3MUNA

Appep_pepclose closed state
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
684
structure length
684
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFWWGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDQRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGYWWDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Route of Substrate Entry in Prolyl Endopeptidase
rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
molecule keywords Prolyl endopeptidase
total genus 219
structure length 684
sequence length 684
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3munA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3munA01
3STUA 2R8BA 2IIVA 3CXUA 4RGYA 3RM3A 3WKAA 1R3DA 4HXFB 4MQMA 4DMCA 1LZKA 3F98A 3G02A 4B84A 4BCCA 4C4ZA 2J3QA 3T52A 1UT6A 3G9XA 2C5GA 2GBIA 2YYSA 1BEEA 1DQZA 1LPPA 1FJ2A 2HFJA 1NX9A 2G63A 2I3DA 1IZ8A 4Q05A 3CCBA 4EUSA 2ES4A 5BWCA 2QVBA 4UHFA 5K3CA 3H17A 5ALLA 5T4EA 1HL7A 4H7KA 4JH0A 3FYUB 4BE4A 2ZYIA 1J07A 4GECA 2RHTA 5FUMA 3FLEA 4DIUA 2O2GA 4FFWA 4QLOA 3NOXA 1DWQA 3CN9A 1UXOA 3WI7A 1ETHA 2XQIA 2WHPB 2BAGA 2PU7A 5ALKA 1LPSA 3WL6A 3WL8A 3FLAA 4LYEA 4WY5A 5AM5A 2G5PA 1QTIA 5JZSA 3AJAA 4Y2JA 4FBMA 4YPVA 2WIJA 2FJPA 1EVQA 4DNFA 1OILA 2WFLA 1GQSA 2PKYX 5K3AA 4Q1VA 3DJYA 4DMFA 2HU5A 4HAIA 1XFDA 1QIIA 1C7JA 2OCGA 5EGNA 1VA4A 5HF6A 2V98A 2WHPA 3WWEA 3AZPA 3MUOA 5LZ8A 7YASA 1EK2A 4Q3LA 2QJWA 2B61A 4BC1A 3TJMA 2RONA 3WKDA 3ZWQA 1Z68A 5AKGA 1RWQA 1DT5A 3D2AA 3O9VA 5E4JA 4OD0A 4BDTA 4X6YA 4LYDA 1E8MA 3WKBA 1VXOA 2BGRA 2WG0A 2WSLA 4K5QA 5AM0A 1XZHA 4HS9A 5YASA 4UFOA 5CH5A 5ALJA 1P0QA 2Q0XA 3ZV7A 3ICWA 3O9MA 4H0CA 1AURA 1ZI8A 2PSFA 2XQFA 3C5WP 1L7RA 1LNSA 4CCWA 1MX9A 4BZZA 2HDWA 2WU4A 3WK6A 4F0JA 5C7YA 2QRUA 2QMQA 3DS8A 1ISPA 5I9IA 1CRLA 1U65A 3TGLA 3D5EA 4XX1A 3I1YA 4AB1A 3HC7A 5CT4A 1JU4A 5FPQA 3QVMA 1VLQA 5ALHA 4GEGA 3VJLA 2GYUA 3L1JA 5AICA 1XRQA 2J4FA 1TRHA 1W52X 4BE9A 3FVRA 2XUOA 4BYMA 3HI4A 4C88A 5JATA 4LIPD 5E4YA 2WFLB 1U2EA 4Q3KA 2XMSA 5IH7A 1ZGBA 4UHHA 4ZI5A 5LZ2A 2V97A 3STYA 4IH9A 1G42A 1HKHA 3HRHA 3HEAA 1SCKA 5LYYA 3QMWA 1B41A 1L7AA 4MQLA 4GLBA 2Y2UA 4UFPA 1CUWA 4UBOA 2ZYSA 3AUKA 3S8YA 4H77A 1QIMA 5FOQA 1ZD4A 4Y2VA 3HSSA 5HK9A 4KE9A 3ESCA 2RIPA 3C8HA 4KAFA 1XZKA 2ZJ6A 3WZLA 3BIWA 2WQZA 1I6WA 5BOVA 1JMKC 4N8EA 1U8EA 5FKJA 2XUPA 3SWWA 4B9EA 1K8QA 1J06A 5CT9A 5DNUA 4DNQA 1VA5A 1XQYA 1LLFA 3NWOA 2JEZA 3I2KA 4H7DA 1MNAA 2PUHA 2PX6A 3F67A 3PFBA 2XMQA 4RE6A 2WJ4A 3I2HA 2XMRA 4MEBA 4TGLA 4EB0A 3ESBA 4MXDA 4EA6A 4B0OA 3O0DA 1F0PA 2HIHA 3DOIA 2O7VA 3BL8A 4W1PA 1XZLA 4B81A 1JMYA 3BWXA 1BCSA 4Q82A 1ODSA 4BVJA 4E46A 4UBJA 3WYNA 4BCBA 2HL6A 2NW6A 1QIGA 1TK3A 1N8SA 2XLBA 3PF9A 4DSZA 3W06A 3V48A 5A7HA 1A7UA 3WJ2A 1P0PA 4UUQA 1CUIA 1BROA 1IZ7A 2DQZA 2JF0A 2H1IA 1C7IA 1IVYA 5ALUA 2JGEA 2YXPX 3WMRA 4J0DA 1XRRA 3E3AA 4YX9A 2X8BA 3FCXA 4RNCA 5FPPA 1KEZA 3GROA 5DWDA 4XJVA 3A2NA 2XUIA 1QGED 4QDUA 4DGQA 5HF9A 1CUVA 1H2ZA 2PSHA 1QIHA 1H22A 3I2GA 1R4ZA 3PUHA 2V9ZA 2AXEA 3QZUA 3D2BA 5K3FB 4ZXFA 1ZD5A 2Y6VA 4BAZA 2WIKA 4OU5A 1AZWA 1IMJA 1R88A 5ALGA 1BN6A 4L0CA 4QLAA 5DTJA 5HQ3B 3BJRA 1GQRA 4TPKA 2BKLA 1QE3A 3PDCA 1EINA 3BDIA 2QR5A 1WHSA 2WFMA 4BC0A 4BP9A 3QMVA 4IH1A 3I6ZA 4FTWA 5AKLA 2PSEA 3WZMA 4LXIA 3RARA 5IKXA 3WL7A 2K2QB 3LLCA 3W04A 3R3VA 3D59A 4QDXA 4Y2YA 3DKRA 4F5ZA 1O6GA 4FLFA 1CUBA 5E4TA 1GKLA 3WK8A 5JZBA 1CPYA 4P92A 4MWTA 4X92A 3ZI7A 2DSNA 4WCVA 5AKEA 4Y9SA 1CUUA 2OCIA 1EHYA 5A7GA 4G8CA 4AMYA 4P93A 4W1SA 3H2GA 4BB0A 2D5LA 1TIBA 4WDRA 1DWOA 1AX9A 1VKHA 3IDAA 4UBMA 2BGNA 3M3DA 1XRLA 3WWCA 2HA0A 5CH8A 1BE0A 1AUOA 2CUTA 4Y2PA 1F8UA 3HABA 4Y2SA 4UBKA 3QPAA 3G9ZA 5IVHA 1BU8A 4ITVA 2YH2A 2B9VA 3ZPXA 4AN1A 1UOOA 2XMBA 1ZD3A 2QUAA 1THGA 3AIMA 4LXGA 2PPLA 1WOMA 3FVTA 3H0CA 2C0QA 5ALYA 3VJMA 1ODTC 1CUGA 1E8DA 3AIOA 4H7JA 1MO2A 4O08A 4C4YA 5LKRA 1CUXA 4BP8A 4LHEA 3IURA 2QUBA 1QJ4A 1YAHA 1SCQA 5HFNA 4K2AA 1FFAA 1FFCA 5AKJA 1Q0ZA 3QPCA 4K6KA 4RPCA 3JYHA 5FLKA 2EEPA 4KJXA 2C7BA 2VQ6A 2WJ3A 1UKAA 1ACLA 5AI9A 3AILA 5JYCA 1EX9A 4J0CA 5JANA 3A6ZA 5DNWA 4XVCA 3EQ7A 5AM3A 3C5VA 3KDAA 2D0DA 2HU7A 4C4XA 3ZLVA 4B9AA 1DQYA 4INZA 5HF8A 3H2JA 1CV2A 2DQYA 5DYTA 3PICA 1YA8A 4QE3A 1FFDA 2OG1A 2OGTA 4I4CA 1E3QA 1HLGA 5EHZA 3HACA 1H2WA 3I1IA 1QIKA 1VXRA 4XIIA 4L72A 4M0FA 4P08A 1HDEA 3G0DA 3Q8WA 5SYNA 1QOZA 3VJKA 1CUDA 4PQEA 5CXXA 3CN7A 2WUDA 4FDMA 3U0VA 2ACKA 2OQIA 1YCDA 1XLWA 1XZIA 4Y2XA 5JZ9A 4PSUA 1MAAA 3DNMA 4WJLA 2PU5A 3DQZA 3DYVA 3JWEA 4H7IA 2OPHA 5AI8A 4OUKX 1GPNA 5AM1A 1TCBA 2CB9A 5LKAA 3FYTA 1XZBA 3H18A 4GW3A 1UOPA 1MAHA 3H1BA 4JYPA 3IB3A 4G4GA 3FSGD 4EZIA 3KXPA 4NVRA 3ZLUA 1UKBA 2WUEA 2H7CA 5A71A 3IA2A 1QIFA 3D2CA 3B5EA 3HZOA 1UKCA 2H7XA 4C6HA 2WFZA 5HFAA 3LS2A 4CCYB 4CG1A 4B82A 4BAUA 1QIEA 1T2NA 5EI5A 3I6YA 2O7RA 3WLAA 4HZGA 5CMLA 1MN6A 1UK9A 4EBBA 1K6EA 2PSJA 4QNNA 2VT7A 4B7ZA 1X2BA 1Q84A 1E5TA 1UK6A 2QOEA 2C58A 4J0HA 5KBYA 4JUIA 1MPXA 1R1DA 3WK4A 5AJHA 1E8NA 4H35A 1XQWA 4DNOA 3R3WA 5HCUA 1ZGCA 3AIKA 4JYMA 4N5IX 5DYYA 4EY7A 5AH0A 1JKMA 2PL5A 3QMMA 1TCCA 2OGZA 2RAUA 3E4DA 3DYIA 1CVLA 2PVSA 1QZ3A 2OAEA 1EXWA 1CUHA 1VJ5A 3WK5A 1EK1A 5IVIA 1FFBA 3V1MA 1DTEA 4WY8A 2GBFA 3GZJA 4EHBA 3I2IA 3K2IA 5ALXA 3MGAA 1DINA 4RE5A 2WTMA 1N5RA 4G8DA 5CT5A 1BCRA 1W1IA 2WTNA 4Y2QA 5KREA 3HLKA 2QM0A 2X5XA 3UUEA 4G4IA 2XUKA 1DWPA 4F21A 1YASA 4U2GA 3V1LA 5K3BA 3IULA 3WKEA 4UBLA 5T4FA 4G8BA 5D3ZA 4X7BA 3L1IA 3N0TA 5LP1A 5CTAA 5HKAA 1H2YA 5K3DA 2WUGA 5K3EA 4BVKA 1SOMA 3I6MA 3FYUC 2JGKA 3OTQA 1JU3A 2HRQA 3OG9A 4DMHA 2RI6A 1QIDA 4DNPA 3Q0TA 5C81A 4AX4A 4J0KA 1DU4A 4OYLA 1A8UA 3KD2A 4DSAA 2OXEA 2PUJA 3D4LA 3PFCA 4FHZA 5CRIA 5A6VA 1ORVA 4FOLA 2CKMA 1U4NA 3WJ1A 4MJ3A 4KE6A 4U2DA 5AOBA 1A8SA 3GUUA 4P9NA 2HRRA 3C6YA 4OCZA 1LPOA 4AO7A 4AQDA 1GXSA 5JARA 1N5MA 2XMZA 2VA9A 2OGSA 1CUJA 1CLEA 3QYJA 3C6BA 1YSCA 4UBIA 1TKRA 1QO9A 3G9UA 3CCCA 4AO6A 3NGMA 3O4IA 1XLUA 2WM2A 1CUYA 2CMFA 4WFJA 5KWIA 5JALA 1CUEA 3UMJA 4UFNA 3K6KA 4L3WA 2WIDA 3AINA 1XZCA 3BIXA 1YA4A 3BJMA 3C6XA 3QPDA 2HADA 3R3UA 2Z8XA 3FLBA 3IUQA 4W9RA 2OCLA 5EHXA 1GPLA 4EY5A 3DEAA 3RK4A 1QFSA 5DNVA 5I7UA 1VOTA 2VATA 4W1QA 3G9TA 4UHDA 4QWMA 3A2LA 1A8QA 3X3HA 1CQWA 4QDZA 3V9AA 2XMCA 4H7HA 5BWBA 2XUGA 3AZOA 5FRDA 3C87A 1E66A 3IBTA 2BJHA 5JAUA 1W76A 1Y37A 3O4HA 4WDQA 2JGJA 2J3DA 3M83A 3EF3A 2CEKA 3HYSA 3DOHA 4NMWA 3WA6A 2JGIA 1MT3A 4WFKA 1WPXA 4KE7A 5LZ7A 3T4UA 3WWOA 1WM1A 1UWCA 2ZJFA 3R3YA 2PSDA 3E0XA 5ALEA 4FNGA 1OXMA 4N8SA 2WG1A 4UHEA 2P8SA 3B3QA 3BXPA 3F9CA 5D7BA 4OYYA 3ED1A 2HFKA 5JAPA 2HU8A 1DX6A 5AK4A 4IHAA 3F8SA 2WKWA 3MVEA 3B12A 4AO8A 2BCEA 3EBLA 1QIJA 4ARAA 5ALPA 2BUAA 4AZ3A 2XUFA 1CEXA 2PM8A 4BZWA 2EDCA 1RP1A 3BF7A 3STWA 4GWLA 1PFQA 5AK5A 1LZLA 1SC9A 2ORYA 3PUIA 3FAKA 1CUZA 4OB8A 4BTLA 1CUSA 5D6OA 4OU4A 1AC5A 3AFIA 4C87A 1EVEA 1N1MA 4G9GA 4ZWNA 3VDXA 4MEAA 2DFPA 3C43A 1XZFA 4B6GA 2G4LA 4HTAA 4J3JA 3VVMA 3LCRA 1TAHA 4QEKA 5CH3A 3R41A 2HHAA 2VJBA 1PV1A 5ALRA 1MTZA 1AMNA 2ZVDA 5JIBA 3BF8A 4EY4A 5EIHA 1S8OA 4AN0A 1QTRA 3IUNA 3C70A 1EH5A 1W75A 3ILSA 1XROA 4A23A 5HKBA 2Y2VA 4FBLA 2Z8ZA 4QDOA 4BAGA 2QJRA 1BN7A 4IO0A 2HM7A 1XZJA 5A62A 1WB5A 3C8DA 2G5TA 1MJ5A 5CW2A 1ZOIA 4DLNA 2XMGA 1EDEA 2JGMA 4B80A 1EDBA 1KU0A 3ICVA 3FOBA 5F4ZA 4J0JA 3STVA 2IX9A 3ZLTA 3VVLA 3PI6A 5JAHA 4X93A 2QKYA 1JJBA 4U2CA 5AI5A 1O6FA 2O2HA 2C4HA 3QH4A 1XZDA 3OURA 5HZGA 4ZGBA 1MNQA 2QS9A 4AXBA 2I03A 5EFZA 4PF1A 4OPMA 2RHWA 5DJ5A 4Q3OA 4IQ4A 3DL4A 3YASA 5AI4A 3I2FA 1XKTA 2WHQA 1YS1X 3R40A 3BDVA 3F96A 5JD5A 2HA2A 2C5FA 2QXTA 3GELA 5DYWA 4V2IA 5LIPA 3EQ8A 2VF2A 4FNMA 1MX5A 2VEOA 1AQLA 2DR0A 1ACJA 3DD5A 4CG2A 1JJFA 5JADA 3FSGA 5AK3A 1IUOA 4L9AA 4JEIA 2Y1KA 3QITA 3R3XA 2B20A 2WHRA 5JD6A 3MUNA 2DCMA 2GBCA 2VTVA 3H19A 1EI9A 2AJCA 5C8ZA 3OM8A 3LP5A 1ZI6A 4MYSA 3JW8A 1IUNA 3WK7A 1ZIYA 2RGUA 3QM1A 1EDDA 2E3JA 4X6XA 3UUFA 3WL5A 2GBGA 4ZREA 1J1IA 3NUZA 2WUFA 3QBJA 5CXUA 3KWJA 1UK7A 4GDMA 1TCAA 3S2ZA 4PO3X 2ZYRA 5AKIA 4ZV9A 2VJAA 4LKOA 4FMPA 1DX4A 1WPRA 1UZAA 1GPKA 4FLMA 1K4YA 1OCEA 4BATA 4HVTA 2W6CX 1YB7A 4X97A 3IVMA 4Y2RA 3O95A 1GT6A 5HQ3A 1WCYA 5AK6A 1K5PA 1QFMA 2FX5A 1L7QA 1QONA 2ACEA 3I28A 4OSEA 5ALZA 5K5EA 4KR0A 2XMDA 3DDUA 3ANTA 2XUDA 4EY8A 3HJUA 2XUHA 1PJAA 2Z3WA 5EIAA 2OQVA 2ONCA 1GGVA 4X95A 5ALIA 4G1FA 1HQDA 2ZJ7A 4HRXA 5ISMA 1VE6A 3M82A 3K9BA 3DKKA 3G0CA 1ORWA 1XRPA 3SC2A 3WKCA 2VJDA 4UPDA 4BRSA 5HK8A 3ESAA 2HA7A 1ZI9A 4B83A 2GYWA 3EIOA 4ARBA 2ROQA 1BEZA 1CUCA 3GFFA 5EHQA 3W9UA 1MU0A 4J0IA 4X91A 3RLIA 2Z3ZA 2I3ZA 4FWBA 2JGFA 5AI6A 5JAOA 2HA6A 5D3KA 5T4BA 4N5HX 4I3FA 1UK8A 2WU3A 2V96A 2WILA 5JD4A 4Z49A 3DL7A 1CUAA 1VZ3A 4E11A 1M33A 4GBGA 3PF8A 4FFVA 4HRYA 1J2EA 1X70A 1G5FA 3U1TA 2OLEA 2GZSA 2B4KA 2XLCA 4ZRDA 4UHBA 5ALDA 4J7AA 5AM4A 1DT3A 3TRDA 5FV4A 3DCNA 1VE7A 1THTA 4EY6A 2VSQA 4X94A 2WJ6A 2J4CA 4QZVA 1JFRA 5ALFA 1JJIA 5ALOA 4D9JA 2JBWA 5AKZA 5E2IA 5SYMA 3VXKA 2DHEA 1C4XA 3R3ZA 2ZSIA 3L1HA 1USWA 1NU8A 3C45A 4BCDA 1AGYA 2AJDA 4F60A 2AJBA 4H7FA 1NU6A 4G9EA 4CIAA 4H7EA 3WWPA 2W22A 5A7FA 4PW0A 4K6HA 4FLEA 1FFEA 1AKNA 1LBTA 1H23A 1ZD2P 1CFJA 1XKLA 4OB6A 1Q83A 3V1NA 5EHNA 4BRZA 4BVLA 1RYYA 2X76A 1XZEA 3SX4A 2XQKA 2XUJA 2JGLA 1R9NA 2XB6A 5AIAA 3G0GA 1JI3A 5ESRA 4CCYA 3WA7A 1YAJA 5AM2A 4M0EA 4N8DA 3O4JA 2ZYHA 1HPLA 1XRNA 2IITA 2CZQA 3EQ9A 5AKHA 1Q0RA 1R50A 1TQHA 2XT0A 1Y7HA 2H7YA 3KOOA 2XDWA 3OPMA 5ALQA 4DYHA 4E15A 4AMZA 2OCKA 3H2IA 3STTA 5AOAA 1EB9A 4U2BA 4QA9A 1IUPA 2WG2A 5BV7A 2XE4A 4J0GA 1UOQA 2WIFA 4I19A 5CT6A 2AJ8A 4NZZA 3H2HA 4X85A 5ALSA 1GKKA 3G0IA 3RKSA 3I2JA 4TVKA 3W05A 1LPNA 4DTCA 2BFNA 4KRYA 1CQZA 3IUJA 3P2MA 5ALMA 4X3CA 3OOSA 3H04A 4K6GA 3G0BA 3LIPA 4X6UA 5FP0A 3W9BA 2O2IA 3D0KA 1R9MA 4MYDA 1XQXA 3A2MA 1F6WA 1B6GA 4LXHA 3H1AA 6YASA 3IIIA 1E89A 1YS2X 2Y6UA 1XZAA 4PSCA 4GI1A 4E14A 3WWDA 4PSDA 4B0PA 1HBJA 4KYVA 4UBNA 5LLSA 5LZ4A 3F97A 2QZPA 2WIGA 4QDTA 2UZ0A 3N2ZB 5DLPA 3A70A 4HXGA 2R11A 4HXEB 2QTBA 4PNZA 1A88A 5KWJA 3OC0A 4KEAA 1YB6A 4PV7A 4GXNA 1WHTA 5LZ9A 3SK0A 5AKYA 3WIBA 1XLVA 1W4LA 3E1GA 4U2EA 5ALNA 4Q34A 1WB6A 5AO9A 4BTVA 1ZICA 1SCIA 3DLTA 1LPMA 5FDFA 5AP9A 2OAGA 2XQGA 1H2XA 1D07A 2PBLA 1CUFA 2XUAA 1QLWA 4DMKA 3GBSA 4W63A 1BS9A 3W2TA 3VISA 4KAAA 2BUCA 5HF5A 1G4HA 2ECFA 4X00A 1ZIXA 5C8VA 1SFRA 4Y7DA 4Y2TA 2FJ0A 4NS4A 1EB8A 4MWSA 2XUQA 1CIJA 1BRTA 5EIEA 5IVKA 4B85A 5JASA 2HA4A 1CR6A 4KRXA 3BE8A 4G5XA 3ANSA 5AHXA 5AKKA 2EDAA 1LBSA 5J3JA 3GA7A 3C6ZA 4JNCA 4Y2UA 2ZSHA 2WLSA 1W6RA 3ESDA 4ROTA 1WB4A 4A5SA 4BBZA 4ETWA 4U2FA 2BUBA 5CBKA 1YR2A 3TEJA 2QT9A 4WFIA 5I8PA 5IVDA 2JEYA 3HXKA 5H3HA 3STXA 4UHCA 1XZMA 4C89A 4YASA 4H18A 1LPAB 2FUKA 3FWHA 3D3NA 4IH4A 4W1RA 1FSSA 2DHCA 4BDSA 1JT2A 5CT8A 1XRMA 5AIBA 3H2KA 1EA5A 1ZJ4A 5FXMA 5ALTA 2LIPA 2C0PA 3D7RA 4GHWA 3G7NA 4CIBA 3AZQA 1LGYA 1ODCA 3V1KA 2H9YA 4KAJA 1GZ7A 1XQVA 4YK7A 3G8YA 5AKXA 3PE6A 1LPBB 4XWGA 3KWFA 4C01A 4M0MA 1K63A 3O4GA 4A16A 4G4JA 2GYVA 2YASA 5AI0A 2JIDA 4CG3A 2XI4A 2DHDA 2Z5GA 4KE8A 4DM7A 2VAXA 4OB7A 5K3FA 1G66A 1MX1A 5DTIA 2CBGA 3FYUA 1VZ2A 3FBWA 2XQJA 4CI9A 1ZJ5A 3WQHA 3IUMA 3KSRA 5CURA 5ALWA 2HA5A 5C8XA 2CJPA 2VT6A 2GZRA 1QO7A 2HA3A 4S0XA 1X2EA 3LIIA 1P0MA 3M81A 4KACA 4X90A 1UFOA 4J03A 1XZGA 5LZ5A 3WIOA 4CFSA 2AJLI 5ALVA 2VAVA 5AOCA 2VJCA 3WK9A 3WYDA 1F0NA 2QXUA 5A2GA 1P0IA 4QWWA 4X71A 2I78A 1Y7IA 4ZV7A 5T4HA 4FKBA 3VKFA 3FCYA 4AZ0A 1T4MA 3FNBA 3R0VA 1KU6A
chains in the Genus database with same CATH superfamily
5D01A 3STUA 1OYVA 1ZJYA 2R8BA 3CXUA 3DZKA 4L5IA 4G36A 4AICA 4EJFA 5HM8A 2RKWA 1M7BA 3RM3A 1FVOA 4BNDA 5IVPA 2GXQA 4I9GA 1P1KA 3WMXA 2ZRBA 1EG7A 2GMWA 3UK0A 3IP5A 3VC2A 4DIEA 3H4VA 5FTMA 2UKDA 3M9XA 1K4MA 4GVXA 1DPGA 1FXWF 1UT6A 3KKPA 4L16A 4IOMA 1X9HA 3OTGA 3GFSA 4RCVA 2C5GA 5CIQA 2GBIA 2PX4A 4GXQA 4N7JA 2YYSA 4QO8A 4UVDA 3AH8B 2NYUA 5IDVA 4IXNA 4GU5A 4DA9A 3N8HA 3KQVA 3CX3A 3WJ7A 1L6IA 3REGA 3TRFA 2I3DA 4ZOBA 5IN4A 1M8PA 2BIFA 2HIMA 1RT9A 3IKJA 4IMJB 1V6SA 3AVQA 3IUBA 1HYQA 3QV1A 4G86A 3TN7A 1E5LA 2CFTA 2FY8A 3R8XA 3VU9B 2F62A 2A0WA 3TNDA 5BSWA 5IHXA 3DEKA 4P4LA 1IBLB 4EUSA 5GPBA 3L6CA 4RWEA 2I1LA 1WXWA 2A0XA 2ES4A 5E1MA 4RK6A 5BWCA 4R2XA 2ISSD 4RENA 3SIXA 5BORA 4R9RA 3EC2A 4EYEA 1QM5A 2NXEA 4C2UA 1NT2A 1BG6A 2OHHA 3RUPA 4YRDA 1E2QA 1F60A 1H6AA 3AOEC 3RG2A 1E7MA 2ZYUX 3H5VA 4XGQA 3NRJA 4PXSA 1HF3A 4LJSA 1T5TA 3PK0A 4RJTA 3K0FA 3E2PA 3HXPA 1XJ5A 1JVNA 2YZ7A 4QUHA 4PNPA 2QI9C 4KVAA 3VOTA 3AEKA 3GRFA 1S3GA 1SHUX 3F73A 3N2IA 3H3XA 4GECA 1Q7RA 5FUMA 3D7NA 2VXOA 2ZIGA 1H5QA 2HMWA 3BWEA 3D0OA 5DFAA 4JR0A 4KUEA 2QRQA 5K3SA 1MOPA 4TYWA 2PKWA 5H16A 3OF2A 4CUZA 3GCGA 4IDGA 3CN9A 4BMNA 4EK9A 1YONA 3TOVA 1ETHA 1WDMA 1VIAA 3MLAA 1WZUA 2V3VA 1G18A 1OAAA 1J8FA 3LD9A 1T1IA 3BORA 3KNZA 4X63B 2WE7A 1C9MA 4DMMA 4CF3A 2LNDA 3WL8A 4WY5A 3CVUA 5JZSA 1EXVA 2IYEA 2F3RA 3AJAA 3D31A 4MS4B 4Y2JA 1RQNA 4CG1A 5CAEA 3QXCA 4DJFC 1YFJA 4BLVA 3DHNA 4QJ4A 5SZKB 1M2VB 4TTIA 3WB2A 5AW4A 3A6PC 4DQ0A 1FQWA 1E2BA 1TTPB 2EC5A 3HFSA 3MS2A 5DBGA 1GQSA 3OWXA 1IOWA 1XCGB 9ABPA 4GKJB 3BX1A 5EMNA 5C32A 2XRZA 3OFKA 4DMFA 2W98A 2WJAA 4FGUA 2OD7A 3OUTA 4B6SA 3NO4A 2IUQA 1RDFA 4BQNA 2AEJA 3LGXA 4MV4A 4URFA 1CZKA 2OCGA 4IX9A 4M46A 5EGNA 3W8RA 3ETLA 5DLDA 5CEFA 1H42A 4IZIA 4B75A 4E4TA 2AOUB 2YDYA 4O2RA 2P78A 4XA8A 3KB2A 3WWEA 4EB6A 4D92A 4JP5A 1JJ7A 1KQFA 1Y3DE 5FPYA 1RPNA 3KSMA 2FG7C 1EK2A 2BR3A 1S0UA 2PQ0A 3COZA 3IPXA 7YASA 4Q3LA 1P2DA 5JVDF 1A50B 3NGLA 1SD2A 1ONNA 3S4YA 4FXPA 3D5QA 5GOZA 5CCEA 2VLIA 2VRCA 2JLXA 1B6TA 3STWA 4KITB 4I1VA 3L6RA 4FEGA 3FM0A 3SEFA 2RONA 2FZKA 3IAFA 3PFWO 2ZIUB 1NR5A 2LXNA 4NZNA 2P0YA 4YO7A 3P9KA 1EWRA 5DI3A 4C4PA 1KARA 4ZAFA 4ZVLA 4JBXA 3GLIB 1HGXA 1W2GA 3SLRA 3CF2A 2ZB7A 3QOFA 3I7NA 4H0FA 1RQ2A 1RS0A 2QL9A 1A82A 5J4KA 4GX1A 2R9VA 5C7OO 1IRIA 2JAOA 3QJGA 3FUWA 3TZEA 1QE0A 2A1TR 2BFAA 3EW9A 4GSLA 4K81B 3UNXA 2NWQA 4X6YA 4NULA 3UAXA 4LYDA 4XDZA 1ZAKA 1YVEI 3KOWA 1UM8A 2ZJ5A 4ZHQB 3UGKA 2PKCA 2HDNB 3IAXA 3ODPA 2CL6X 1TQ8A 2N42A 3QU9A 2J6HA 4UNQA 5AM0A 5HA5A 4XX0B 4GM9A 2J0EA 5EINA 1NPYA 1WVMA 1M1NA 1F2TB 3ENWA 3L7DA 4DJ5X 1H0RA 1WW8A 2G5GX 3KUKA 3E2IA 1NPTO 2Q2NA 1PD1A 4IICA 3VSEA 4RMGA 1YQTA 2YVQA 4BZQA 1TF7A 2P2DA 1ONSA 4M1WA 4RHFA 4YMTA 2DUWA 3H75A 2IE0A 1NRXA 5D3MA 1AURA 3BMCB 3AQ4A 3L8HA 4OQMA 4MYRA 4KHPB 4ZZ1A 1UPTA 3OF5A 4LHYA 1U94A 1CF9A 2B5WA 1S3IA 2PSFA 3EGWA 3U9LA 4B71A 3LG2A 4OGKA 4E6EA 5DMHA 4CM6A 4BECA 3JYNA 3VR6H 2PRYA 3UATA 5F52A 4ZDWA 1IHYA 1XK6A 3KQHA 1K32A 4RCZA 3LUDA 4EECA 1T43A 2JNWA 1MRZA 1T0JB 3LQQA 5BN1A 2I1QA 3IXLA 4J81A 3NPMA 3R8FA 1YACA 1JHZA 2N47A 4OJNA 4B3DA 1OIWA 1DC7A 3BEOA 3O8OB 2VBGA 2A0KA 1E2PA 4R6XA 1ST2A 4LPSA 5F5XA 1FXSA 2CD7A 3NCTA 1B9YA 1FSFA 4TMYA 4O0LA 5DB4A 4KMOA 1J8QA 1YZNA 1SQGA 3MSXA 4IGIA 4J1TC 2QRUA 4F0JA 4OHMA 4KGZA 1HY3A 4B2PA 1PJTA 3B1WA 2J8ZA 2BGLA 4YRRA 1PUXA 1UINA 3IQEA 3B5JA 1U65A 2I2FA 3K70C 1BMQA 4MA4A 1OTHA 4YAUA 4MUKA 3ZWNA 1KJJA 4FSXA 4QHSA 1G4UR 1W5EA 4DCNA 3FWPA 2A14A 3RUCA 3AM3A 3G7UA 3IKVA 3H4MA 4P4TA 4XX1A 3BSYA 3I1YA 4GRAA 4DAEA 1PI6A 4FE4A 3QLTA 1JU4A 4R16A 3ESQA 5FPQA 1Y89A 2VI5A 3JD1A 5FWAA 1KOJA 2BBWA 2XA1A 3ON5A 4LG9A 3QVMA 3JALB 1CW2B 2GTIA 4DDWA 4AJPA 2QX4A 3A14A 1FLNA 1VL0A 2DMRA 3K8ZA 3VJLA 1BAPA 3L1JA 1E2UA 4K40A 1ZOLA 2J4FA 3REFA 2GK7A 2FDCA 2X5JO 4QSHA 4KIFA 4BNNA 2MCFA 4ENSA 3OSZA 3IRVA 4BYMA 1XNRB 4K3JB 3VR2A 1DIOB 1NIPA 3CKMA 4Q03A 1JIJA 4BLQA 4BVAA 3ORHA 4RQAA 1Z6XA 4IWXA 5JI2E 3S0JA 2CHEA 4JLUA 2HMVA 4Q3KA 2VKTA 2HHCA 1JXQA 2XMSA 4FEYA 4B4UA 2E0IA 4YT8A 2IEBA 1A04A 1QV7A 1XT6A 1KQNA 3PQEA 1L4YA 3VUEA 3LTNC 3F8WA 4M9SA 4Y6RA 3VGZA 4RZXA 4UHHA 2QZJA 4MLCA 5EWMB 5JZVA 3AY6A 1U3CA 1YDHA 2FWNA 4TKMA 3RYTC 2V97A 3DZ8A 1NI5A 3HA5A 3FYHA 5ERGB 2PXAA 3STYA 1IJEA 1U8ZA 3EODA 5EEHA 5JRJA 3HRHA 2P67A 4YRNA 1RQPA 1Q0LA 4A2QA 2WJWA 4BUJC 1EK5A 3MCTA 4Q9JA 5DHSA 4D2IA 5JNRA 3UJCA 4N14A 1Z4OA 2PVCA 3R7WB 4DQXA 4UFPA 3UVOA 4PCUA 4UBOA 5AHKA 5D1NA 1ID8A 2UUAB 3UFBA 4H77A 1QIMA 4UARA 3ZOKA 4BO7A 5IJ0B 5IKMA 4DTIA 2R48A 3SJLD 4Y2VA 2ZYGA 4UTOA 2I87A 1P9WA 5GJBA 3OPYB 1H2RS 2WNSA 1E3IA 2H4YA 3ZG6A 3EFBA 3KTFA 4MGHA 3AXSA 3EIXA 2RIPA 4KAXA 3WLLA 4F12A 2F55A 3JATA 4KAFA 5DT2A 1KYZA 4OFZA 4RQBA 1I6WA 2FI1A 3S40A 3HDJA 4WZZA 1TCVA 1Z4MA 2PMFA 1JMKC 2LE0A 4HAWA 4RY0A 5FL7A 2X7HA 3SXUA 5MGBA 2C4UA 2Y0CA 2AGLA 3M7IA 3MWEB 3PT5A 1AQ6A 2P77A 4OIMA 1MABB 3RS5A 3KZ1E 3FCSA 3ROMA 1BQ4A 2O19A 4WNIA 2BI4A 3EQ2A 1J06A 3ECSA 4JI7B 5FA5B 2HCJB 4BUJA 5HKKA 4HUQB 5SV2A 1VA5A 2INGX 3RVDA 1E1YA 3WO0A 5L8VA 3B6JA 1E79A 4PCAA 2QUKA 1DKOA 3FI0A 3HXMA 2V59A 2AQ5A 2IOHA 3U62A 2YKGA 1MKYA 4NENB 5CA1B 2JEZA 1NR0A 2FMIA 2GPSA 3SXPA 3ICCA 8OHMA 1LBEA 2QD2A 1R9GA 3PC8C 3TR5A 4UM7A 4B3XA 2MSEB 5KYGA 4DWVA 1LBHA 1VPLA 1L8OA 4ZANA 5GOTA 1DJOA 3MKSB 1V3TA 3VI3A 1ZMOA 2XMRA 2H5LA 4MEBA 4DEVA 5FL7D 1T26A 1WDWB 2AFHA 3PRHA 4F9GA 4EA6A 5KDDA 4QARA 1IVNA 2RFLA 3UQZA 4TKUA 3PYMA 1OB5A 4NV3A 1JMYA 1UJMA 4OZUA 2PZBA 4JLSA 5DCLA 5IT5A 4EPTA 2C4NA 1P1HA 1E1MA 4FINA 2KQUA 4DJAA 4E46A 3TPFA 4E11A 2AH5A 4QPZA 3WSWA 3I01M 3L4OD 3TVTA 3HK2A 4JU8A 1G3IA 3L4EA 2RKOA 2OL4A 1MHTA 4DS3A 2ZULA 4JC8A 3T5TA 2XLBA 1AK9A 3OJEA 4PZ0A 1Q21A 4QECA 3URKA 1OKKD 4Q4LA 3UVEA 2H14A 1JLHA 3JD2A 3K9CA 1SIUA 4AYTA 1B8PA 2VYCA 4WXHA 5TPZA 1JEYB 3V48A 1M5UA 5BW8A 1O4WA 3TXYA 1GA4A 3LT0A 1P0PA 3T7SA 4MDYA 1KFJB 4II7A 4MRSA 4UUQA 5M2QA 1CUIA 2SKCA 3NHJA 1IZ7A 4DCVA 1DJQA 2VQFB 1T1RA 2GZDA 3H1TA 2DQZA 2JGDA 1JAXA 2VXYA 4YCMA 5B2EA 3EG9A 2PD4A 4B8YA 2DJ5A 2H1IA 4MVWA 5J2TF 1F2UB 1C7IA 3RVNA 4BFZA 3HEMA 3QUQA 4Q4HA 5EJ2A 4JHLA 4X61B 4YN3A 4PAQA 3VU8A 1ACMA 2Q6VA 4CI2A 1L7BA 3EXIB 2YXPX 5AHRA 5B57C 1U9YA 2PWBA 3E61A 5BP7A 3TKAA 3E3AA 3H9EO 3HBMA 3K4PA 3OY7A 4PG7A 5KOYA 4B8ZA 1KXZA 3UVKA 1ZSNA 3FCXA 3PJEA 4JB0A 1F2UA 1MAUA 2AHRA 4A7JA 1KEZA 1KVRA 5D3QA 5DBOA 1JKFA 2R6GA 5FB3A 3SS9X 2F67A 4KN8A 3QHQA 2F9MA 4XGRA 2XUIA 4QDUA 2WUVA 3D4OA 3NWBA 4JLNA 4BVEA 1H2ZA 1XKXA 4PINA 3U1BA 1HDRA 2Q3LA 3W5UA 5EKTA 3UHPA 2JD2A 4LE1A 4YAOA 1KEUA 4MQUA 3QBTA 2I6UA 1QYXA 4F3TA 1PR6A 1JE0A 3LBYA 3QLUC 4YCBA 4EGSA 5FI0B 3WLQA 3GFVA 4ZXFA 3CB4A 1ZD5A 2Y6VA 1WU7A 2BMAA 4F9FA 4BAZA 1GILA 3GD7A 3E6AA 3DMTA 3TGWA 4OU5A 2GWHA 4EEKA 3OEED 1WDTA 1N3IA 3IR5A 2VDWA 4J16A 5I48A 1Q11A 2ZS8A 4GP6A 2QK4A 4R8VA 5LQUA 1BXKA 4L4SA 1GN9A 1Y5NA 4FZJA 4TPKA 3FNIA 3I8EA 4RSHA 2CNNA 4NAHA 1SVIA 3WAGA 2I65A 4XW2A 5LIRA 3IMGA 3EZYA 4MW4A 1RLTA 3IVGA 3I4FA 4IJVA 5FNVF 2GPJA 4O6VA 1YJCA 4YHBA 4CUKA 4XWYA 4J73A 2Q5JA 4BC0A 2CF5A 2CKDA 1UXGA 5HILA 4QYIA 3RSOA 1TK9A 3A9CA 4BP9A 2UAGA 3M5DA 2FEAA 4TTPA 4V0SA 3ZTTA 1PNRA 4IH1A 2W6QA 4LJ5A 3GLGA 2GM9A 1W73A 1XEXB 5AKLA 3E81A 3UHOA 4L7QA 1GM5A 4LXIA 2QTWB 1XXHA 3OIGA 3PL5A 1KBQA 3DZDA 3RARA 3D2LA 5CX1B 3WL3A 1DG9A 1N1EA 4I66A 3N2EA 1DC8A 3VAYA 4TMXA 1XU9A 5K0SA 2MWMA 4UREA 3MLEA 3KJNA 2Y1WA 3W04A 4A6PA 4DT1A 5HE0B 1KPHA 2Q5CA 4K46A 1MABA 2JPDA 4TMTA 1JE1A 2BE9A 4QDXA 4EITA 4P7GA 2IURA 3TZHA 2W43A 3CLKA 2C03A 4HF7A 4UHJA 3RU2A 4YT5A 3NIGA 3DKRA 3I32A 4LYYA 3C74A 1REQA 2WF7A 3MN1A 1TA0A 1U04A 2A0YA 1XEFA 2NQ8A 3WK8A 3R75A 3FDZB 3L8GA 3LT4A 4D5EA 3PX7A 4QT8A 3K1AB 3K1TA 3NWJA 4NQRA 1ESCA 1SCDA 4MW1A 4UW9A 5CYFA 1YHYA 3CUUA 2JZCA 1OZGA 2YHSA 2ADMA 2RBEA 4Y9SA 1CUUA 1DPFA 1G0OA 1U2TA 2OCXA 2IUUA 3QKTA 4C0QC 4Q66C 1EHYA 4WKBA 3A9RA 2WAXA 2G0TA 1WBDA 1GGEA 1RZUA 3H2GA 2P2GA 3IS3A 3P20A 4BB0A 3KJFA 3I1JA 5EMMB 4GM4A 3ZXYA 1YS4A 3IP3A 4DNVA 4IDPA 4MVJP 3EIWA 3P1JA 4L1MA 2ZJOA 4PGHA 4WDRA 3N8NA 4Q9HA 5E9QA 4XVUA 1VKHA 3EBPA 3HWX1 3BB3A 4KFTA 3M3DA 1VP3A 1JBEA 3BC1A 3FX2A 1XRLA 4NPCA 3CZ9A 2XRYA 4FE3A 1YZLA 4QSMA 3U7IA 3L7LA 3WWCA 4X66B 1CB7A 1T5DX 2WYWA 4HGQA 2HESX 1SKAA 2HA0A 3C3XA 4N49A 1JTDB 1AUOA 1T6XA 4F04A 3IUSA 1SXJD 1SVOA 2XEXA 3NMUF 4Y2PA 4BRUA 2V0GA 2BMVA 2XCSB 1NYRA 2PUWA 3TQOA 4JP1A 1HYBA 1P29A 4PTZA 4H6PA 1XCPA 2REBA 3HP1A 5ERXA 4QFBA 4UBKA 4S1VA 3VNAA 3EVDA 5BMVA 3G9ZA 3HKBB 3UGQA 3I04A 1NUAA 3BHJA 3JQGB 4ITVA 1XHEA 3DLCA 5ESXA 4ECAA 1PO7A 3ZPXA 1C1XA 3LC2O 5EZYA 3R20A 1JUDA 1MC5A 2VJQA 5CDYA 3W79A 2F00A 2CVPA 1G8SA 1KK3A 1Q1AA 3Q85A 4UMVA 3SYMA 1NVMB 5JO0A 1AZLA 3AIMA 1B26A 3FF1A 1EESA 1PX2A 2GFIA 3Q98A 3SMQA 2QORA 6ABPA 2CV0A 4ZTUB 3V8RA 1JIKA 3OE7D 2FDRA 1KI1A 4HH0A 4BFVA 4CN8A 1HXHA 3OHPA 4DIFA 2EKLA 4BL0A 3K27A 1F8FA 1WABA 1CUGA 1KIMA 2P6PA 2Y0PA 4OH1A 2C1ZA 1FS4A 5ENVA 1R10A 1ZUIA 3FTQA 1VG1A 1EE2A 1XTKA 1MO2A 4IIVA 4AJ1A 3GIDA 3KB8A 2NU6A 4QQEA 3SNKA 5LKRA 1OWNA 2FQWA 5FD8A 4F4FA 2Y1FA 2I3TA 1JXMA 2WD8A 3QI7A 5L3ZA 4HGZA 3CTMA 4E1VA 2BD0A 4QPJC 4PHTA 2CVZA 4GYKA 2IUEA 3ZE0B 1GDHA 4AP9A 3C3JA 3KQPA 4RTLA 1H4SA 1M66A 3HU1A 3AUFA 3H8JA 3I3OA 2PAAA 2QL5A 1FFCA 2ODQA 2Z30A 2XHEA 1Q57A 3IIJA 2WF5A 3ZWOA 5FHQA 1QHNA 3ZU3A 2E9SA 2VP6A 2EEPA 2P9CA 5LU8A 4YP9A 4B3SB 1E20A 2MHCA 3SBPA 4UD6A 1XUOA 2F6RA 5DZSA 3RS3A 4DA6A 2VQ6A 5C86A 3KJHA 4JNKA 4XYHA 1GLGA 4RK0A 4Y67A 1DG3A 2H5EA 3AEZA 3O47A 4A09B 4X3OA 4YJFB 3RYCA 1SVSA 2HJBA 3W6OA 3PG5A 1CZUA 4V0KA 3I61A 2F9FA 5TNXA 2UVDA 2J45A 1I0LA 5JYCA 2BEVA 1EX9A 2AMFA 2QRVA 2NPFA 3OHMA 5AFSA 1KP2A 3JSXA 4M8IA 5JANA 1Q3HA 2O8VA 3HVJA 3P0FA 3R76A 1APBA 4I1RA 4M55A 3NOVA 3X1KA 2XDQA 4MW5A 3JD4A 4RF5A 3OQ1A 2X5KO 2B8NA 3F6RA 3NBZC 4Y1RA 4WK2B 5G1PA 3RC7A 3KDAA 1MUUA 2UUCB 1A69A 4NBKA 2C5BA 4GOXA 1N32B 3G2OA 5BUZA 2Q46A 2OGUA 1VE9A 4INZA 1RFGE 3DOFA 4MKGA 4UAVA 4MP8A 4RHTA 2C83A 1Z7YA 4UUNA 4DDVA 3R9XA 3M3PA 1MDBA 3FI9A 1X80A 4TMWA 1AXRA 2OOSA 1JDBC 3OX1A 1LVGA 2ZU6A 3TSOA 3R3SA 3ZCXA 4CQMD 2W11A 2CV2A 2EOAA 1RMYA 2HEGA 1YA8A 2W6PA 3I2YX 1W36C 1FFDA 1X7YA 1TF2A 3V8NA 4AU1A 3CR3C 3G8AA 2ZEJA 1SY7A 2C3YA 1H2WA 3WLSA 1XTJA 5CP8A 1QIKA 1HYHA 1D4ZA 3QHAA 2AVDA 1VXRA 3I42A 3LZ6A 5J3JA 1UJ4A 2ACVA 4L72A 1HDEA 1Q1BA 2UDPA 4PO9A 2JL1A 2PR7A 4JR2A 4FVTA 4JSPC 3DNFA 3RHFA 4FAND 1CUDA 3L8MA 3QA3E 4CZXA 3VR6D 5LYJB 3TF5A 1S2IA 1T0IA 3COYA 4FDMA 5KYNA 4F3KA 2PNFA 4HI0E 4E5VA 1CY8A 2OQIA 4Q21A 5DF1A 3KP1A 3THXB 2X1HA 4NLLA 1E77A 4TKVB 1Y6JA 4Q12A 5JZ9A 5IYZB 3ZDBA 3CUYA 3AHFA 1X1DA 5EALA 1PIWA 1Z15A 4JFRA 1LDEA 4PC1A 1TU0A 5GM1A 3U7JA 1NPDA 4WXEA 2EKPA 3CISA 3U44A 1WO8A 2XZTA 4TWRA 5AI8A 1XRSB 4OUKX 2I22A 1YTLA 4B17A 1CJSA 5JROA 3L05A 4O4LA 1RI1A 3RFXA 5L3RA 2GC4A 3DXYA 5CU7A 3H18A 2H57A 3C6MA 3OQJA 1CVIA 2D06A 2EBWA 4GW3A 4POOA 5JMWA 1MAHA 3IB3A 3HWRA 4WACA 1D9XA 4G4GA 3FSGD 4NESA 1Q74A 3PDUA 4BB6A 3L40A 4GAEA 1ZNWA 4KL8S 1B9XA 4Y1GA 4CLHA 1XDUA 1UKBA 2OP0A 1H2BA 1NDHA 4XPZA 1DAMA 2O7QA 5CITA 1E61A 2GD6A 3CY6A 3RGGA 2CK3D 4JUDX 1QIFA 3C7DB 3DC7A 4R7GA 4LF9B 5KU1A 1N2HA 5EWLB 2C94A 1UKCA 2OFPA 1OWOA 2H7XA 3D4IA 3JAKB 4HQOA 1QK3A 1Z35A 2NM0A 2Z58A 3UICA 4DF3A 3GPLA 3SG0A 1ZO8A 1EG2A 4LJ6A 4D4LA 2V65A 1GQ2A 2C54A 4CCYB 4YV0A 2VUHB 3FTEA 4L4ZA 3AONB 4KIUA 3M4YA 3Q5DA 2ZATA 2P68A 2P6UA 3A3KA 3OL2A 5P8WA 4MR7B 3VO2A 4BVHA 4IDBA 1TZJA 1V1MA 4Q7MB 3OPVA 3AHDA 1VSUA 3EXEB 2CDCA 4US0R 1U28A 1HZZA 2XVMA 5CMLA 2VNHA 3RV4A 3O8BA 4Z4EA 3RYHA 3HR8A 4NG4A 3UF0A 4BX0A 5HJ7A 4R2LA 1UK9A 3B1KA 4EBBA 3MYRA 2NADA 3EI3B 5BWMA 5E6UB 3FOWA 4DZZA 3PXWD 4YP7A 3EWEA 1G9XA 1E5TA 1Q84A 1VMEA 2BEJA 2EYQA 3D9QX 5FQOA 2Q3FA 3MRXA 4V3CA 2EL7A 3CO5A 2QOEA 5E0OA 3L02A 5JFTA 4NY1A 1AB6A 5I7EA 2RHHA 2QX7A 4QD3A 4TN1A 4WLOA 4AP5A 3CPHA 1AKEA 2C2ZA 3I0MA 1PR0A 4PHFA 5AJHA 3WK4A 1GGHA 2AW5A 4BX3A 1HLDA 1TCUA 1JHUA 1V0JA 4PX2A 3VNRA 2W2XA 2XBUA 3R3WA 5BSMA 4DADA 4A8HA 8GPBA 1DBVO 4D3ZA 1UC9A 4N5IX 1JHAA 3ER6A 3BOSA 5BSTA 5SICE 4A0AB 4LCJA 4HDRA 4M9CA 4EVSA 1XVLA 1XYVA 4IGEA 4WBSA 2Y71A 5FTNA 1K5HA 2HPVA 3ET4A 3T15A 3W5AA 1TL7C 3QVGB 3V9PA 2O2CA 1RXVA 4IIGA 4U0JA 4P0QB 3ASVA 2QE6A 4E5PA 3DYIA 4I9FA 4JSVC 1CVLA 1V47A 1YI8A 3GLRA 1OH6A 1Q1QA 2XL3A 1T8SA 5U9CA 1CUHA 1NRWA 2B1IA 4RZIA 4KYIB 3COPA 4MGYR 3H6HA 1U7XA 1EVIA 2JH9A 3JVEA 3HLYA 1V1RA 4JSYA 1LSJA 4LGCA 3HKDA 2WF9A 2EX4A 1JDJA 5H17A 3KR1A 3REOA 6PFKA 3SIWA 2Q5IA 3KQYA 2B1RA 3BFKA 4YCDA 5JXIA 2HMSA 4UVEA 3JD0A 1AN9A 2VDUE 3MZ0A 1K8YB 3K2IA 3MMZA 5LWQA 2L19A 2FEWB 5C7YA 4D4MA 3QJ5A 3MGAA 2G72A 4V1CB 4E4YA 1ODIA 2HNAA 1XMXA 4HL6A 1U9ZA 4WZAA 1U5CA 5JBQA 4GOJA 2BP7A 1GOFA 2DBVO 3ZVNA 1CS0A 1W1IA 1TB4A 3C7AA 2WC1A 2WTNA 2IS4A 1NX6A 4M37A 1B43A 4Z1OA 3HRKA 3UH1A 1NLYA 4QL1A 5HGXA 2JLYA 4DABA 2JBAA 3GB9A 1BFUA 1HDOA 3ZLBA 2QM0A 4C7KA 4YRKA 1ISGA 4XCQA 3LH5A 2CDNA 3CB2A 1YASA 3D6AA 4U2GA 1KI2A 2H1VA 2W2KB 3V1LA 1ZNYA 2BJVA 4GC9A 2WOOA 3V33A 1I0ZA 1J0BA 1KIFA 4MK4A 1EYZA 5K0FA 3QXSA 4PPYA 4GVLA 1U9IC 5LMNB 5D3ZA 5KWEA 4P3KA 2A94A 1WWKA 2YWCA 3WYFA 4X7BA 3L1IA 3HY4A 4BFYA 2A30A 3PD1A 1K89A 1YVRA 5IFLA 3N9IA 4GPEA 4EHIA 4WBNF 2CC2A 4D8VA 5LP1A 4HH1A 4NRDA 4JQYA 1T8YA 4RCYA 4U7TB 2XZOA 5HW0A 1QRSA 1CJMA 2WU1A 3C5CA 3U60B 3FUVA 4Q0MA 2OCAA 1HFJA 2ZE8A 3DOEA 3JQAB 4IDDA 3QMPA 4BVKA 4UDXX 5EIWA 5K2OA 1COWD 2JGKA 2Z1NA 2WWFA 2I3AA 3QVWA 2C82A 2CJXA 3FYCA 4JELA 4KLCA 5HX7A 2JHCA 4RYDA 2IWKA 4XLLA 3BGOS 4RS3A 1K3FA 4DCUA 2NV2B 4UZEA 2IWRA 2Z6QA 4WGGA 4C4TA 4RVOA 2MJLA 3AL8B 3AUSA 5LPNA 4YJ3A 1A4IA 2HYDA 3KU4A 4RDIA 1GG2A 4X60B 1BGXT 2FMUA 5LM3A 1R0BA 3M5PA 4N6GA 4WECA 3CKKA 1NUTA 1E96A 1IC6A 2Q6IA 3I7PA 2X3UA 3EIQA 3PXCX 1EGMB 2OWEA 4QL3A 4U7HA 5DHTA 2B78A 1RYZA 1P5HA 1FS6A 2JLVA 3X1JA 4QJ5A 4I1UA 3TSCA 3B70A 4BFSA 1E3DA 1B7GO 2SNIE 4JR1A 3ZIDA 2EIBA 3KD2A 1TVKB 2PUVA 4ZT7A 2ZOSA 3D4LA 2OV4A 3PFCA 2QMEA 3GPCA 3KPUA 4HFNA 5KKAA 4C08A 2WHXA 4EGCB 3LCVB 4CIYA 5CRIA 1NURA 2GUWA 4V02A 2O0JA 3MWFA 3RWBA 3GQVA 5A6VA 2DPGA 2FUG1 5JUWA 1XJCA 4FOLA 2HLNA 1MA3A 4II3A 4EJMA 1Z0SA 1LA2A 3KQNA 3GT0A 1P74A 3GUUA 2BHSA 4KRFA 1M2OA 1E1RD 4AM8A 3GR6A 3CU5A 4OREX 3C6YA 3LCMA 5DEOA 5CB4B 1DAKA 1X13A 2O2XA 3V1YA 5HSGA 4AO7A 4JLDA 2C7PA 4AQDA 1F9EA 2HQBA 2ZB2A 4RD6A 1XZQA 3E7DA 4X64B 3HCOA 4K8OA 2CUKA 2HLDA 1U0FA 4AZ0B 1QH8B 3FFWA 2P9UC 2XMZA 4GC5A 4MPJA 3ZQKA 4E6PA 1IY8A 2P9GA 3SE0A 2FEKA 5J1TB 4B43A 1Y8QB 3RW9A 2A9OA 2OTCA 1RQRA 4L08A 3ZCRA 2DECA 2R25B 4WJZA 3SQWA 4NAAA 1Y33E 1A76A 2P6NA 3B13B 2AFVA 3GJ0A 3AY0A 3QYJA 2EERA 1KYWA 1L5GA 5M5VA 4L51A 1PZEA 2RHBA 2AFHB 1MH1A 2X0RA 3Q8MA 1TKRA 2I4TA 4RIHA 3BEDA 2B2NA 5AVRA 5KTSA 1DX9A 1KPIA 3HCDA 4C3OB 3QEBZ 4C76A 3RF6A 3UCEA 1CY4A 1CUYA 1AXGA 4OQDA 3VI4B 3K30A 1ZA1A 4JUFA 4OOEA 2H07A 5IT9A 3LDGA 4OATA 1FU4A 3JQFA 5KQLA 2YOHA 5KTPA 4TV8A 4YRMA 5M34A 3AR4A 4HZUB 2XE8A 4WFJA 1F5NA 3DO5A 1LW7A 5JALA 5EE0A 2UXBB 3FFAA 3DSMA 3UMJA 4UFNA 1L4GA 2FW0A 4DDKA 4O4IB 3GLHA 3N5CA 2Z8YM 1MV8A 1H94A 3CRZA 4V2UA 1ZRSA 1XMVA 2HJGA 3K6KA 2F1JA 1UPUA 1O77A 2WIDA 4HO1X 3K8OE 1C8BA 2J55H 4DRYA 2Q1XA 3BIXA 4CM3A 1YA4A 1E9BA 1ZVMA 3IMCA 2PM7B 3E05A 3F4LA 1ODFA 3A1WA 3KS9A 3U13A 3WRXA 1LQTA 4DG5A 4J7CA 5TEVA 3MWEA 3QPDA 5TF0A 2BN4A 2J31A 2EGGA 1XR3A 3R3HA 1JFLA 4WW0A 3BH7A 1VLLA 5C2VB 1EE9A 1L7NA 4OKIA 4XCVA 5CUQA 5IMBA 1NF2A 2IU4A 2P9ZA 4BNLA 5CDSA 5LVAA 2FSIA 5JJLA 1GZDA 1TD1A 4TV9A 1Z7WA 2JGNA 5F78A 5K0LA 1W29A 3U7RA 1NTRA 4BP3A 2G1PA 4YO8A 1NJGA 2LDBA 3V4RA 3CFSB 1R7RA 4YRBA 2YWJA 3T95A 4XOUA 2RK6A 5C8ZA 2DVMA 3HADA 1EK6A 4ZT6A 1MQ8B 4N76A 3K09C 1GUYA 5I7UA 1TQ6A 3OOEA 1E58A 1UZUA 3G9TA 5FORA 3F78A 5C3MA 3SQDA 5EJMA 2ENUA 4KR3A 3VOAA 2WMNB 5IG2A 1MG2A 5KVQA 4AZWA 4UHDA 4O4LF 1SZDA 4AMBA 1FNDA 1FRZA 1WRBA 1KEVA 4OQNA 1N4DA 3V9AA 2ZDGA 2QSJA 1DC3A 2BZSA 2P0AA 2XMCA 5THAA 1NJ1A 2WA1A 3BD8A 1D09A 4JQCA 2GCGA 2XUGA 3AZOA 5BWBA 5ETJA 2C59A 2Y05A 4LVNA 2P65A 3LO5A 1ZK4A 4PYOA 2YXLA 4V39A 5B1DA 1XA4A 3IBTA 1DELA 1DXYA 2BJHA 4KG7A 1U0JA 1T34A 5G0WA 4E33A 1PR2A 1GRVA 1Y37A 1E3EA 1M1ZA 3BL6A 1KZ6A 3DT6A 1O5OA 1S2GA 3U44B 3N0RA 2JA2A 3WMGA 2W00A 4YJ2B 2FZGA 1KBOA 3OPYI 4YQYA 1O94A 3W5JA 4PZZA 3CTPA 4NMWA 4V3BA 4NMLA 1KI4A 4UEOA 2PYIA 2N1BA 5BQXA 1WPXA 1UJNA 3DE1X 2WPDD 3DBRB 1PJBA 1L9KA 4MV1A 4R1MA 1ZL2A 2HTFA 5TV2A 3T7KA 2EFHB 5LYJA 2IXTA 7ADHA 2HF8A 1G21B 3IVXA 1OU0A 1JIUA 2ZJFA 3R3YA 4GF5A 4JX9A 2W93A 3E0XA 4PHCA 3ZTWA 4E13A 4RDHA 3VKUA 4NJMA 2WVHA 3K0CA 4FNGA 4JOQA 5CFNA 2WSMA 4Q1FA 1SKBA 2XWJI 4KTTE 4IRMA 1H2FA 3G2KA 4ZT4A 2JFOA 3EVGA 2BKEA 3NBQA 3F7TA 1IK4A 4P98A 3S2UA 2QWXA 5CG2A 1N5LA 4UXIA 2YYYA 3VOSA 3O31A 2IU3A 4AJIA 4XUCA 4F4JA 4BOYA 3ED1A 4R9VA 1N6FA 2HU8A 1XLTA 1JGTA 2ZSKA 3PYLA 3KB6A 3KTAB 1JA1A 1DX6A 3TQIA 1RAIA 1R27A 2JJMA 3KUUA 5C53B 3F8SA 4JFAA 4LKRA 2WKWA 4QRHA 1IQRA 4G23A 5MF6A 4R2WA 1D1SA 4NQZA 2IEZA 4TTVA 3DHWC 5LQJA 4MVJA 3RRMC 3BT7A 4CY2A 2QV7A 2YJNA 4ARAA 3EI4A 4HDOB 3MWYW 4TXJA 3MCWA 2LPMA 1CEXA 2QP3A 4MTLA 1D1PA 4JI5B 1Y3HA 4BZWA 4DWOA 3C1AA 3HMQA 4G5SA 5DBIA 2EDCA 2P4EA 3AUAA 5NULA 4GWLA 5AK5A 1T9AA 1ID1A 3S70A 3ZV6A 1U81A 4IIJF 1NVWQ 4KWEA 1Z5GA 2BEVB 5LCXA 1E7QA 3RJZA 4AN4A 2H51A 1GRCA 3F4BA 4LHXA 5DBHX 2XODA 3M6UA 4OB8A 1NA5A 4FNOA 4KVFA 1OVGA 3LDUA 4V24A 2HK8A 4BFWA 1K8ZB 5D6OA 2UYHA 1T0BA 3PEFA 2ZIFA 4GPZA 3UXYA 2IH4A 1Y42X 2JD0A 4WK0B 1QH1A 1W46A 2H8GA 2JATA 3W7BA 4A5OA 1VKJA 5G4KA 2P5YA 1K68A 3R6GA 5FBQB 1XMOB 5KS2A 5BRJA 3VR5A 3GRCA 1ECLA 1VL8A 2ZWIA 4ZWNA 3VDXA 1DQNA 1P3Y1 2VKQA 2LCIA 3MOIA 4J0EA 4FHGA 2F8TA 3C43A 5K4GA 1W85A 4I4LA 4WVLA 1HDIA 4FUTA 2JBAB 2QAGB 1RHKA 5ECGC 1NYQA 5JRDS 2OORA 1MEJA 2HF9A 2B4EA 4B6GA 3GMSA 2RKBA 3O1HB 3H0KA 4PSXB 3BCRA 4QEKA 4BQIA 5CH3A 1UAAA 2QBYA 1NG1A 2C2BA 2HHAA 1WAMA 1SPXA 2QTFA 2VJBA 3DFUA 4IXMA 2NU9B 4B40A 4JVMA 4ZJZA 1YL5A 4LXUA 2R60A 3MWKA 4IFTA 4M60A 1OA1A 1T5OA 3BF8A 4EY4A 4ON9A 2IYYA 1WTAA 3MINB 2VK2A 4R9UC 5EPOA 1SXGA 1FTQA 5DX0A 4AN0A 3QEAZ 4PBZA 1CRZA 1T1EA 2MSWA 1SKUA 3K1JA 1QTRA 3KXLA 4RYLA 3C70A 4LHSA 2G9AA 2H9MA 2ZBQA 4UMEA 3U61B 3H05A 2CXTA 3QOWA 4RD4A 3NVNA 1SXJC 1JLLB 1QYIA 5IM4A 1NOIA 4A23A 4RHCA 4C43A 1G21A 4CNBA 5HKBA 2Y2VA 2AWOA 1IWOA 2Z8ZA 3LAWA 1MQSA 4FBLA 4BAGA 5BR1A 1Q0HA 2D5BA 5GAJA 3SJBA 2J5RA 1JHRA 1WB5A 1VLVA 2G1AA 3T7IA 1N25A 4DDHA 2BMJA 3TW8A 5CW2A 1XWIA 3E23A 3ICQB 2BGGA 2GN2A 4OAPA 1J2TA 4DLNA 5BV8A 2ZI6A 4FDLA 3DB2A 2O3TA 3OEYA 2OORC 5JXGA 1CB0A 4OA5A 4LRSB 1UT5A 4IKEA 2WJGA 1RCTE 2KLHA 1UM9A 4JQSA 1F14A 1EDBA 1NKVA 2VRNA 4CL2A 1BX0A 1WEHA 3L0ZA 5CPFA 1XCJA 1FP6A 2WTUA 4DIDA 1LQUA 4KPYA 3UW3A 3JQ8B 3DFKA 4X1IB 4HNRA 2O5VA 1Y48E 3IERA 3AEYA 2KS6A 1E5DA 2Z4SA 3CZQA 3DMDA 3M5WA 3LUAA 4JZKA 3FOBA 5F4ZA 4XWOA 5IDQA 4YYEA 1P3JA 5CEEA 4O59O 3QOYA 3W90A 3WP0A 3PWZA 5BVGA 5B6IA 2YTZA 2C8LA 5B7NA 2P62A 1SCUB 2QR2A 1NULA 3B7PA 2OCPA 3IVCA 3E03A 3K96A 3CLSD 4NU6A 1JDNA 1UXJA 2F3TA 1A5BB 3BA1A 3C4JA 2VDNB 1NQWA 1P60A 1TVEA 4L6CA 1FUYB 2GKGA 2QKYA 4URHA 3W2FA 3AUJB 3W77A 2P3QA 3ZKWA 4YUAA 3M3HA 1JJBA 4KN6A 1NE7A 3AUTA 4CZYA 4JCOA 3WYGA 2OBMA 3HFJA 5AI5A 4AJJA 4CKEA 1JG7A 4XCXA 3RHZA 4ENWA 1ODKA 1NBIA 3NHYA 3PX3A 1KEEA 4KU4A 4QHYA 1Q3TA 4GMBA 1WZ2A 3NVKI 3MXOA 5J5AA 2YX1A 1KEPA 2JEOA 3LXUX 3AYXB 3KEMA 3NGXA 1YBAA 3R5JA 3SYTA 2GNAA 2K2WA 4ZGBA 3PXEA 5CDTA 4KFCA 4KLZA 1G6KA 1MNQA 3QVLA 1L3BA 4QJIA 2M9MA 4U7GA 3MXXA 1K5GA 1YBVA 3S29A 5JS2A 3WGTA 2I03A 2VDOB 4TL8A 2ZYTX 8ATCA 3B1VA 4JN6B 1EXNA 1II0A 2JKVA 5EFZA 4AJ4A 4KPGA 3ZD9A 4NPHA 1NUUA 1UMDB 2NVOA 4DBLC 3EMKA 2VH5R 4PLCA 4WLVA 4PYJA 2C97A 5E7MA 1HT3A 4D8XA 3DL4A 4PYIA 1Z9BA 3PNVA 1YZKA 3KU1A 2CO0C 3I2FA 4MDFA 1R6DA 1XKTA 4K1LA 3DF7A 3ILYA 3R40A 5F2OA 4MI6A 2W4MA 3IP9A 5BVGB 4BNJA 1OWMA 2RAPA 3X1ZA 1R3UA 5FUBA 4BWVA 2UXCB 2QXTA 1JZSA 4FMBB 1UMKA 1JR4A 4TV8B 4M83A 2RGBA 1NUHA 3DBHB 3FGOA 5ERYA 4C3ZA 2Q1TA 2CCGA 3WRWA 3ZU5A 4BN0A 5JPCA 4F71A 1T3ZA 3K92A 1MOSA 2BW0A 3J81k 4QUAA 4F8YA 2QTAA 2EJBA 5AJTA 3ZZMA 1J90A 1LJUA 3PPIA 4B6FA 4JB3A 1JBQA 3DD5A 1NW5A 2DFKB 1VB5A 3HJAA 3PHJA 4HATA 4QOIA 1L1EA 3D7KA 4GUAA 4AWBA 1VJ0A 2FW7A 2VDWB 5KTTA 1Z37A 2AIRA 1SIBE 3PFGA 3P0IA 4FYHA 3T9FA 2O1XA 3KXKA 3Q88A 1TQ2A 4JEIA 2GRAA 3PZBA 3PJGA 3DLAA 1OTYA 3UANA 5F3WB 2ZKLA 1L5HA 3GFRA 1U6IA 5JD6A 1ZK2A 1ZGGA 5FF9A 3T54A 1LH0A 2E4AA 4NL4H 4QRIA 5EMLA 2AJCA 4G67A 1SIOA 3OM8A 1YVUA 3N2NA 1PYGA 3EVZA 1V39A 4UNSA 5T6BA 1A8PA 1SOUA 2GAFA 4EATA 1B4DA 3USZA 2RBGA 2R1ZA 3UJ8A 1DARA 2PM9B 1R4AA 4JS0A 4ALJA 4CF5A 4EG8A 1DUVG 1E1KA 1E9EA 3A11A 3JARA 3WK7A 1X94A 2PCJA 1ZIYA 4JJFA 1HEUA 2J3HA 3UTDA 3QM1A 4HFJA 4K03A 5KJEA 3HDGA 1F4PA 2XNHA 5FQNA 3MA0A 5FOXA 4EFKA 3BMNB 3K32A 3HNRA 4JLWA 1K7EB 2O20A 1GCAA 2E3JA 4PICA 1X9GA 4ZZ0A 2QU7A 1ZRHA 2H4JA 2IIBA 5EYPA 5GQSA 2GBGA 4OA8A 2WUFA 1U0GA 2OHGA 2REQA 1EIZA 1ML3A 1TVKA 1VJ1A 4K9OA 4XGKA 1U98A 3ZGVA 3GCZA 4DIKA 5C4IA 3KWJA 4JSRA 2W2TA 3IAUA 3V8EA 2ZI7A 1FMTA 4KQJA 5L4NA 2P8JA 3R1IA 4V0MA 3ER9A 2IIPA 3B38A 4IXDA 5ELXA 4LX0A 3GG2A 5M5BA 2XOEA 3NANA 3NM4A 4ABTA 3VPXA 2PJDA 2V45A 4FMPA 4MAMA 1DX4A 2YNMD 4RVUA 1EDOA 3VVCA 5AUOB 5KSWB 4HVTA 1IMOA 2OE2A 3RIXA 2FWJA 2GPAA 2DUMA 3NVMB 3F1LA 1Y9JA 4HQRA 1XVVA 4WERA 4WXYB 1KMNA 1L4HA 4Y2RA 2L2QA 2X1VA 3NTRA 2WYOA 5EYPB 1GT6A 2VPYA 3OKCA 4NBSA 1C30A 3DBOB 1PI3A 4PBRA 3U7GA 3BXGA 3IAM6 2EYUA 3ND9A 1TYCA 3RS0A 2VAPA 1QGOA 1DRJA 3EU7A 4WNCA 4DLPA 4HNVA 1P5JA 1Z28A 3V7DB 2UV8A 4K9KA 2Y93A 2EP5A 1QVWA 3FDFA 1RBQA 1GPJA 2RH5A 1YXMA 5G3ZA 2DE0X 3GNSA 4R3UC 4PN3A 1T10A 4CM9A 4L22A 5K5EA 1Q20A 2XMDA 2GJ8A 3CIKB 3ANTA 3E82A 3Q7SA 5DXFA 3ZZ0A 2K6GA 5LUBA 3I7HA 1PJAA 4R8LA 4OQXA 4Q3AA 5JW6A 2PS1A 4QOFA 2ONCA 3ZEIA 4HAOA 4X95A 1Z0DA 4K9NA 4BWFB 1OTXA 1W2WB 3JZAA 4Z51A 1P19A 1Z33A 3B82A 2CJFA 2BGTA 5G0VA 3CZPA 4UM8A 3B6KA 4HRXA 3D6VA 3C24A 2AG6A 4UXJA 2I9KA 4X45A 4CQNA 1N6NA 1NAIA 3LW8A 3UTCA 1LVHA 1BVUA 4RM2A 4AAYA 4MPRA 3GT4A 3TTUA 1ORWA 2J1LA 2D3WA 1R0YA 2XNCA 3LJKA 1USUA 3PGMA 3SC2A 4UPDA 1ZK0A 1KPGA 1W2HA 3A32A 1A1VA 2RGDA 3BQ9A 3TTXA 2XTZA 3ESAA 1QFZA 4L7VA 3EXIA 2Q6TA 3O21A 1C1DA 4CT4B 1J56A 5FBWB 1V6AA 3NETA 4G37A 3Q8KA 1CUCA 2X2EA 3GFFA 3HZHA 3QTBA 2ZE7A 3GLFB 3ACDA 2LCFA 4EGJA 1YWGO 1HRKA 2NZXA 4IJUA 4TROA 4ZOLF 1M75A 2FPSA 5BMVF 4X91A 1OZ0A 4IZ6A 3JAWB 5JCJA 3WY9A 4EKEA 4ZAGA 2IJGX 4HYTA 3T1VA 1JHVA 4FMCB 2ZI5A 3E1KA 5JH7F 2JGFA 3X1WA 1I1OA 1U7HA 3ZDYB 1ZEJA 2ISCA 2LDXA 3C6KA 4JT9A 1ZEMA 3IVRA 3OLYA 3DUFB 4MIEA 1H1LA 3FPGA 5AUNB 5D3KA 1FMJA 1A7KA 1G63A 4W5JA 4E12A 1C0PA 5JAMA 1E2KA 1IONA 4NFSA 1VKZA 2O57A 1IXYA 5KJCA 3PCRB 1RHJA 2AI2A 1W35A 2V96A 2WILA 1EAYA 5KNBD 1I2ZA 4O2BA 1DI0A 5T8KC 2QYSA 2ECQA 5JD4A 3DL7A 2YYAA 1VHWA 2KSQA 4KDCA 4P1ZA 2R68A 1VZ3A 1H1DA 1MXFA 1ZM3A 2GEFA 2JI6A 4IDFA 1M33A 4W99A 4X44A 3UWMA 4XSVA 1UWVA 2WI8A 3RR2A 3UJ3X 3ICOA 1NMYA 1FPMA 2VP9A 3OECA 1UXIA 1SH7A 1G5FA 621PA 3B1FA 4F1WA 4P3PA 2O2SA 1G8JA 3ZCPA 2EP8A 2HGZA 4IHJF 4ETNA 1G291 1TMOA 3P0EA 4Y2HA 5I7WA 3O8LA 4RORA 1I7DA 2FH5B 1SCUA 5TRTA 4EL5A 2GOYA 2PKXA 1UDAA 4ZRDA 5FKRA 1VYVA 3UHAA 3NM6B 3FIUA 4MKXA 4M1TA 4UHBA 2HLHA 1N9KA 1SG0A 3HYRA 3WNVA 3CBQA 3Q7EA 1GSAA 2BT4A 2FMHA 5LBUA 1CDOA 2J6CA 1V7QA 4NNJA 4RQTA 3DCNA 5CVCA 5F7ZA 3ND5A 3STHA 3DE5X 4GLLA 4DT1B 1AGNA 4J43A 4JEMA 2CZCA 2Q0QA 1I6LA 2VSQA 2QLFA 3LYLA 3G79A 5CX1A 2WJ6A 4GM1A 1H5NA 2J4CA 2ZVPX 3MGGA 3QYPA 3IAHA 4KVGA 4O4IA 1OPXA 3GK3A 4Q39A 2YNMA 1ZVKA 3JZDA 4ZAXA 3RUDA 3K26A 1JFRA 2BF7A 4URWR 3ZNNA 5AVUA 4JHXA 2CLIB 4FJ0A 4JBNA 5AYVA 4D9JA 2WHEA 2FV8A 5AKZA 3QYFA 4NBWA 1M8GA 3NZEA 2IPOA 5K8TA 1TM2A 3SF8B 1M74A 2E1PA 4FDTA 1F20A 3R5XA 3GD5A 3QXGA 3SI7A 5CIYA 4QFCA 3ZWCA 1ZKMA 5EXXA 1N5JA 2CMKA 1NU8A 4NOLA 5JAQA 1WKVA 1YB1A 2I55A 4BCDA 1NXXA 4NTZA 2YVKA 3O38A 4WFQA 3O93A 4P7JA 4JU9A 3QYAA 3DEYX 5K45A 3HQ4O 2AJBA 4M99A 1O54A 2D74A 2RGNC 1IG3A 3BYZA 3NP7A 1B1CA 1SCAA 2A4MA 2LZ0A 3NT2A 4OV6B 3GEMA 4L5CA 5E2AA 2AK2A 3R7WA 5B7GA 1RXWA 3N6RA 1N75A 4ZI2A 4ERXA 4IV8A 3V2UA 3VA7A 1CSEE 3Q8XB 4PLPA 4UOEA 2YUIA 5JSYA 1QVAA 4OP2A 1FFEA 4YUWA 5J58A 4BEVA 1UBHS 1CJTC 3NBKA 5I5MA 5EAMA 2CE2X 1ZD2P 3IEPA 3JQBC 1CRWG 3OQVA 1GNSA 1A0OA 4B3HA 4OSOA 1P44A 3CUSA 4R0VA 4S04A 4H1TA 2X0IA 5KKCA 2IEDA 5GONB 3ETJA 4BGIA 2PX0A 2VTKA 2EFCB 1MPTA 5WRFA 1Y1PA 4BRZA 3OD5A 5DU2A 2V5UA 3CF0A 4BQFA 1C0KA 4NJEB 2FSVA 3T5GA 3GVPA 3MTJA 4AP6A 4AG6A 1QGUB 3GT7A 2AQKA 4C7MA 3R4VA 4DLVA 4CN9A 1XZEA 4D25A 4AWAA 3RTGA 1AKYA 4WK4A 3VR3D 2P5TB 2XXAB 5CXBB 4UU1A 4FFRA 3UJPA 1AXEA 1OBFO 4NE7A 1PBYB 1TZMA 4LCBA 2ACWA 5U4XA 2ZUUA 5AIAA 1D4OA 1VYTA 2RGNA 1D6NA 1BXGB 1L1RA 1B3RA 4N9QA 4PC2A 1ULUA 3WA7A 3JALA 4LOIA 3X2SA 2JDIA 3DQQA 3LPAA 5KNDH 5AM2A 5B58T 4CI8A 2JFYA 4QASA 5CLJA 1ZH8A 3HVIA 2IPXA 3Q6IA 4KOEC 4WUTA 2X9NA 4KC0A 5DX8A 2DFNA 3V4OA 5LU9A 3RI3A 5JO9A 4DLSA 1QU2A 3LXRA 2OO3A 4DY4A 1HDGO 3HVRA 2IITA 2CZQA 2REQB 4P0TA 2C3PA 1Q0RA 1TQHA 1P1JA 2DFTA 3TD9A 2ATXA 1HI9A 1IE3A 2JLBA 2YN4A 3K5HA 2LCQA 4KXFB 1JX6A 1EUZA 3KQMA 4QUJA 2NUTB 1RYMA 3SHFA 1PG0A 3GV0A 1E79D 3OLWA 3IELA 2VNIA 1YDWA 4KSYA 2QSYA 3HL0A 2XDAA 4A0GA 2NTYC 3EUWA 3MEQA 2O50A 3LFHA 5H59A 3EGOA 2ZRMA 2CXQA 3D0RA 5EEGA 3STTA 3SU8A 2DT8A 4DA7A 3OBIA 4LY6A 1EFAA 3ZS9A 2NX2A 2NTVA 2AK3A 2WG2A 1Q1EA 5DHFA 5D5HA 3W8NA 1NUQA 5B3KA 3NIDA 4WKNA 1LSSA 1RYHA 2XE4A 3CPJB 1ZR4A 4D42A 3F7NA 2VXBA 4J0GA 3JZHA 3BSFA 3INRA 1XTVA 2AJ8A 3HKEA 4IDOA 1CNEA 1O4VA 4NZZA 2P6MA 2Y68A 1MAVA 3MTDA 4BO2A 3H2HA 3OTTA 4KQMA 4LFBB 1L5FA 4N03A 1L1FA 3HKCA 3EEFA 4B6RA 5IRCD 2AH1A 1OGJA 5GZ6A 4CLOB 2AVNA 4XDYA 2AZDA 4L50A 4QICA 4D0KA 1QBGA 2Z08A 3JQDA 3NR2A 5TS3A 5DN6D 4JQOA 4IQ8A 3ZE0A 1YR1A 3QXXA 4YJ2A 2IUVA 2SCUA 3BQNB 3L7YA 3JQ9A 2D1YA 5F2KA 1T13A 5THQA 3W05A 3PNLA 2ZXFA 4Y0NA 3ROKA 4CEIB 4B3FX 1VMAA 1VL2A 4QXQA 2J0QA 1JHXA 1K0UA 4TQ9A 4K9RA 5JWHA 3QPUA 3GFBA 4KRYA 5E3IA 4RGQA 2VSOA 3LUHA 1FFSA 1OXSC 2Y67A 3NASA 4KMRA 3OOSA 1H66A 1Z0UA 4ZVQA 4EVIA 4QOJA 1I6MA 2BFPA 2ZRLA 4PNKB 4YCNA 3PGLA 3A4IA 4J7XA 4X62B 1ZOSA 5DW0A 3MK31 4AL4A 3KT3A 3RDPA 4R8MA 3OCYA 5FP0A 4N0MA 3AVOA 3VV3A 1MGOA 4RF2A 3W9BA 4ESGA 2X22A 4ZYWA 4MYDA 1LJ8A 3ZWXA 4DHEA 5LA6A 2FRVA 3GLIA 1B6GA 2W90A 2QDKA 1VPVA 2PMCA 5LQRA 3QWAA 3USCS 4ENUA 4LXHA 1Y82A 1VL6A 3QWIA 2W8BA 1RZRD 2CVQA 3H1AA 5FWDA 1URPA 3HA3A 2JA1A 1OVMA 4IS2A 3KUDA 5I7AA 5A0FA 4KMSA 3ZHQA 4B3JA 5BSFA 6YASA 4PTYA 1E89A 4NCBA 1S02A 3CUTA 3DPIA 1C4OA 1JB9A 3TM4A 4R3NA 4TMKA 3HUTA 3H5TA 1L5MA 3K6SB 1OB2A 2WINI 1GPYA 2ZJYA 3NX4A 1XZAA 2YV3A 4PYMA 1O9GA 3D5TA 3MW8A 1AT1A 1CC1S 4AMVA 4F06A 1NQUA 1T8PA 2LD4A 1YZUA 2RGEA 3LBFA 3THOA 4YV2A 1H6BA 4PSDA 1L4UA 1T1SA 2DLNA 3O2QB 1BA3A 1C5KA 3FPAA 1R0CA 2IPNA 2PHZA 3H2SA 4KYVA 4ZVRA 4BJ1A 3AEXA 2CHFA 1CCWA 2ID8A 4YMWA 2J4DA 2ZUFA 3ZGLA 1YRQA 4NMHA 3Q3IA 3DZIA 1ECGA 1X7HA 1P18A 2OO5A 1P8JA 4XD2A 1QPZA 5DLPA 2CE9A 3T7DA 4A9AA 3A70A 3EI3A 3ADCA 4HKTA 2UU9B 4MHTA 3WAJA 3AUUA 2NYAA 1H0SA 2ORIA 1WG8A 2X77A 4HXEB 4B6EA 2QTBA 4TV9F 3ZYZA 2NO4A 3D4BA 5BNWA 3AM1A 1XMIA 2OCDA 1L2TA 3OC0A 6CHYA 2Q41A 4IV0A 4PO8A 4ZQIA 3RSQA 1EFHA 2BJWA 1KOFA 2UYGA 4GXNA 3KR2A 3S7TA 4AG3A 5EP2A 5LZ9A 3DMPA 5K8LA 1ZJWA 1RJWA 2EZ8A 1FFXB 3L0IB 1J9ZA 3N0XA 5KSOA 3AB7A 4S1WA 1TBGA 4EQ6B 1X9IA 3A1NA 4X63A 2Y1GA 5I9TA 3GLIE 1XHFA 1GIAA 1DWUA 2XSZA 5REQB 3UB4A 1W4LA 1M7HA 2J41A 5CYGA 4L8WB 1GZ5A 4M7WA 2QB5A 2YNPA 3NAMA 4Q34A 2ON6A 4O2WA 5BSUA 2HNBA 5EL0A 4CDNA 4CLDA 4P33A 1ZICA 2NG1A 3OLCX 2UVQA 1U3WA 3WC4A 1K6JA 1OAOA 3DZBA 2PVPA 4JYCA 3ORYA 3SBXA 4DY6A 3LCCA 1NMQA 2VRBA 2C88A 1SVNA 2ZAOA 2B0CA 3NEYA 5TVGA 2XQGA 1H2XA 5TDHA 1R5NA 1ZG3A 2FR0A 2XUAA 1KEKA 1UTCA 1DDIA 4X1YB 1WV1A 2G9ZA 4LNHA 4WKPA 1NXOA 5B4VA 2ZW9A 1KAMA 4MDEA 2PFSA 3K0FB 4GQIA 4RAOA 1KYIA 4IIEA 2YINC 2O1SA 3BH0A 2C0CA 2JFBA 2AG8A 4QJBA 2QAGC 1MC1A 1S2OA 4TRJA 1U9JA 2ZYVX 1X7DA 1K6XA 4QT0A 5JOQA 1GAEO 4DR2B 2QXVA 2R2AA 1QH0A 4B34A 2CVHA 1FF9A 1GTJ1 2DFDA 4AC9A 4I3HA 4WLNA 1U5BA 1ZUNA 1DEHA 4HNQA 4CM9D 3DONA 1N34B 1TZCA 2G7MC 2MYUA 3QEKA 4PFKA 4RH1A 5D51S 5HE3B 5DTEA 1U0EA 3TMKA 4CR8A 5IYZA 1RPTA 2NUAA 5K19A 5G2OA 2H08A 4GI7A 1ZSVA 2QPTA 3GXBA 1RWPA 1CNFA 3P19A 1HQCA 2XUQA 2E5FA 1CIJA 1VBKA 3KJXA 4PYNA 1P39A 3WVNA 1P91A 3HCEA 1G6OA 4K7JA 4E03A 4EIWA 1AO0A 1AHPA 4B85A 1GRRA 5JASA 2ENWA 3KBOA 3U6KA 1XAHA 1CR6A 3GGJA 3NBXX 5G4KB 3QHYB 1UKYA 1JAIA 2O14A 2VPWA 1R5OA 3G23A 1XNGA 3AL8A 4X3PA 1P5ZB 2QTRA 3P4YA 4NH0A 4LXTA 3ZHOA 2ICAA 4JP8A 5B12A 3NG1A 1AS2A 2Q2VA 4Y2UA 4JJ8A 2ZSHA 1JYEA 3GRAA 3JQQA 2ZJ2A 4NEGA 2WLSA 4UQLA 5TSDA 1ZP6A 3PXUA 5JXHA 1W6RA 1D0VA 1V9LA 2Q6LA 1A95A 3Q2OA 4KQ2A 2YWXA 4W82A 2W6ID 1T36A 2PWPA 4QU8A 5MN5A 4DUGD 2O05A 1C9DB 2PT7A 1XU4A 3CF6R 4E7PA 5C4MA 1CNMA 4ND2A 4YIHA 5JCPA 1DC6A 4BLRA 3LRXA 1GNLA 4ASUA 4GGCA 3GJ5A 3BG5A 3KFVA 1W19A 4GPAA 4ETWA 4OXKA 1K7XB 2LKCA 3HJRA 3MCZA 5TY0A 4LY9A 3VC7A 3RSLA 1MA0A 2GVNA 2WRZA 5A5FA 3KD3A 5CBKA 3PKIA 2RARA 1LFDB 1TM7E 3NC0C 5BNTA 4WFIA 3W8EA 1PT8A 1S8NA 3FJ1A 3Q41A 4UJ5A 3HXKA 4D1YA 1JV2B 4E32A 2FOXA 1BHO1 4KGDA 3SX0A 4EHDA 4H18A 1LPAB 2DETA 4JZYA 3JZFA 1N6EA 2DT5A 2QM7A 1D7OA 1OZHA 2VPTA 1IXSB 2F2TA 3GEEA 1NBHA 4BDSA 1LTQA 5IF9A 2WB2A 1DC4A 4MZXA 1MOZA 5AXCA 3VDQA 5CT8A 1XRMA 2R6JA 4YJHA 3PUVA 5ARCA 1NVVQ 2GCOA 3H2KA 1FK8A 1EA5A 4C7JA 1IBKB 3BXHA 3JR3A 3IKOA 3DXXA 5BSEA 2ZI3A 5ALTA 1MXHA 3BJEA 4CJXA 5L3QA 3G7NA 4BNVA 4DKJA 2R87A 3ZZTA 1KO8A 3L7AA 2Y1EA 4QBHA 3ZW7A 2P75A 3UMYA 2O06A 4MVJG 1QQTA 2ZR0A 4ZODA 1M8KA 1PN3A 1WXFA 2WP8J 4MMZA 1VHQA 3BWYA 5LNK1 2V55B 1T3HA 3T1YB 5J1SB 1XQVA 2OFWA 4ZOLB 3TTVA 4NG5A 3G8YA 1EUCA 1NVKA 5H4GA 1QS0A 1ZS9A 2JAWA 2JFWA 5BOSB 4MI3A 3U2QA 3BSWA 3IPRA 4B4KA 4P3XA 5BQOA 3ZU2A 1CK4A 1RQ7A 5HIAA 4FFMA 2VK4A 1XEAA 2O6LA 2JFXA 4ADSG 1PSDA 1KY3A 4RK4A 4HDJA 4LE0A 4EHHA 3GLGE 2R86A 2H9PA 1WSBA 1Z06A 2AFIE 1JV2A 2WMDA 3QQPA 1ZJZA 4XJSA 4AYWA 4C01A 1U9IA 1NSFA 1MB4A 3JZNA 1IIRA 1U7PA 2CB0A 2W0MA 3PD0A 4LJAA 3WL4A 3E22A 4ALKA 2WJVA 1L8XA 3DAYA 5JSKA 4YJGA 1U80A 3LKZA 3PBKA 4MB2A 4Y8VA 4XQ0A 2VF4X 3CT4A 2PS9A 4KE8A 4DM7A 5A05A 2XYIA 3AI3A 3IJPA 3G85A 1GVHA 1J9GA 2ZE6A 2AMYA 4XGNA 3NTOA 4QC2A 5E6SA 1XI2A 2Z0MA 3GP5A 3CVVA 5IDXA 4M49A 1NOKA 5DTIA 4BKQA 2O1EA 4DZRA 3G7SA 3X2EA <