 1SU4A 3HI6A 4DLLA 2ZRQA 1YFQA 2EFHB 3KVNA 1GZ4A 2QNRA 3I39X 4AY2A 5MGNA 2OG2A 5DHUA 4JQCA 3D3EA 3LHDA 1W49A 4IHKA 1XNHA 2RHGB 2ZYSA 1T2FA 1X7WB 3LUHA 1I3NA 1WMFA 4QRHA 3BH6A 3QVLA 4PHHA 3O47A 3KSDO 1NJGA 4G4GA 1NI4A 4PHTA 2CBGA 4NG4A 3LK7A 2H1OA 1U7PA 1ARZA 3ROQA 3UVKA 2K7ZA 3O1JC 2F3RA 5EZYA 2P2DA 3GLFB 5AI4A 5IDVA 2B69A 3HSSA 1A8PA 4GI3A 4UAJA 2AI3A 4JZYA 4TXHA 2NSLA 1PLJA 4J0DA 4ZDJA 2ECOA 2WYWA 2VN8A 4BNVA 1XCGB 1HTTA 1CUIA 1YBMA 4ETIA 1TX4B 2X9VA 3EEFA 5F2EA 3P32A 1FZTA 2C9MA 2R6DA 1F8YA 1WHSB 2AC2A 1M7GA 2OLKA 4IEIA 3K9WA 4BGUA 3C85A 4WK6A 4XLTA 2XXAB 4HXYA 5CJ2A 4JA2A 2L18A 4PIPA 3SCZA 2C1XA 2V6BA 4BNKA 3BE4A 2O5RA 4QASA 1V4NA 1MDAH 4B6FA 3N9IA 3WL7A 4DVGA 3K9FC 2BL4A 4GZ8A 1A2QA 3EK2A 1M8PA 4CNQA 3L7BA 5E6SA 2VJDA 5FWXA 3ZDZB 3CEHA 1TFUA 5G4LA 2WZBA 4YP5A 1RXVA 2FFBA 1LDNA 2QXTA 1C80A 4HH4A 1SD5A 1BA3A 4QOGA 3AVYA 1A9YA 3OY7A 2OM6A 5U4QA 4Y1GA 1MDFA 1RIIA 3UGKA 3ODPA 1EESA 4R71A 4ZQFA 1FVHA 1V96A 4QJ3A 1UMCB 1F0KA 1KK2A 1PG0A 5EJ4A 2QJOA 1VG8A 4W5TA 4QLAA 2Z57A 4EY4A 3MINB 3A10A 1X8LA 2F6RA 4I55F 1L1RA 3IP3A 4LNHA 3KAKA 2FSGA 5CYOA 3DKRA 2ZSUA 1Q95A 3B6IA 3BCRA 1VPDA 4A11A 2JLWA 1CNMA 4C7KA 4ZC1A 3GCWA 4B34A 4JVNA 2AH5A 1HY3A 1U1FA 1DKQA 2CNOA 4WL0A 2QTGA 3TJRA 1LU9A 5AHRA 3TLGB 3O8OB 2QN3A 2IXDA 3KPWA 1CUEA 3HV2A 2MMCA 3KQNA 2ZB3A 2WKPA 5DBOA 2BN4A 2BMJA 2WDZA 4G41A 1NJ2A 5KDLA 3TGPA 3RN1D 4L3VA 1C7RA 2AZMA 4X94A 2JHCA 2P2ZA 3FVVA 3OP4A 2VDMB 2VP4A 1I10A 2IUPA 2OVQB 3LO8A 3MS2A 1JNXX 1FMJA 2CLDX 1XXHB 3TLKA 4PQRA 2WMNB 1TPZA 1KYZA 2PVSA 1AHPA 3ZU5A 4Q0MA 1M9NA 1KO5A 4CG1A 4DC0A 4GWLA 3WRYA 3NX4A 4AIIA 2VLBA 3DT8A 3LXUX 4QPNA 3THYB 3PXGA 1EDDA 2CHVA 3FJ1A 3FHCB 3F8SA 2LUOA 3PCTA 1ID8A 2V9PA 2OCGA 4RY9A 4DC1A 2BOVA 5DU2A 1UFKA 4L8YA 1U2VC 1ZVKA 5ITVA 1LV7A 4AJKA 4XEHA 4A03A 3UANA 3HO1A 2H2HA 5TT1A 2P9QA 3WAJA 3DV0A 5BN1A 3ZK8A 1C1XB 2NZVG 5COBA 1JMVA 3K32A 1VLMA 4C9BA 5BWCA 3N86A 4HD8A 4QECA 3U4GA 4MCAA 3NDBB 4G65A 5JAQA 3ITNA 5HKLA 3LP5A 4R0MA 4MYCA 4XDYA 3E5RA 2JKZA 1YBAA 2I7XA 1Z29A 3BIWA 4LCBA 3G0DA 3D4OA 4V39A 3KDAA 1PFGA 1LTHR 3DBRB 1UDRA 2I1VB 3DG9A 3LUBA 2HREA 3B89A 1VA5A 5SZHB 4I55B 1NPDA 3ZE1B 4BQQA 2P9YA 2RJ3A 1XRJA 4DWOA 4G5RA 3GG2A 1UTCA 4QSMA 1KZYC 4G0WA 4FHFA 3K8ZA 4M1ZA 3PWTA 2BMVA 1USIA 7YASA 1T6NA 5I9SA 1PT9A 2W58A 3K0AB 2WKQA 4ND3A 3QXXA 2WP0A 2FOLA 1W9MA 2R1UA 2QTTA 3OCCA 3NRCA 2CXOA 3TMKA 2GN9A 4PBYA 4KIWA 3R5SA 1MB4A 2LCFA 2QMOA 5C8VA 4M0DA 5E3JA 3GGCA 2R00C 3I1JA 3HACA 4GNKA 2Z2YA 4HWSA 1RZUA 4HGNA 1R4AA 4E46A 1E9VA 3IE2A 4MW2A 5TRTA 3WLFA 5JD5A 2HA3A 4NH4A 2XRYA 1OJ7A 4D4HA 2K6GA 3VPCA 3AFOA 4E14A 1NMYA 1Q12A 2OJYA 1Y4UA 2R5WA 5NULA 5KAPA 2VSQA 2YIMA 2V1XA 3L6DA 5LFAA 3LGSA 5AK0A 2AFHA 1K68A 2CLFB 2D7JA 1XOIA 2AXQA 2ZTVA 5KNLA 1G2OA 4Y2TA 1S96A 4FCCA 3K0FA 3F7MA 2N0SA 1ULZA 1Z28A 1XZPA 3D7KA 4JI1B 3ZN2A 2LXNA 3BTUA 4LF8B 4V1CI 1IDOA 3AY0A 1U7WA 5FBRB 4ZTZB 4JWTA 2HGSA 2UZ1A 3LG2A 4BWVA 5JI3E 2WIFA 5KNDA 2PT7A 4RFLA 1X1DA 4UVDA 1DXHA 5HKKD 3BB4A 2W6IA 3JYNA 1Y7LA 3DO8A 4HAWA 2YCLA 4TMFA 4YPVA 4LQ4A 4EFKA 2NV2B 4PCUA 4YP7A 3N53A 1DQYA 5IZCA 1NWCA 3QOWA 2Z9CA 3ZGVA 1KKLA 4GQBA 1OIXA 1X2EA 2I4TA 2D54A 2ORYA 4LE0A 4DRXB 4A6EA 3I9JA 3IFSA 1EFAA 4DKXA 3ENNA 4CEHB 4IZ6A 2LDXA 1RI4A 1W36C 5E0OA 5DOVA 2J7PD 4MUNA 4KAFA 3NIFB 3NBXX 4MKRA 1J90A 3W1VA 2VJKA 1V71A 4RA6A 4PHGA 4EG3A 6AT1A 4B0OA 4KXLA 3KQQA 5IBRA 3GREA 3A6ZA 1KY3A 2B8NA 1DC7A 3GLRA 2VPYA 2R65A 5BW4A 3PQEA 1CS0A 5FI3A 2VDLB 1D1TA 4XOUA 4GGCA 5MDHA 1MX9A 4JI5B 3HJGA 2NSYA 2Q8QA 3GHHA 3SD7A 1W36D 1IQUA 2R11A 4RVOA 4ZZIA 1PX0A 3EMHA 2FUG1 1LPSA 4CQMB 5JW6A 1QV6A 2RHLA 2P65A 1SOUA 3RYCB 3R3VA 4UBIA 4XR9A 2EIDA 3BMQB 2JLUA 1KC3A 2D7CA 2JKYA 4MR8A 3AETB 1RM3A 3IT0A 1UJ2A 2BFFB 3OT4A 1YR8A 3MYRA 1ECGA 3DXFA 3AWDA 1JDBB 2YH2A 4N5IX 2XL2A 3V4PA 2NO4A 2NW6A 2I7TA 1EVKA 3QXHA 1AKEA 4EOGA 1NQUA 2HF7A 1RHUA 2GHQA 1U8CB 4A4DA 2NZUG 2D2IA 2GD1O 4BQSA 5AESA 2JZNA 2YJGA 2GARA 2NZXA 3VUEA 4HADA 3RC1A 3PZRA 5JNTA 4F3TA 3VU0A 1U04A 2YNMA 4L9RA 4LWZA 4OXNA 3FWKA 3WK5A 2Q1SA 3T3MB 2QZJA 2YKGA 1DJQA 4C0LA 2RI1A 3CE6A 3W2TA 4GMBA 2JCBA 3I12A 4E4YA 4YVFA 2AZ4A 4J8GA 3S8MA 2ZCUA 4LSGA 4EKYA 3K0SA 3BJRA 1FQKA 4OQMA 3SKYA 4YJFA 2JIZA 4M1KA 3M1AA 3RG2A 3NHLA 3NBZC 3AKEA 4AZVA 2DXIA 1RM0A 2VPQA 5CXCA 4OSEA 2EU8A 3KUKA 4MS1A 4L02A 3HKDB 4Y18A 4O2AA 2WTUA 1V41E 5JO9A 1IK4A 4UBJA 1T5TA 2FW0A 4RIFA 1EFVB 4BOYA 1EVIA 2IBSA 2VTBA 4MTLA 4Q15A 3ELBA 1SAYA 3PUHA 5K3OA 4JYMA 2AQ5A 3LYHA 3RBAA 3F6YA 1SHJA 2I6TA 3IQGX 4CI8A 4DMGA 3HCBA 4P7GA 1Z6ZA 2JAQA 4D46A 1DKRA 1GT91 2NQ2C 4IF6A 4PGAA 5KNBH 1X1AA 1QCYA 1P73A 2OCLA 5FOTA 2PAFA 2BFCA 4BX0A 2JA1A 4QSHA 2BRUC 4H0CA 4WEOA 4HDRA 3RS7A 1I7DA 2KLHA 5HOEA 3N5CA 2IOQA 1TD9A 1U0GA 2QTAA 3OD5A 4K28A 2R751 3QW2A 4ZOAA 5A2GA 2PMFA 4CLDA 3KIPA 4J0EA 4U1RA 3WP1B 2AN5A 5F7XA 2X0KA 2FOIA 5IEJA 3PC7A 1P1CA 4MVJF 3WK8A 2OMEA 3UJCA 3L0SA 2DY0A 4D3SA 3NOXA 2Y0DA 3K8QA 4CMJA 4Q7JB 3BTSA 2PX8A 1CYDA 3TIVA 2CLEB 3HVJA 1F0PA 4FJ1A 1NBWB 3WKCA 1IMJA 3ZUGA 4C3VA 3EQ9A 3JQ8A 1USGA 4H7KA 5F23A 1T6BY 1PL0A 1DIRA 4B3MB 1IZ8A 3Q9SA 4CLRA 5K0NA 3OICA 2BEWA 2GDJA 4HXFB 3FPCA 1AGNA 1KEEA 2O9JA 3HC7A 2FN8A 4YRLA 3SDSA 3B1FA 1ZD3A 1V5IA 2FSVA 4PIMA 3AYZB 1B8OA 3L40A 5G0SA 3PVWB 3FHJA 5H14A 2FZKA 2VDRA 3GZNB 4C4RA 3DYIA 1Y6GA 1N6EA 1DQSA 1QYCA 2Q3FA 3LGAA 4AMVA 4IBOA 4GXNA 3BWVA 4G6ZA 1G7TA 1Z17A 4CFSA 4EDFA 3IOEA 1YJXA 5AWFC 4IAOA 4ITUA 1INLA 4A08A 1LLUA 5JQGA 3OAAD 1XQXA 4ZCTA 5G1PA 1VPEA 1NWHA 3RTAA 4MI9A 4DEXA 4DLVA 5SYMA 4EUEA 4NJEA 4M86A 4JBHA 1AHIA 3TX6A 1EVZA 5EARA 2QPOA 4EPWA 4X95A 5C52B 4FFBA 4W7HA 3WFZA 2BGWA 1V5GA 4GD3Q 4E6EA 1OF1A 3CR3C 3SQOA 2IV3A 2BZSA 5GZ3A 1VL2A 1BS9A 2P69A 5DHQA 4JJ4A 3D59A 1X38A 4FMCF 5K4AA 3QVWA 1VG0B 1UEJA 3C3AA 3ZE0A 3KXPA 1LQUA 3EFEA 5EMJA 2IEDA 4JSNC 2AH0A 2AG6A 5J4LA 1IN6A 3OZXA 3CSUA 2CCJA 2DERA 4QXQA 3FAKA 1BJTA 3AOEC 1SWWA 4DLWA 3FFAA 2IITA 3DAPA 2COKA 4OQQA 1OWNA 2SKCA 1IATA 2VEDA 2V8OA 3ANTA 1POXA 5G0UA 4LEIA 3H2IA 3RU2A 4JS0A 1W76A 4M21A 3AMVA 4MSUA 4YACA 3G2QA 4V1CA 4Z7JA 5AMSA 1B00A 3RUFA 2A9VA 3EGIA 4OJQA 3TFQA 4FILA 3BJZA 3HUEA 4N6NA 4I5EA 4D80A 1S3GA 5FPYA 1VC2A 5JYEA 3DGEC 2M9MA 1L5LA 1LGYA 2PUEA 4RJ2A 1TQHA 3I9FA 1P2GA 1WUTA 5DX8A 4QDOA 1KQNA 3OKAA 2VQFB 5KYUB 3QU4A 2CLLB 3L49A 6ABPA 3RLMD 4TKUA 1YVEI 5A4AA 1PR0A 3T06B 3AVVA 1ZRNA 4MV0A 5FWYA 4CCAA 4ZODA 4BO5A 1NX6A 1U90A 3VR4H 1E9CA 1RYBA 2XNDD 4LECA 3GRPA 1R0XA 2Q3EA 1FNDA 3E3LA 1U28C 1UBUS 2E4WA 3B36A 4J03A 1ECCA 2C7VA 3QNWA 1SD1A 5AVZA 1HFWA 1SH7A 3OZAA 4QO7A 3ZD7A 3NEJA 4ENUA 3V1LA 4ENSA 4FEEA 3A36A 5NLLA 1RAIA 2PWPA 4BFSA 3GELA 1W9HA 2R5NA 3F0TA 2MYPA 1IY2A 1ML3A 1G17A 3SR0A 3LBFA 4WQMA 2QTVA 4NAUA 3PRYA 1T3HA 1GZSA 5IXYA 1CJVC 5P8WA 5HE9A 1C0IA 2C7PA 1EGHA 5ALWA 4N3NA 2PM9A 4J82A 1L4KA 2FCAA 4PWYA 1BCSA 2R68A 3ILHA 2IH2A 4RV9A 3MJSA 1FMFA 3V7WA 3D6UA 1AGRA 3LY9A 3HCEA 1LQ2A 4FMCB 3FYHA 3HU5A 5TF2A 4C4OA 1TZMA 4O29A 2UZ4A 2H2IA 1Z5UA 2WG0A 5HZGA 1YL7A 3U3RA 4M55A 3F98A 1UOEA 2OB2A 4NHOA 2WFLB 3WQQA 3G9UA 2YWRA 4NULA 2ZATA 4IIHA 5BV1A 4II3A 5MGBA 3AEUA 1CXZA 2P9PC 2AE1A 5L51A 3N0EA 4CI3A 1V7CA 2YOGA 2ZUWA 1FB5A 4CL0A 4AN1A 4S2UA 3C3BA 1VPTA 2GBIA 2O7VA 1E98A 1R88A 2Q6KA 4D45A 5I7EA 4L8VA 1ONNA 3U81A 4RFVA 4BNZA 4AD8A 3WKDA 3NVDA 2YR0A 4D0NA 4F5DA 4AYWA 1Z73A 2P30A 2X42A 1LFDB 2GTIA 5ED4A 1GV1A 2HYIC 3WRVA 5M61A 2VJMA 1TW2A 2TYSB 3LXMA 1S0UA 5DMXA 1YRQA 3PP8A 2IDKA 2WD9A 4G3XA 2VRBA 4E2WA 5JU6A 1V9SA 1RQGA 4YROA 1GPBA 1ODJA 4ZYWA 1O6BA 3X1XA 2P1RA 4OM7A 2VNHA 3C8ZA 3FZNA 4TKVA 2N9UA 3EDOA 2YRXA 1CV2A 3KBOA 5GV8A 2XQGA 2J3QA 5SICE 4HNRA 3KAPA 1D09A 1Z4OA 4G0OA 5IAJA 2FW6A 1UKAA 1QDLB 4EECA 3ZDEA 4Y9SA 1TM2A 3SBXA 3TDNA 1FOEB 2CWDA 4QARA 4ZO9A 4PXAA 2DEUA 1NUHA 2BELA 3PC3A 2BBOA 4NAAA 4GOJA 4Q9KA 4YBRA 1MB3A 4L9SA 3TEMA 5DYNA 3WWCA 1I24A 4AKIA 5COQA 1GY8A 2ZP1A 3D81A 2GK3A 3WLQA 2YHUA 3EA0A 5I9BA 2CLCX 4G5GA 4B2PA 3VHQA 4D6YA 1ANKA 1ISMA 3UKUC 4C6HA 4L51A 4PFQA 3RFVA 3CTMA 4XVHA 1PT6A 1N4DA 1TZKA 4TS3A 3CNEA 2QX9A 3OZWA 1AQJA 4V3BA 3AI1A 1FU4A 1QHSA 2QAGC 3VDXA 2VUTA 2CLSA 5KTTA 5KYTA 2OV8A 4R6XA 4B4VA 4AY4A 2PRJA 1M2VB 1Q7EA 3H5NA 5FBWB 2WIKA 4NOMA 4N6OA 3U4DA 4JD2C 1ODFA 2IELA 4FYJA 3VZCA 3E7WA 3DLIA 5CYKA 2YWDA 1XZ8A 4R3UC 1FX0A 4KVFA 5KYKA 4B2LA 4QRIA 3M3PA 1US8B 3N2KA 2EFDB 1FNSA 4P54A 4FGLA 5C9ZB 3NHMA 4XQGA 4Q3LA 2AGVA 4DTCA 2G1KA 4DG5A 3SFZA 3OKPA 5JS8A 2EJVA 2O5VA 4MVCA 2JD0A 2IPLA 1QGOA 4F97A 3J81g 1IWOA 5B2EA 2C78A 3GQBA 3H3FA 4Y2JA 4JP3A 1CJTC 4NZZA 2EWVA 2CXPA 1NUPA 1JHDA 4FGSA 1RWBA 1ORTA 3RIMA 2FETA 3V2GA 3LCMA 4MR9A 4ZYLA 1J9EA 5I8ZA 1ILEA 1I1HA 3TNJA 2X0IA 3I2JA 3UMVA 1OKKA 2WYHA 2NVOA 1CUHA 1I1NA 1VIMA 2EKLA 3F6SA 3WSWA 2BBKH 3FSRA 1DOAA 4KNYA 5J58A 3X43A 3M4JA 2QUIA 5B64A 3ODGA 3UW1A 4QD3A 1QZ3A 5FV7A 1XCPA 2D5CA 4GP7A 5JXWA 4MCIA 3G8CA 4ADSG 4OX9Y 1NXWA 1IHPA 2JLBA 1L8AA 1ADGA 4X64B 5LQUA 2A1UB 4ZQEA 1QDEA 4MS1B 1JA1A 5C18A 3VH3A 1Z34A 4PQYA 1QHXA 5C2WB 2ORIA 5DBEX 3SNKA 5AKGA 3VDMA 4AYXA 1NR7A 1ZW6A 3SLGA 4J87A 3PEFA 4HYQA 1UWVA 3ASUA 2QW8A 2H4WA 3A4TA 2DBRA 3R7AA 1CU1A 3I2KA 2CO0A 1W5FA 4Z7NB 4GP6A 2C2OA 1GUZA 2GHIA 2OENG 5COAA 1F7UA 3PGLA 2H52A 1FVFA 1UPUA 2B5WA 4WDRA 3H17A 1VRVA 3MGCA 2TRCB 3OETA 4MMYB 4RFSA 1A96A 4OQYA 4GM3A 3KXLA 2ECQA 2AG8A 5BT9A 1EX9A 2IPNA 3C3XA 3W06A 3VVLA 3DVRX 1XD2B 3EMBA 3M6LA 3BYZA 4E32A 3KYCB 4JJGA 2DJIA 3HM9A 3RVJA 4GMXA 1G8YA 1Z2DA 2ACWA 3MA0A 4P5DA 4WK2A 3ZZTA 3OF5A 3WDLA 4EPYA 5KJCA 2JJ1D 3PL5A 1NLYA 4B3FX 4Q7QA 4KACA 5KKCA 4TYQA 3TBKA 1I9GA 4YMLA 1II8B 5B5SA 3AUKA 3V34A 5A05A 1VL8A 2QX7A 4REMA 3Q87B 1ZQ9A 1VG9B 1T2UA 1VL6A 4U6NA 3FPKA 2CYBA 4G63A 2WJJA 3CB4A 3G68A 1JG3A 2EIEA 1ND5A 2JJ8A 4RENA 1LPMA 3EDMA 4ZFNA 4IO0A 3KZVA 3HLKA 4KXXA 3RSFA 3VYVA 4M46A 4NNOA 1NKVA 4QYSA 4K6FA 2BEWB 3OEYA 3PEWA 3KAQA 3S7ZA 4XQCA 3C15C 3KEFA 4AS3A 3ZW8A 1T35A 4L1MA 3RROA 3AP1A 1GUFA 4MICA 4F12A 5LP1A 4U63A 4LVUA 5B2ZA 5EE9A 4EQZA 3CJTA 5B6PA 1W30A 1ZAKA 1OA1A 2YMLA 1Z26A 5HIAA 1XX6A 3ORRA 1J49A 4BVGA 4HVAA 4DCJA 4FWTA 4KYUA 1YFJA 4A91A 4OAQA 1DLIA 1XMJA 5A7HA 5AH0A 4B5KA 4KTTE 4DRZA 2X8JB 4E88A 1T4MA 1CUUA 1NLMA 3FPFA 3ZWAA 1PJ3A 4X63A 5KYNA 2C77A 4F3CA 1JT2A 3W9BA 2D8AA 2WAYA 3NKLA 4QE3A 4BRUA 3AESB 2R9VA 3HB7A 3UICA 2XYPA 1P22A 1H4TA 3BMNB 1NN1A 5FEUA 5LZ7A 5BOSA 1GCOA 3HA5A 3MCZA 1XELA 2KHZA 4R8LA 3AP2A 7GPBA 1YWGO 4L3GD 2IUTA 3DKPA 2ERCA 4FFBB 3T35A 4BNDA 1FU8A 2BFEB 4BFTA 4QDUA 4ZK2A 4IXTA 2CVQA 4DM4A 1UH5A 1II0A 4FFDA 1Q2XA 1NMEA 3HCWA 3VI4B 1TZ2A 4J16C 4ZO6A 2FMXA 1IPEA 2V7EA 1NVEA 3LFHA 3CIKB 1XE3A 4AJ9A 4LGCA 1Y5LA 4A0RA 2WWRA 2JC3A 2O0MA 3WL8A 2H9IA 1M83A 4S1TA 5HJ7A 1QF6A 2GPWA 2PY6A 1AUQA 3PITA 3LCRA 2FPKA 2AA3A 2GCIA 3RMZD 4A2LA 1NHGA 1YNSA 3TR0A 3PDIB 3PHHA 2P9TA 1ZOPA 1BJRE 721PA 1I7NA 2FR1A 3LY5A 1ULBA 2YJTD 3FTEA 1N2SA 3QEMB 3S28A 1E79D 5JXHA 2WJ3A 3LPLA 3G82C 2O14A 4F60A 2MSDB 3GUCA 1R0WA 2D1TA 4B75A 4UZSA 4TLBA 2XTNA 3CW2A 4C4SA 1VHLA 1YZKA 5A9SA 4FZ3A 3LRTA 2FDRA 4JVOA 2FH5B 5KTRA 2O8NA 1DAMA 1A4XA 2I2FA 5BR1A 3SYRA 1JHQA 4HTAA 4XGIA 4OVKA 4ZT4A 3QBJA 3O8DA 2Q46A 3ZDFA 1WR8A 2PQ0A 1Q1ZA 3CX8A 4NYJQ 4PX5A 5EJ8A 1T9KA 1G6HA 4QUGA 4AQ7A 2RHRA 3IRUA 1R4MB 3WGHA 1YB2A 3COVA 4QM6A 2ZS7A 1GFSA 4AULA 4KG7A 1CKEA 1CZKA 3GNSA 3EVGA 1ZICA 4AZWA 4HB4A 1YBHA 4QRDA 2XEXA 3GFRA 4RJJA 1G8HA 4HDKA 4Q21A 4HH1A 2PGJA 3QPUA 1VYTA 4D4LA 2DR3A 1ZUNB 4GI1A 2HJWA 4OBXA 5K6AC 4U0KA 4CM7A 3RSLA 4NONA 1J0XO 3G89A 2R6AA 2GN1A 4ETNA 4LOKA 2BGRA 2QN9A 3DHEA 4QFDA 4WGFA 4YCJA 1U2EA 5IAEA 4EZIA 2KM1A 3OU6A 4G0XA 3A6EA 4FHDA 1CIJA 1D1QA 3NWBA 4GBGA 4ZVPA 1HWYA 5CDSA 2VDPB 1QIJA 4NE2A 1AV7A 2HOQA 4K0KB 2JGDA 5DB4A 4A82A 2RAVA 5A3RA 2BSAA 4F7WA 4UVHA 2G7MC 5KHLB 1UZMA 4B48A 1EK1A 1OPXA 4W1QA 4R9RA 3QP9A 4K1XA 4NJMA 1IEXA 3SHWA 3A3OA 2HUPA 3M5PA 1MJGM 2O1EA 1HT2E 2CUZA 1E7QA 1K3IA 4GC5A 3R3UA 1Z4LA 5KNCD 4BO9A 5H02A 1SUWA 1GQOA 3JQAB 5DLYA 3NT4A 5DH9A 1NT4A 1B6GA 3RE1A 4GPZA 3EZ7A 1NVVQ 2DFTA 3ZHOA 4DMLA 2GFIA 5C1BA 5FI5A 1O0SA 4WY2A 1SCDA 3KV1A 3DE5X 3TQSA 3I0NA 4ID9A 3VOAA 4J4BA 3RYHA 1BRTA 4YJGB 5M5SA 1CRQA 2KBFA 1KP9A 3NBQA 2JAPA 1QX3A 4R1PA 4YUWA 2Y71A 1PTJA 1J70A 4KQGA 3I4CA 4JLSA 2UYCA 1FDTA 3HO6A 5BMVA 4TKVB 4M1TA 1SXJE 1YR3A 4U5XA 1ODSA 2NZYA 3PQDA 2W4IA 4ZT2A 2R97A 2HTFA 3EGXB 1IUNA 2DKOA 4Q9LA 4KZPA 1VIVA 2QD3A 5DOZA 2WSYB 1PR1A 4OB6A 2GD6A 2EERA 2AKYA 3AHDA 1D7OA 1R5JA 1NQ5A 2W7TA 2GPAA 3SYTA 3NAMA 4R0VA 4AKEA 3NBMA 1KS2A 4CMCA 2A8YA 3NNSA 1H65A 4BBPA 4MS4A 4DSZA 2BI4A 4TWBA 1UBHS 3SF8B 4WLVA 5B1EA 5EWMB 4BCBA 1RXIA 1SC6A 5E4TA 3HXTA 3MXTA 1YA4A 3ENZA 3OY2A 1MJHA 2PTGA 1E3LA 4CKWA 3O2JA 1H8EA 3GA0A 3H6KA 1GITA 1Y5MA 5BN5A 3SN6B 4XLZA 3S2EA 4BYMA 3J81k 3ZGZA 4YONB 4LWQA 3CLVA 2QSJA 2PS1A 3HJNA 3GRVA 1R6VA 4NV1A 2QPAA 2C4WA 3FH0A 2WDPA 4YJ2A 4HWRA 4IDNA 2VYND 1YE8A 3AR9A 1GEGA 2DTEA 1R18A 3T6KA 4NE9A 3LBAA 1OOEA 1V0JA 4MQEB 1OJLA 1H9AA 3RC8A 2BSQA 3GLHB 4ECEA 3GG9A 3QFCA 4MRMA 5DP1A 2BGKA 3IUJA 2OLJA 3C98A 3DPUA 1D9ZA 1V16A 3IR7A 2B2CA 3UAOA 3W34A 4WKCA 4P22A 1BGXT 4RH3A 3E4DA 2J45A 4O4HF 1HYBA 2PYZA 4UOEA 3RK0A 1QHHA 4AURA 2D0PB 1CUWA 1KSHA 4B31A 4H1VA 4FKBA 1EBUA 1FNMA 2HJBA 2I34A 5JYCA 4D8UA 4DW8A 3RC7A 2CBZA 4JP1A 2D2FA 1EA5A 3UMJA 5DLEA 3T1TA 2JGJA 1K6XA 3JVIA 3OFNA 4BQNA 2BM1A 1J5XA 5GSAA 4G1FA 4RLFA 2QT0A 4ALLA 4R83A 1NBIA 3WB1A 1UBLS 1F2UB 3NHAA 4TKLA 5BR8B 3JAWA 1CEXA 4NCHA 1CUCA 4R9SA 2AB0A 2G77B 1I4LD 3SIRA 1PQPA 1KP2A 3A3YA 8OHMA 4XYIA 3JB9L 2I65A 1E2KA 3LQ2A 2CLOB 1Z6PA 1KQPA 1WBDA 2XVZA 3TPFA 1K7EB 2NU6A 4CY1A 3PNVA 3KUUA 3LC2O 5AVVA 2AE2A 4JZKA 1P29A 1QQ7A 4GNRA 5HIKA 4ITVA 4Y1EA 4ED9A 5H59A 4O4IF 3U3ZA 5IAGA 2H3HA 2PJUA 1FYDA 4C7JA 2AN3A 4JENA 5EAPA 1HTBA 4LS3A 2W2MA 4R1MA 1V5EA 3ORHA 1DQNA 3NTVA 4D9NA 4HL6A 2HEIA 1TAGA 2GA9A 4XQEA 4NY1A 5DNDA 3CXRA 5TARA 3CH7A 5CCBA 3E8SA 3D2LA 2ZJYA 4EI7A 1DAKA 3DCNA 3SJCA 2ZK7A 2WILA 3E9CA 1NVFA 2QV7A 2P2CA 5LXTF 1ZGGA 4UPEA 5HBRA 2HNBA 3L7IA 4FSDA 4JLUA 2WJZB 3IUEA 2BBWA 3FXAA 1Z4IA 3K71A 4UMEA 5DM1A 1B14A 4QGHA 3MTBA 1X7XB 3WIOA 2H6KA 1FYFA 3J81A 1QORA 2HYEA 3SBOA 1G7RA 4DMRA 1YDMA 4PCLA 1YKFA 4RFSB 3ZCSA 5JWRA 2WBLC 4BLPA 3I8OA 4L7QA 4O4HB 2X0JA 1XZKA 3GJ4A 3LSTA 1HQDA 1N8SA 2I7VA 4XCVA 5JVDA 4RHXA 2J5KA 3IELA 2BI7A 1JZSA 4FLFA 4HAOA 2L19A 5AW6A 2CNWD 2OORC 2WWTA 3R7LA 3CKKA 2EZ4A 3LX6A 1QRRA 1WABA 2BKAA 3BRCA 3PR3A 1MA0A 1NATA 3CBQA 4D0RA 1XG5A 3OIUA 1UDAA 3FPEA 3TUIC 3MJDA 2O1XA 4ZYTA 1M54A 4A1OA 1MT3A 1EIWA 4MDFA 1Y8QA 2CXQA 2R2AA 3FRIA 4E6PA 4J7UA 3NVQA 2FCRA 2IDJA 3VI3B 4Q16A 3W5UA 2UU9B 1JU9A 5ECYA 3SXPA 1KVQA 4GKAA 5T57A 4YT2A 3PTZA 3QENA 2VT7A 4KQ9A 1JXMA 4KRFA 4Q7LA 3HN2A 2FSIA 1NUTA 5U1PA 3EASA 1E0JA 3PNYA 4JDUA 4D43A 4IO1A 3VC2A 5BPFA 1BXZA 1HNWB 4O4IB 4Y2SA 2CYAA 1P1JA 1A5BB 3BE8A 5DWQA 5T4FA 5GM2A 3HJFA 2A88A 1S2GA 1CFJA 1YRYE 2WB4A 4DLKA 4IOJA 3BSYA 5F1PA 3JYQA 4WJKB 5DCUA 2BKLA 3RRZA 1GGFA 3K8YA 4INJA 3GI1A 4NYMQ 2DZDA 4PG8A 3PKJA 2K7FA 3PUIA 1QNFA 2BFWA 1PR3A 2QW0X 5LXTB 4RS4A 4QYXA 4L6IA 1VHTA 1H1LB 1PGOA 3RSHA 4D96A 1FL9A 4RM2A 4TWRA 4I9FA 3FOAA 2I22A 2VK2A 3OQJA 5DLDA 1ABBA 4O59O 2PUTA 3CURA 2JHFA 1AXEA 4PSCA 1IBCA 5C7IO 2K2WA 2AFIA 4V0QA 1C3VA 5AUQA 4MMZB 1D6MA 5FO0A 2CV1A 4FEAA 4DR4B 3ND7A 4ES6A 4EUHA 5IC5A 2XB4A 4ZREA 2FRXA 4Q24A 3I3SR 4N65A 3ZGXA 4FHGA 4WXPA 1CUVA 4PS0A 4E09A 1JTEA 3P2EA 3BDIA 3FVQA 3U31A 1DIHA 3BC1A 1A5AB 5B4TA 3C3PA 1QO0A 3IQWA 3PX7A 4HYYA 1H6DA 2FPMA 2F4VB 5B1HA 2OCXA 4B4UA 4NV0A 3PT5A 4RC9A 2MT9A 5IVHA 1J0BA 1R6AA 3JVUA 1ORRA 5DULA 5AI8A 4H2DA 4J0WA 3UJHA 4WERA 3IOYA 3AUXA 4RZQA 1Z8DA 2X6QA 3DMTC 1U0SY 2GN4A 5DIFA 1E7SA 2BDUA 2R44A 4Y2GA 2XJ9A 2EBFX 4H6WA 1EGQA 3SBDA 3DE2X 4J0HA 3IHTA 3H2SA 4HT3B 2IFTA 3RBVA 1B15A 2EL9A 3CB2A 5LQJA 2WSMA 3UJAA 1M66A 4YASA 2BMWA 2A67A 1LDBA 3B20A 2QMHA 3EXHA 3NQ41 1TIPA 5JNWA 8ABPA 2DG2A 2HADA 1JLRA 5H0IA 4FOOA 4IF4A 5B4UA 3IURA 3RGGA 1E1NA 1C8BA 5TMPA 1QFZA 1GAXA 2P5YA 2JFGA 5GXIA 1M2OA 4MRPA 2KYRA 3IQEA 2EGGA 1XTZA 3AFGA 5EP2A 2E4YA 3T7RA 2RKBA 1FBTA 4L0QA 3V4ZA 2Y0EA 3A9UA 2ATEA 1GA4A 3S2YA 2AOTB 1SBHA 4MW1A 2VUUA 1P1IA 2QM8A 1DRWA 5IABA 2Q2NA 3D8NA 1S1CA 4L3HD 4DL9A 1OU4A 4S0XA 1OE0A 1QRAA 2EYQA 4BX9A 4ZGWA 4UQOA 1HOTA 2I4LA 3DEZA 1M67A 4ZQBA 4KR7A 3RWMB 3X1WA 1B6TA 1S2LA 1O94D 4X54A 2RDMA 2WAAA 4EEZA 3N1UA 3W5SA 4NR0A 5D86A 2ZSEA 4KJZA 1KMQA 1RJWA 2CW5A 3T5GA 3DAHA 4U7GA 3OE7D 3OPQA 1P1HA 4P0TA 2MYNA 2RGNA 1KI3A 3CKMA 4H7PA 1L8XA 3PNLA 1PX2A 4QLOA 2B37A 3QWBA 3LQ4A 1PVVA 3PE4A 3PPXA 2PV7A 4HQRA 3TINA 1BW9B 2W70A 2J67A 4UPVA 4R69A 4DA9A 4D9SA 3OFVA 1MX3A 4WLEA 3ORFA 1H5NA 4HWGA 1TEZA 4HDNA 1YCDA 1G20A 2WIBA 4P2BA 3I64A 3U80A 1RHKA 3BCSA 2OCKA 4KO1S 4S12A 5DHAA 4RHTA 1GPMA 1FRQA 1QE5A 5B6IA 3MAAC 4JBXA 3ZDXB 1W46A 2JRLA 1P7ZA 2Q2OA 2VNIA 4J91A 2OFWA 4ZI5A 2J56H 1KJ8A 4GYKA 5DNWA 3JPYA 1HPLA 3X1YA 4HTFA 4YCNA 1YQ9A 3IH5A 5ALGA 2PANA 3T7EA 3WLPA 3A3NA 4FXOA 2BHNA 3VQTA 3M33A 3V3KA 4CUZA 4YP6A 2IH4A 5K51A 2A3RA 5D8DA 2RGDA 3G7NA 3V46A 4BU0A 4D41A 4RLSA 4CFZA 2CV2A 2IYNA 3ZX4A 2ZTLA 3RT9A 4I1VA 4CI2A 3PHGA 5KKAA 2I2DA 4B80A 1YI0A 1BFDA 2ET6A 4NFYA 2PA0A 3EWIA 1RLIA 5E6UB 3RS8A 5TQ2A 1Z75A 3E1KA 3MOGA 3FCSB 2GGSA 3F3MA 4JBGA 3IIEA 3I04A 1K8ZB 2ZJ0A 2X8LA 3EHEA 1DCKA 4DR1B 5DIZA 2GBCA 4MI3A 3THXA 5EZYF 2YWGA 4RAQA 1YDFA 2KJQA 1NVAA 4TQGA 4YVDA 2CF6A 1U0LA 2DPYA 1XZNA 2ECPA 1WZ2A 3F5FA 5G0VA 3WIUA 3T1NA 4UM9D 3IR6A 4GYJA 4ERYA 2I8AA 5TY0A 3REFA 3BL8A 3AONB 5CTAA 2J9RA 2PZLA 4N41A 4UFPA 3CRVA 1M3SA 2D1SA 2IU3A 3A70A 1EM8A 2A5DA 4J90A 2WZQA 1HT0A 3WGLA 3DL2A 4DVJA 3FKJA 1PFVA 3ZH2A 1H5UA 4DCGA 4CGZA 3GOQA 1XJQA 2VT2A 5BVHA 3HR8A 3WYDA 5BUCA 3FZYA 4U4AA 4KP7A 4KOAA 4UTNA 1O96A 4M0EA 5HG0A 4PO3X 1HRKA 3ZEIA 3KVOA 3QOXA 1RAGA 1W0KA 2V7PA 1HG1A 4PYQA 3EQ2A 5AVYA 3SE7A 3PKZA 1YE3A 2E4VA 5C1PA 4N18A 3ABSB 1O5IA 3QRWA 5ALMA 1EAMA 4C1BA 2CN1A 3NWPA 3LBHA 2QLTA 3KYDA 1JP7A 1AD2A 5F76A 1RWVA 5MHTA 2EP5A 4LRWA 1GNTA 3PVUB 5D51S 2V3WA 1GGHA 4D4MA 2AUMA 1B93A 1RI1A 1SHUX 5F51A 1VPWA 3SYMA 4DDHA 1XQ9A 1J0AA 2VS1A 3W79A 3GLSA 3UJPA 2H63A 5I45A 3PE6A 1NI4B 2IVFA 2Y1XA 1A9TA 3DR5A 3GMTA 2JCXA 4BNIA 3S5UA 3H0EA 5EZYB 1NFRA 1S4UX 2P9NC 2H92A 1N32B 2B0CA 3RVBA 4D9MA 5DWVA 2O2HA 3N70A 4YUXA 3DUWA 2GEFA 4P0PB 3GCGA 4E5ZA 3R7FA 1JQLB 2FG5A 3QH4A 1N6LA 2QWXA 3UBTA 1O54A 4QFCA 1R9GA 4BN4A 5GMOA 2O0JA 1P9NA 2B8EA 1RJGA 5AM1A 3WMRA 1RYHA 3KJXA 4PZLA 3TQIA 4KQFA 2XDQA 4NHEA 4L9WA 1FY2A 3MYYA 2IHKA 1QFMA 4E5DA 1JDPA 4FW9A 2CNNA 2ZSKA 4S04A 1EE2A 2ONZA 3UAGA 2X77A 2IXBA 4LYYA 221PA 3DTTA 4W1PA 4DFDA 1G6KA 5L95A 3B2NA 5AK3A 4BMVA 3N0WA 4IIYA 2J30A 3AU8A 3I6QA 4WT7A 1LDMA 1N5JA 3VJRA 5E6SB 3UJNA 3OM8A 5EIFA 5FWXB 3NEPX 3KKLA 1XZDA 5JRJA 1PQ4A 2R3SA 2QVBA 3OMLA 1S2NA 5CH5A 2HTEA 3JVVA 3DQPA 1FIUA 3H5AA 4QULA 3G1WA 1H2HA 3KT8A 4NZYA 5TS3A 2ADFA 3GPCA 2GB4A 3IC5A 3DM9B 5CYFA 2JI7A 2R7NA 3L18A 4IZHA 4KE6A 3ZJ5A 3GJZA 1GG8A 5AK5A 2NUAA 1YASA 5FQOA 1ESEA 3JASA 5ENDA 5EMKA 1K3FA 3U1BA 3KWFA 1PZXA 4Q3AA 4DDVA 1VMKA 4Q1DA 1ES9A 3N8IA 1L4UA 4IDFA 4A11B 4CKXA 3K1ZA 3SSNA 1EGMB 4EHAA 1I4OA 3VPHA 5TNXA 1MQSA 3I8EA 5ADWA 2E0IA 4DBZA 2OHOA 2P2SA 4N8EA 1U5CA 4LGVA 1OY1A 1YIDA 4GM8A 3VV3A 2IHUA 4CF5A 3EG5A 1IL0A 2HKRA 3DEAA 4KFRA 1IXSB 5TS2A 2I66A 2I3TA 3CF2A 4HRVA 1I6KA 4TWIA 5B3KA 2EBHX 4GZ5A 1XEXA 2HLDD 3O2QB 2IIVA 5ESRA 4QICA 1MQ8B 3RRJA 4F84A 4QOSA 1G21A 1EJ0A 5EGNA 4PM4A 3PUZA 3GN2A 4BJHB 2W6NA 2ZJ5A 4X8HA 5TC4A 1QV7A 4DB4A 2WSIA 1R0LA 2A2ZA 2RK6A 3QVKA 3DW3X 2ZSIA 1O3YA 1ECJA 2HMWA 3ICCA 4O9DA 4LNUA 1ZJZA 4G97A 3STUA 5LD2B 5LQSA 3SJAA 3IHWA 1YUNA 3PC8C 4W1SA 3MJRA 4XI9A 2YFQA 1WZCA 3WGZA 3GEDA 3EI2A 4QTTB 4LXHA 2MTBA 3U49A 5A1TA 4J1TC 3DV0B 5KHAA 2C1EA 4RVFA 3WWZA 4W9NC 4HSEA 5TGDA 2NU8A 3V4RA 1R0SA 1G5TA 2QLBA 1QZXA 3ILYA 2HMTA 4U2KA 3D31A 4YQYA 2MHCA 4XB2A 3ROMA 4YUAA 1ZPDA 4C6RA 5EJ5A 4B7ZA 2QT9A 5KQPA 3GH3A 4JSPC 3AKDA 3JROA 1V6CA 4WTOA 4K9DA 4PG5A 1MJFA 1AC5A 4GR9A 5IN4A 4QRJA 2IBMA 3ER8A 1EBFA 3MHTA 2EF0A 3HYSA 4M7OA 3D4PA 5A71A 5JH7A 4PSDA 3L41A 5AP9A 1OFIA 5C46F 5C5IA 4Q3KA 5F2OA 3P9YA 4Z1OA 3DFMA 1EK6A 3U61B 2V5UA 3COSA 2R8YA 3EVBA 4PW0A 2VKQA 3SHFA 4B2IA 4PZCA 2J32A 3DBIA 1Z5GA 4MQUA 4BMCA 1NW4A 2Y1OA 2PKQO 2B0JA 3UV6A 1DJMA 4CMEC 1BJKA 4LRTB 3P2OA 4C4PA 1AKNA 4FT2A 3KVYA 4NU0A 3OP1A 3WGGA 1X42A 2CNBA 2FRVA 2Z0MA 4O3FA 3KWMA 1GPWB 4Y9DA 3HPQA 4FONA 4HJXA 1K6EA 2NZWA 3I5UA 3P2IA 3FJYA 5LLTA 5CLHA 4BMDA 3RAPR 3ZLTA 4X66B 3HCRA 4YQEA 3P9CA 3HZHA 1WZEA 3NORA 3CC8A 2IF0A 5H4HA 1SEPA 1ZSYA 3H1GA 3VGPA 4JBIA 4CRWB 2E49A 1BOFA 2ZUBA 2A0XA 3ER6A 3DMGA 1ZCFA 2AFHB 3B1XA 4IDPA 1M6NA 1ZR2A 4DREA 1I2DA 2W98A 1X6VA 1K7FB 3K0FB 2ILTA 4P4GA 3LQFA 1UKYA 2CLKB 2Q3HA 4UREA 1Z68A 1P4JA 4GUAA 1L9XA 1Q50A 1YCHA 3IS3A 2CDAA 5DM2A 1M8GA 1WD5A 4BP3A 4EMBA 1AGYA 4K9MA 4LXYA 2UZ1B 3AHFA 3CPJB 4I2VA 5FUBA 4Z4GA 3FNEA 3S1AA 3IT2A 1SC1A 4UOZA 2ZB7A 1VI6A 1K4MA 4D8VA 2GM9A 3MT0A 4PFSA 4PFKA 3K9GA 1IH8A 4UUOA 5B1IA 3VDQA 3GFOA 4OGFA 1FJ2A 1U3DA 1SUPA 5HIJA 1GNPA 1P44A 1X13A 1P6UA 4GQBB 1SR8A 2ZRNA 3ELWA 1CRZA 3BGSA 2VA8A 3AR5A 1L5QA 2J3LA 1T3TA 2QL9A 4IIDA 2WW8A 4MV5A 4MINA 3V80A 2F59A 2VKTA 4N12A 2J9GA 5HUJA 1PJBA 2RSLA 1QK5A 3OEHA 3VOSA 2H18A 4DMCA 1O9GA 4EW3A 5ICCA 3LNCA 1P0IA 4RA6B 1CVIA 4LSZA 4O2AF 2VDWA 1KE1A 4QPDA 1J5EB 1F8GA 1LS1A 3FCXA 3VNVA 3EW7A 1CS0B 3DKIA 3AVUA 4MV9A 1BOOA 2QENA 3NOQA 3H7IA 5CXQA 4ZRNA 4TROA 3MB8A 5A4JA 2Q29A 3UK7A 4DJDC 1Z5NA 2OE2A 4IMMA 4EATA 2VP2A 1GKIA 3PEUA 5AJHA 2ZPTX 1C4OA 1IZ7A 4E4TA 1CY1A 1U3CA 5CK5A 4ESHA 3IP5A 2G0TA 1RWNA 3EFHA 1YGPA 3VNUA 2VYQA 2GSWA 3TI9A 4R40A 1UANA 5M3BA 4U7AA 4TGLA 1EXDA 3N0RA 5FULA 3ZXYA 5G41A 2OHGA 1Y1RA 4MR8B 3ZU2A 3KFVA 4AWAA 2WUVA 4M8IA 1T2DA 4Z0PA 4RHFA 5L4NA 4LJ6A 1T4BA 1U81A 2Z1NA 4PCVA 3V4PB 4UTRA 4EW6A 1JIJA 5HWSA 3DYVA 3K5WA 4A7JA 3ZOKA 3HSKA 3LC1O 4Z4IA 4R1UA 3BWMA 4BGEA 1ZUD1 2M6SA 1FRFS 1JL3A 1A5ZA 1MG0A 3Q10A 5IPFA 5FQDA 5DM4A 4A2MA 5IEBA 2QSUA 1WEHA 5EQDA 4DNPA 4LK2A 1HLFA 3G88A 3ETNA 2KS6A 1L7XA 2HSDA 3JS5A 4X71A 3QYFA 3C1OA 1SZCA 5C7LO 4RTLA 1E6MA 2J9FA 3G23A 2ZIVB 2JLZA 1JPVA 3TW4A 4G25A 3OOEA 1DCTA 1GU7A 1OVGA 3DMFA 3WIBA 1GLGA 4DCUA 1EX1A 1OW3B 4YJFB 1YK1A 1BEZA 2VHEA 4UUBA 4MIOA 4GGOA 2CFRA 4DEVA 4ZHQA 3TNYA 1LLQA 5CXCB 2YHAA 2ZUCA 3LK6A 3LECA 1RYZA 4IG4A 1TK3A 3VR5A 3G0CA 4G5QA 4O2AB 3WYGA 4HZGA 1C3LA 3BULA 3E03A 3QBDA 3JV7A 2YWXA 5JEDA 4KLZA 4FUQA 3ZKAA 4GIBA 3RJ9A 4K7JA 4YP9A 3GPLA 2VTBB 1P18A 5B1YA 5TDHA 2H2AA 3IP8A 4PLZA 4KOEC 1FUUA 5T5QA 3T12A 1SVWA 1WCWA 3FGPA 2I0RA 2E55A 4MUIA 2PL1A 2R84A 3VO9A 3A1WA 5JQGF 2G06A 3TIGA 1X1BA 4J1NA 1BO6A 1IM8A 2FYTA 2BFCB 1ZEJA 3NKVA 3SHOA 3DHWC 4C78A 1HA3A 3OKCA 3RK1A 3EWEA 4HDRB 2QPLA 2FHSA 3WK6A 1CJKC 3E4CA 2HF2A 1YVUA 3EXG2 1Q2UA 5H82A 2IH5A 1GZVA 1OTYA 2PVPA 1W34A 4F9TA 4ZICA 4XGQA 3IBSA 1E92A 5G2OA 5IH3A 1OD6A 1H94A 3L1IA 3T3DA 2FF5A 2WE8A 2ODBA 3OIDA 5DYTA 1TA0A 3R9IA 1Q0TA 3BXOA 1VSBA 5AKJA 1OROA 3L9XA 1P1KA 2J59A 4E5ZB 1GL3A 1B42A 5LMUB 4RPLA 1LDGA 4Z6KA 4WZBA 1T8YA 1UDCA 2XKJE 3G0GA 1DWPA 3JQ8B 4BAUA 4DJ5X 1XTVA 2IUEA 4YV7A 1T5BA 1GN9A 3KB8A 4TYPA 1VJDA 4YMUA 4CLRB 1YVDA 2IHJA 3FOFC 3EAGA 2D0OB 2QTHA 4QJ4A 4FFMA 1KEEB 3IBYA 1RFGE 2MCFA 3OZRA 1CDDA 1T8PA 4DQXA 4XPIA 4JL5A 1IXKA 3INNA 4E0BA 4UE6A 4IOLA 2VDRB 3Q5DA 1UAAA 2XAAA 4LRQA 4I1SA 1JDJA 5A1JA 5JSQA 2VH1A 4KQIA 4MO9A 1PQUA 1H2BA 2MMGA 4G24A 5IJWA 5JAIA 5KJ1A 1CG6A 4ZT3A 2R6R1 3U6BA 2QM3A 2F3PA 5JCPA 4ZEOA 1SD2A 4A08B 2QTFA 3X0DA 2Y93A 3G2MA 3ILSA 3ZTYA 1AU9A 5JQGB 3RVKA 4Z2AA 5LDGA 3R74A 4ZZ3A 3QKUA 3PRHA 2ZRFA 3EZXA 3AOEA 4NJEB 1NONA 4TQ9A 3N8HA 5AHXA 1IN8A 2V0CA 4PLCA 1TJPB 5FDFA 4D3YA 5E8RA 5LL6P 2OXCA 4IIXA 1E2HA 4J3FA 2O3SA 3LX8A 2P2YA 4KXVA 5H8WA 3L2OB 2Y67A 3ZE0B 2D2XA 5EMJB 4CY5A 4DNWA 1TMGE 5CHEA 3HCFA 3RRXA 3MRVA 3V8MA 1KARA 1CHNA 2WWGA 3PU6A 3ETEA 2A9RA 1OAAA 4OKSA 4KXQA 2FSFA 3K6SA 4PO8A 4ZVTA 4DJAA 1T8SA 4GYWA 4V1CB 2H6QA 4AFNA 3FFTA 2AKEA 3DCIA 2GCNA 4UAVA 1R8QA 3QMPA 5J43A 5ALZA 2XAUA 4G8DA 2ZFUA 4TS4A 2X41A 5IUJC 4AL4A 2VP0A 4HGYA 1O5TA 4L9AA 4TKUB 4IWNA 4KQEA 3V2HA 3OIFA 2HCBA 3S27A 2EKDA 3NIGA 1C7FA 5FWYB 3GGGA 3OLVA 1UK6A 1XDGA 2W00A 5DWDA 1CQPA 2ZT5A 5LMZA 4CN8A 1VBMA 4LOHA 3OE1A 4R8MA 5AW2A 3RRMA 2C3OA 1RQRA 3PYMA 3TE6A 1NGSA 4EUSA 3P2KA 1L5MA 5GIPE 3S6JA 4GFDA 3QWHA 4CI0B 1P77A 4FMBB 3OQBA 2EFEB 2D5BA 1S3IA 3VNRA 4BNXA 1DX4A 3SSMA 5AKLA 4KLNA 4E7OA 3I09A 1ZN9A 1P7VA 3PDHA 2IURA 2X0RA 3CLSC 5DNAA 1H23A 2QTVB 1SKBA 3SJLD 3DBLA 5CLLA 2X4LA 4ZHSA 1W4LA 4H18A 4X84A 3AR6A 1FS5A 5LIPA 4H4CA 4HATA 1WVGA 4KWEA 2EVWX 1J8YF 2PM9B 1U3GA 1U1DA 3CZAA 1BCSB 1Z6AA 1Z15A 1HBJA 1E4EA 4C7OA 1OFUX 4Y7DA 4KRYA 3E9EA 3CRZA 5DGHA 2FXVA 4YMVA 3CLSD 3KR0A 3PSAA 2JGKA 3Q8XB 4A2QA 1PJ4A 4WOPA 4UAUA 3V7DB 3KQHA 4TMXA 5JNLA 1FUYB 4MWTA 1BA2A 2CNDA 4W82A 4GG1A 4CIAA 2XYIA 1YAHA 4IFIA 4JUCA 4MYRA 4P4TA 1BN6A 3ZVKA 5L7WA 3HRHA 1M2NA 3EDQA 5T8KC 2MJLA 1DBRA 1XLVA 3ZE2A 1HKUA 1NI5A 1SQGA 4HRYA 4BAZA 2HJVA 2Y2VA 3AEUB 4IKEA 4Q1EA 3TFWA 3X1DA 2B9VA 3RJZA 4M38A 1A4RA 2DHQA 3AFCA 2G70A 2VF7A 2RIPA 2EIBA 2PEZA 4HNAA 1DG9A 4M7WA 1H2AS 4JUAA 1TCUA 4C6SA 4UTZA 1N0IA 5JSHA 3A9TA 4A8TA 3A3KA 2IXEA 3E1SA 4QDXA 2RJOA 2HXSA 2VJMB 3FPAA 4HN9A 3NPMA 1XAJA 1ZKDA 3DDNA 1SXIA 2VHXA 4ZP1A 2V98A 3ZYCA 4OP1A 1T5SA 1REQA 4TV8A 1ZXLA 3TLMA 1LBSA 4ABTA 4BZPA 1QH8A 2B4QA 2OZPA 4IRXA 2QMEA 3JD0A 1HEUA 4EL0A 4TQUS 3HSYA 2X1HA 1IXRC 3CG4A 5M5TA 2QR3A 4HLCA 2V3VA 4IP0A 2YV5A 1AGPA 2RE8A 5HA5A 1F5SA 4D8WA 3AXTA 3WGMA 4MDEA 5TGZA 4KFMB 5HE1B 3WRXA 1W44A 2OWEA 4X91A 3WI7A 4CTJA 2Y1CA 3OT5A 4OBBA 3REGA 2NN3C 2G6BA 1JH8A 1F0YA 1DRKA 5JJ5A 4XSHA 4PSVA 2QZ4A 1RWPA 3ELUA 4AMUA 2HMYB 1JQ5A 3VC7A 4KIUA 3BZWA 3HPRA 2EWMA 4G4SO 4Q34A 5K8JB 4A2PA 2QYOA 1F2TA 5CFOA 1W6UA 3RFGA 3WLSA 1HMPA 3IAM1 4V0NA 3CUTA 4FYPA 1Q0SA 3OSZA 1PWYE 5ESWA 3CONA 5FLEX 2WF5A 3ZCXA 1R9MA 3HYLA 3GVPA 1GYPA 4MWGA 4JOQA 3TLYA 2XCSB 2FJPA 4HN2A 3PNPA 5CYKB 3FJOA 1FMLA 1FFWA 3ENVA 2P3QA 3A8TA 2L2QA 3FTCA 1M2GA 2XWJI 1FX0B 1HDEA 5AXCA 4IH1A 1K6MA 2F90A 5KB3A 3GMIA 4TV9A 3N2KB 4C7MA 1WULS 3ENKA 2VT6A 4IXWA 3GFPA 1E1YA 2Y8EA 1NNI1 4CIXA 4H0FA 10MHA 3O8LA 3P9ZA 3VR2D 3LW7A 2HF9A 1FNNA 3W6UA 1W96A 5C1OA 3BIFA 1BHO1 2XADA 1UIRA 2I62A 4PAOA 3E53A 3I8XA 4JCOA 5EEGA 3K0HA 3A4YA 1NPTO 3GQBB 3OIYA 5AO9A 1P0PA 1X1RA 3PJFA 3QVXA 3CQ9A 8GPBA 2UYHA 3IOCA 5JSKA 4GMFA 2G36A 1SOMA 2RKWA 1IDN1 2H11A 4MUYA 1R74A 4MR9B 1U31A 2D2VA 4QUBA 5H17A 4GT1A 4DEYA 1T6XA 4HUQA 1PU2A 4ZOZA 1Y7IA 3GEMA 3UQZA 4I6EA 1UQUA 4AP6A 5FPPA 2PL9A 2J9FB 1H8HA 3A2LA 2DBVO 5G02A 4NXNB 4YV1A 4E5VA 1G5IA 2ZB4A 3ZVMA 2LIVA 2GLUA 2DULA 3NLLA 5LZ2A 1ZU5A 4EMSA 4G2NA 2O20A 1TCVA 1VYVA 5KS2A 4EYSA 5C1IA 4H7IA 4H4EA 1SUIA 2FP3A 4RE6A 5DT9A 3QQPA 2PZMA 1XNGA 3PDJA 3F49S 3VZSA 2PS3A 2NO0A 1K7SN 3ZU6A 3AYXB 1DZIA 4LVNA 3UGQA 1JV2A 2PL3A 1AN9A 2HIHA 3IV9A 1PUXA 4JHNA 3FR7A 4DV4B 3WGTA 3TVDA 4KBGA 1C30A 3I9MA 2ZU0C 3KTDA 4MUBA 1QGAA 1VKNA 1LSSA 3U3XA 1OB5A 1UOPA 2HWYA 2OAP1 4X8MA 1KYXA 1TRKA 4LZNA 1IBRA 5ELXA 1EB8A 3CFVA 3KSMA 2YJZA 2ZRJA 3HMKA 5LMNB 2ISQA 2HNKA 3U40A 3L4JA 1VG1A 4TVSA 2APJA 3HJTA 1AV6A 4ND6A 4F4FA 4PLGA 5EQFA 5J1TB 4FHLA 4MJ3A 4QHTA 3CH5A 4CLEA 3QEJA 4YV0A 2IOYA 3IHKA 2NTYC 3GVCA 4MITA 4MAFA 1O0CA 2C2KA 2HJSA 3N75A 4WK2B 2CE2X 3GLFE 1XZHA 4QAQA 5E9QA 4A27A 4JLAA 1EFUA 1KTVA 4TS1A 1TD1A 3HJUA 4ECAA 5K01A 1XTJA 2GN6A 1L5OA 2X7XA 3AJ8A 3OCZA 3NHJA 3DZ8A 2HZ7A 4AF8A 1HFJA 1IVYA 2YRFA 4DR5B 4DJEC 3AL0C 3CVJA 2FMIA 4KI0A 4O1QD 3Q3GE 2GERA 2GASA 1ZMXA 1R27A 5AJWA 1MGPA 3C3KA 1B8PA 2VPZA 2ZJ4A 3OO1A 2DQZA 1UEIA 1I2ZA 2X0DA 4IV0A 1VYHC 5CAEA 3R9KA 4IZOA 3ADDA 4FFWA 4URWR 4OJTA 4FFRA 1GVNB 3IAS6 4Z1MA 3UJ7A 4QBTA 2JDID 1Q3KA 5BSKA 2UZIR 1PAUA 1MF7A 5EXDA 1LQTA 4EGQA 5LR6A 4P93A 1IY0A 5IARA 4RHCA 3W5CA 2H7YA 4ENTA 1KH1A 3KJQA 4Q9IA 1M2KA 2GBFA 1WB6A 3C87A 3RASA 1FMCA 1UKVY 2NV0A 3CXUA 1U0FA 2WT8A 4OKNA 2ZYAA 3SZRA 1XTPA 4J76A 3QMWA 2ST1A 2XRZA 2O7QA 3L1HA 3RO7A 3FYTA 2DF8A 3UHJA 4X63B 2BCJQ 4G01B 4EP1A 3E35A 3E58A 2RHWA 3MIZA 5ES3A 4GM0A 2V7QA 1G5RA 2CN2A 3NEAA 4C3ZA 3OJEA 1PV1A 4AZ3A 4F1KA 3A0FA 3A9VA 2PBZA 3UPDA 5BOSB 4L57A 1V47A 2J3EA 2VQSA 2QZ9A 1GYRA 1CUDA 1JQAA 1VL0A 2B5MA 3EFBA 4LSWA 4V0SA 2MIIA 1FQOA 2YOFA 1YKSA 2O6HA 4BNDB 3QI2A 3GVHA 3BFXA 2CJPA 3EAFA 1I3KA 3S2UA 4EJSA 3EZLA 1K98A 3I7HA 3OEEA 5KOHA 2QRNA 1GO2A 3UC5A 5L3QA 3KC2A 1UKBA 3TH5A 3BA1A 2RC6A 2HA5A 2PMDA 1TU4A 2J41A 5C3MA 2G1AA 2JJ2A 4FGWA 1EP3B 1PK9A 4OGLA 1LH0A 3AOGA 3K0CA 1I51A 3ROXA 1GUYA 3L8ZA 3UM9A 1E3SA 5CPFA 4BNGA 4DUGA 4QODA 4FC6A 4W7SA 3RTCA 5FJJA 4L5CA 3RSZA 3O1LA 1XKLA 1D8AA 5ARCA 2PX6A 4B82A 2HPHA 4DNXA 4NFHA 1N5OX 2FP4A 1XXHE 1BHQ1 1AK9A 2B1IA 1SCNE 3KG2A 5CGQB 2ZS8A 3IDZA 4ZGGA 4DB2A 1Z0UA 4M8NE 4KDRA 1D7AA 1Y89A 2JD1A 4WE3A 4F6CA 4XYMA 5A9SB 1BMFA 4IX1A 2P2GA 3G2NA 2AI2A 1P6XA 4KQ6A 4XUGB 4XH9B 3L8GA 2JFVA 3L05A 1AF4A 4DBLE 1EZ1A 5H7XA 4DR6B 3VC3A 4F8JA 1W87A 1KMHA 1GG2A 4NG5A 3OBIA 2GRUA 3EBLA 3NTQA 5THKA 4FPXA 1O94C 1RDFA 4ZZ0A 1LK7A 3QLEA 4HFNA 1KORA 4H16A 3TL6A 2G9UA 1OPRA 3RBXA 3VUFA 4JHLA 5I7VA 3GXOA 3V7NA 1R66A 2C1ZA 5BMVF 3H3JA 5KCMA 4B7CA 2CLMB 3MIIA 3N74A 3QX8A 3Q6NA 3NHRA 3ZQ6A 2C84A 3TQTA 2PA3A