3MUNA

Appep_pepclose closed state
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
684
structure length
684
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFWWGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDQRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGYWWDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl endopeptidase
publication title Route of Substrate Entry in Prolyl Endopeptidase
rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
total genus 219
structure length 684
sequence length 684
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3munA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3munA01
1ZICA 3O9MA 2XMZA 4GBGA 4MJ3A 1QIGA 3I2FA 4X00A 2UZ0A 1OILA 3NWOA 2HIHA 1TKRA 1IVYA 3G8YA 1GPNA 1G4HA 2JGIA 4G1FA 1XZAA 2YASA 3LS2A 2HA5A 1E8DA 1ZIYA 2ZJFA 1GZ7A 1FFCA 3QM1A 2RONA 1XZMA 4WDQA 2ES4A 1BE0A 3D2CA 4UHDA 2PSFA 4GI1A 3UUFA 3RARA 4JYMA 5ALUA 5SYNA 1YCDA 7YASA 1EXWA 4WFJA 5I8PA 2AJCA 2AJDA 2VAVA 1CUBA 1Y37A 2GBFA 3HXKA 2DSNA 3JW8A 1XLVA 5AM4A 4UBOA 1H22A 4PQEA 4A16A 2WUEA 4LYEA 2ZJ6A 4OYYA 3RK4A 5JAPA 1XZBA 4IQ4A 1CIJA 2XLBA 1QIIA 5DNUA 4B83A 1E8NA 2R11A 1LZKA 4AZ0A 3SWWA 3EQ9A 4W63A 4C88A 3GBSA 4Q34A 2XUFA 2OQVA 1EINA 2XB6A 1H23A 1LPPA 4U2FA 3LLCA 2K2QB 4H7HA 2WIFA 1ZD4A 4FMPA 5HF5A 4UHCA 4CG2A 5FV4A 5EIHA 1CUGA 3F96A 2QZPA 3FLEA 5AKYA 1XQYA 4JUIA 3HLKA 4Y2YA 1NX9A 3ZLTA 2Z8XA 3H17A 4RPCA 4KACA 2WLSA 4XX1A 3C45A 3FBWA 4Y9SA 4UUQA 3WA7A 2XQFA 1ACLA 1ISPA 1SC9A 3BDIA 4AO8A 3FAKA 3H2GA 4X94A 1IZ8A 2WIDA 2XLCA 1A8SA 4L9AA 2CUTA 1S8OA 3VJMA 2VJBA 4F60A 3D0KA 1W4LA 2WFMA 5I9IA 4DM7A 4FNMA 1MJ5A 4MYDA 4WCVA 5AM5A 4N8DA 3FLBA 1BU8A 1F0NA 1MO2A 2OPHA 1QO7A 5LZ4A 4BE9A 4Y2UA 3ZLVA 3LIPA 3STXA 3C6BA 5AI9A 2YXPX 2CBGA 4EB0A 2VJCA 4FOLA 1C7IA 1A8QA 1KU0A 1E3QA 4GECA 1QGED 1NU8A 4HRXA 2P8SA 2WM2A 4ZWNA 3G9TA 1A7UA 3PF8A 5EFZA 4B82A 1LLFA 4UHFA 3ZWQA 4MYSA 2FUKA 4C89A 3QH4A 3IDAA 1SCQA 5IH7A 2QXTA 5JADA 3I28A 1XKTA 5FP0A 5C81A 1CUUA 2G4LA 2WQZA 2VEOA 5ALHA 1E89A 1MT3A 2PSDA 4B84A 5AKKA 3WK6A 4RGYA 5DNVA 2C4HA 1QIJA 4UHBA 2ZYIA 3ED1A 3PUHA 1CR6A 1CUYA 2DHCA 2V98A 1L7QA 4AB1A 5E2IA 4EZIA 1ZIXA 1DT3A 4G8CA 5AI0A 4H7KA 4J7AA 3WYDA 3NUZA 4BDSA 3VKFA 2BGRA 1IMJA 2OXEA 3TRDA 4DSZA 4CCYB 2XMQA 3PDCA 4W1RA 4BB0A 5DTJA 3B12A 5ALQA 4FLEA 5EI5A 1QOZA 2PUHA 3EQ7A 3C6YA 1UZAA 1K6EA 3HSSA 4MQMA 4W1SA 2OG1A 2Z3WA 1VA5A 4U2GA 3IBTA 4EY5A 2PKYX 1OXMA 5DYTA 2Y2UA 1UKBA 3OC0A 4ZV7A 3C43A 1FFDA 2WTMA 5JYCA 4BDTA 1ZD5A 3L1JA 3DL7A 5E4JA 5FOQA 4S0XA 4E46A 2XDWA 1YR2A 2CKMA 4QDUA 4O08A 3STYA 3KWJA 3SC2A 5AKGA 2I03A 5AJHA 1H2YA 3I6YA 4P08A 3Q8WA 4KE8A 2Y6VA 5FPPA 4KE9A 3WKBA 5JZBA 3D2AA 4EBBA 5J3JA 2EDAA 3EF3A 1YB7A 4C6HA 5ALZA 2XUJA 2H7CA 3F8SA 3B3QA 4I3FA 1XROA 5AKLA 4UBJA 3V1LA 3GUUA 2WG0A 3W9UA 3O95A 2OGZA 5AI5A 2FJPA 3AIMA 2G5TA 2JEYA 4FBLA 5ALSA 3H18A 3WWDA 5AM2A 5D7BA 3IULA 1ORVA 1R1DA 3QMMA 2ACEA 3A2NA 5HQ3A 3MUOA 1UOQA 3DLTA 4N5IX 2YYSA 1CQZA 3WK5A 4AZ3A 4AMYA 3CXUA 4UHHA 1R88A 5K3BA 4JH0A 1CPYA 2ECFA 1WB6A 5ALNA 2QMQA 3K6KA 3DS8A 4CI9A 5LZ7A 1UWCA 2DCMA 4A5SA 1A88A 2HA2A 4Q3KA 4Z49A 1BROA 3UUEA 3DQZA 1QIEA 2VT6A 3GELA 2ZSHA 1CUSA 2QRUA 2R8BA 3C5WP 4E15A 1IUOA 2I3DA 3U0VA 3HC7A 5ALTA 4B6GA 2BGNA 2XUKA 3V1KA 2X8BA 3PFBA 3ZLUA 1IUNA 4X7BA 3OURA 2XUDA 1YB6A 2HRRA 4J3JA 3DD5A 5ALXA 1XZGA 2FX5A 5AK4A 2WHPB 4P92A 1VZ2A 3DYIA 1DQYA 4IHAA 2OQIA 3FYTA 1QIMA 3I2HA 3IB3A 5JD6A 1GPLA 2WG1A 3BXPA 1EDEA 3DYVA 3BDVA 5JAHA 3A6ZA 3R3VA 3STTA 2DQYA 1F8UA 3H19A 2AJ8A 3PFCA 4M0MA 5A7GA 4B0PA 3WJ2A 1XZIA 1GQRA 4B7ZA 2D0DA 1CUCA 4EY4A 4RNCA 1VA4A 1QONA 4K6KA 1AX9A 4F21A 3IUNA 5EHQA 4YASA 2C0QA 3BF8A 4EY6A 4OD0A 5A6VA 4BC1A 3S8YA 3DJYA 4OCZA 1EDBA 1EHYA 1KEZA 2HM7A 2G5PA 1XZKA 4W1PA 4JEIA 2OAGA 1EK1A 1SFRA 3DDUA 1G66A 4ARBA 2WJ4A 4H18A 2BKLA 5ALIA 3STWA 5HF9A 2J4CA 4WFKA 1K8QA 2FJ0A 1QZ3A 4PV7A 2QVBA 1MAHA 5HKAA 1GT6A 5JIBA 4BE4A 3M83A 4KR0A 4UHEA 1MNQA 3E0XA 1W52X 3O0DA 1YAHA 1B6GA 2DHDA 5DYWA 4QWWA 3WWOA 1P0IA 4Y2QA 2XT0A 4BAGA 1HPLA 2HU8A 2BFNA 5CH5A 2VQ6A 3R3UA 6YASA 1XQWA 2PSEA 4G4JA 4GW3A 4M0EA 5CH8A 1DWPA 3ESCA 3DKRA 4YX9A 2H9YA 2XMBA 5FKJA 5JZ9A 4L3WA 2QJRA 1BCSA 2XI4A 3QPCA 1ORWA 4HTAA 3IUJA 4AO7A 4H0CA 3X3HA 3FSGA 3FWHA 3BJRA 5HF6A 3U1TA 1WHSA 5JATA 4KRYA 2OCGA 3DOIA 1TRHA 3H2HA 3MUNA 3LCRA 1CVLA 3HRHA 3G0CA 1DT5A 1C7JA 2XQKA 5BWCA 5EIEA 4DNPA 1M33A 1VOTA 4X6XA 4W1QA 3AIKA 1CEXA 3K9BA 5LZ9A 1GPKA 4DMCA 2B4KA 2PSJA 4V2IA 4WDRA 1UKCA 3AIOA 1LPAB 1CUZA 2ZYRA 1H2WA 3I2KA 2HL6A 3DEAA 1MX5A 1Q84A 1AGYA 1CUVA 2QM0A 4OB7A 2GZRA 5D3ZA 3QITA 1VJ5A 4IH9A 4X3CA 3DL4A 1GXSA 1OCEA 1GQSA 1N1MA 4EY8A 3GROA 1SCIA 4BP8A 3Q0TA 2WJ6A 3FYUB 3QPDA 1X2EA 2CEKA 5EIAA 4YPVA 4QA9A 4UFPA 3WL7A 3IURA 3PE6A 1F0PA 3M3DA 3VJLA 4HVTA 1QO9A 4HRYA 4DNQA 5KREA 2JGEA 4NVRA 2OCKA 1U8EA 4DLNA 2VSQA 1DX6A 2RAUA 4EUSA 3E3AA 1C4XA 2WIKA 3WI7A 1XLUA 5AKXA 3W9BA 5FXMA 4E14A 3ZV7A 1R3DA 5C8XA 2WJ3A 3VVMA 3FCYA 5C8VA 3OPMA 5ALGA 2Z8ZA 2WFLB 4B9EA 1DX4A 2V9ZA 5FUMA 4RE6A 3R3YA 3WMRA 1CUHA 3W05A 3AJAA 4KEAA 1Q0ZA 4LKOA 2RGUA 4BAUA 3O4HA 3F67A 2OLEA 1SCKA 2XUOA 4OYLA 3A2LA 3VXKA 4XWGA 5CBKA 4Y2XA 3GFFA 3A2MA 1YS2X 5JASA 3I1IA 4KAFA 2WU4A 4FLMA 5A7FA 4KE7A 4QDOA 4PF1A 1XQVA 4DMHA 5AH0A 2PSHA 4NS4A 4Y2TA 3S2ZA 1XZCA 4KYVA 5AKEA 2C0PA 4H7EA 5FLKA 1Y7IA 4FFVA 1LNSA 4XVCA 1QIKA 3R40A 5K3FA 4U2BA 1QFMA 1T4MA 1MN6A 4J0JA 3STVA 1WOMA 1P0QA 4I19A 2XQIA 1UK7A 3T52A 1GKLA 1EA5A 1K5PA 4N8EA 1UT6A 2JEZA 4C4XA 3SX4A 4X90A 4J0HA 4HAIA 4LXHA 5ALPA 4J0IA 4AO6A 5BV7A 4KRXA 2IITA 4H7DA 2RIPA 1BEZA 1K4YA 4FBMA 3VISA 1ZJ4A 4QDTA 4RE5A 5LKRA 4LYDA 5AK5A 3WWCA 5EGNA 4ITVA 1MTZA 4FTWA 1U4NA 2XQJA 4C4YA 3QYJA 5JAOA 1QTIA 3D5EA 3TGLA 3EBLA 3EIOA 1UK8A 1JJBA 3T4UA 3HACA 4ZV9A 1RWQA 1AC5A 2C58A 3W04A 3WLAA 4FKBA 2VTVA 2HA6A 1IUPA 4ARAA 4UBIA 1MX9A 1CUEA 4J0DA 5E4TA 3VDXA 2WG2A 5K3EA 3FVRA 2WU3A 4UBMA 1ETHA 2OGTA 2JGFA 3BF7A 5KBYA 1XRRA 4Q3LA 5AICA 4PSCA 5FPQA 4B80A 1WM1A 3EQ8A 4ZRDA 1ZOIA 2C5FA 1ACJA 5ALRA 3WWEA 4G5XA 5IKXA 1TCAA 5CMLA 3BE8A 5FRDA 2ONCA 1UK6A 1QFSA 1CQWA 2VA9A 2ZJ7A 3G9XA 4G8DA 3VJKA 2DHEA 3ANSA 1EX9A 5LZ5A 4L0CA 5H3HA 2PU7A 2JGMA 4ZGBA 3ANTA 4FWBA 1GGVA 1PJAA 1VKHA 3AZQA 3IUMA 3DOHA 1W75A 1JT2A 1WB5A 3O4GA 4FLFA 3BIWA 4P93A 3WKCA 4G8BA 4CCWA 1DINA 2XMCA 5AK6A 3R3XA 1WHTA 1HQDA 3FYUC 5ALVA 2O7VA 5ALYA 4BBZA 1EK2A 4TGLA 3QBJA 2Y2VA 5AM0A 1JKMA 4QDZA 4A23A 1VE7A 4UPDA 1N5MA 1QJ4A 1DTEA 1XZJA 4Q82A 4J0KA 3HJUA 5HCUA 3FCXA 1CV2A 3FSGD 4IH4A 3PUIA 5HFNA 2XQGA 1J1IA 3KWFA 4BP9A 4PO3X 1E5TA 3WK4A 5AKZA 3TJMA 4AX4A 5HK8A 5HF8A 3W2TA 3C6ZA 1P0MA 1WPRA 4BTVA 5ESRA 2WHRA 4X92A 4JYPA 1Q0RA 3R3ZA 1BCRA 3R41A 3TEJA 4P9NA 2HADA 4X6UA 2GBIA 3AFIA 3OM8A 5T4HA 3H0CA 3KOOA 4UBLA 1XLWA 1IZ7A 4GLBA 2HA0A 5CXUA 1R50A 3STUA 3R0VA 4OU5A 5BOVA 3M81A 5JANA 1HDEA 1XFDA 1LPMA 3WIOA 3G9ZA 4OPMA 2PBLA 1BEEA 1THTA 1UFOA 5DLPA 1HBJA 3HEAA 3C87A 3R3WA 1XRPA 1EVEA 1W6RA 5AM1A 3O4JA 3WZLA 1FFBA 5HZGA 2PM8A 4CCYA 5DJ5A 4BZZA 4Q1VA 4L72A 3ESBA 3E1GA 4PSDA 2OCLA 3WKAA 3IIIA 4X71A 2XUIA 2WUFA 1MX1A 2EDCA 2LIPA 1JFRA 3WL6A 1UXOA 2GBCA 4E11A 4DTCA 1J2EA 3AINA 3IUQA 3MVEA 4BVJA 3HI4A 5ALJA 1SOMA 1AZWA 1CUJA 3OG9A 4OB8A 4CG3A 5IVDA 5ALDA 3PICA 2X5XA 4CIBA 4CIAA 2PVSA 3I2JA 1DWQA 2OGSA 2JGJA 4M0FA 3RLIA 2VJAA 2B61A 3OTQA 4BRSA 1TQHA 1FFEA 2O2IA 1LPOA 4INZA 3HABA 3BL8A 4KE6A 4TPKA 5AKHA 4K5QA 5F4ZA 2XMSA 2IX9A 5A7HA 2QUAA 4B81A 5AIAA 5K3AA 5AM3A 5ISMA 2O7RA 4OUKX 4BVLA 4U2EA 2QOEA 3G0DA 4C01A 5AIBA 1JMYA 2I3ZA 5E4YA 5YASA 4LXIA 1W1IA 1A8UA 4OB6A 2HA7A 3G9UA 2CZQA 5ALOA 5ALEA 4F0JA 2J3DA 5K5EA 2Y1KA 3D2BA 4G4IA 1XQXA 1D07A 4WJLA 5CW2A 1R4ZA 5AHXA 1BN6A 5LP1A 1VE6A 1TAHA 5LZ8A 3G0BA 4BATA 4BCCA 1KU6A 3RM3A 2VF2A 3W06A 4BRZA 5SYMA 4CG1A 1AQLA 4U2DA 3WWPA 4KJXA 3FOBA 1QIFA 3F97A 5HKBA 1X70A 2WUDA 2OAEA 3CCBA 3WZMA 1K63A 2WHQA 4ETWA 3I2GA 4EHBA 2G63A 4HZGA 2HHAA 1R9NA 1H2XA 4U2CA 4HXFB 1AMNA 1FFAA 2QJWA 4Q05A 5JD4A 1YS1X 1JJFA 1DU4A 3P2MA 3AILA 3V48A 2E3JA 4LXGA 3QVMA 1TIBA 1QIHA 1EB9A 1X2BA 1RP1A 1ZD2P 4FFWA 5AO9A 2ACKA 5CT5A 3QPAA 3WJ1A 2WHPA 4BVKA 2QS9A 3WK7A 4X93A 1QE3A 5AK3A 2PX6A 3WA6A 3DKKA 3JWEA 5CT4A 2D5LA 2VJDA 3HZOA 1JU4A 3H2JA 1LPSA 1XKLA 2PL5A 1ZJ5A 2XMDA 2XUHA 5LYYA 1QLWA 4GDMA 4QEKA 5T4BA 2NW6A 1LPBB 1VLQA 3G0IA 1ZGBA 1P0PA 1CLEA 1ODSA 2W22A 4X97A 3ZI7A 3CCCA 1UKAA 5HFAA 3K2IA 1WCYA 4AQDA 4ZXFA 4BZWA 5AOAA 5A71A 3WK8A 1ZGCA 5DWDA 1J06A 3BIXA 1W76A 5LIPA 4K2AA 4QWMA 3F9CA 5JARA 1MU0A 1CUIA 1ODTC 5LLSA 2DFPA 3LP5A 1FJ2A 1LBSA 3IA2A 4HXEB 2Z3ZA 1EB8A 4MQLA 3MGAA 4QLOA 4XIIA 3C70A 3D3NA 4UFNA 5AKJA 5BWBA 3ILSA 4B85A 5HQ3B 4GXNA 2QTBA 4Y7DA 5DYYA 4QE3A 3AZPA 4DYHA 3G7NA 4X6YA 2HA4A 4KAJA 4G9GA 1NU6A 2BCEA 3D7RA 2JGLA 1RYYA 2GBGA 4K6HA 1CUFA 3N0TA 3OOSA 1G5FA 3WKEA 5A2GA 3I2IA 3L1IA 2WSLA 1YASA 3JYHA 2XUGA 4GWLA 4DMFA 1JI3A 3QZUA 1E66A 4FDMA 3WIBA 2WIJA 1G42A 4BTLA 2WKWA 3ESDA 2BJHA 3DCNA 1ZI8A 1PV1A 2WIGA 4DSAA 1XRMA 1EI9A 4NMWA 5AI6A 1PFQA 2EEPA 5ALFA 1R9MA 1XRLA 3WKDA 5JALA 2PU5A 2IIVA 1L7RA 2H7XA 1UOOA 4J0GA 3QMVA 2XUQA 2WUGA 1MNAA 2ORYA 1I6WA 2HU7A 4BC0A 4EY7A 4D9JA 4JNCA 4CFSA 5D6OA 4H7JA 5ALKA 2VAXA 4DIUA 5IVHA 3NGMA 1XRQA 5AI4A 1TCBA 2HDWA 2JGKA 4WFIA 1Y7HA 2ROQA 1XRNA 3G02A 2BAGA 4OSEA 3I6ZA 5IVIA 5AP9A 5CXXA 5EHXA 4IH1A 2QXUA 4AMZA 1LZLA 4G4GA 3SK0A 2WFZA 5AOBA 3ICWA 3VVLA 4AN0A 2QUBA 1U2EA 1J07A 3YASA 3RKSA 3FYUA 4TVKA 2AJBA 1JJIA 5K3DA 1QIDA 2HFKA 1N5RA 4H7FA 3KDAA 1Z68A 4X91A 5A62A 2H7YA 2Y6UA 2Q0XA 1EVQA 4W9RA 1HKHA 2XMRA 2B9VA 1TK3A 2B20A 3B5EA 3I6MA 3GZJA 1BRTA 4GEGA 1EH5A 1ZI9A 1JU3A 1YSCA 5KWIA 4MWSA 3GA7A 5LKAA 3C5VA 3H1AA 3H2KA 4XJVA 5AI8A 2WFLA 1EDDA 3C6XA 2OCIA 4KAAA 1UK9A 5CURA 1AURA 4MEAA 1ZI6A 5ALWA 2BUCA 4OU4A 2XMGA 4DGQA 3BWXA 3AUKA 1JMKC 4H77A 4Y2SA 3V9AA 5CRIA 3WQHA 4WY5A 3V1MA 5CT6A 1VZ3A 2PPLA 2PUJA 5JAUA 2C5GA 3F98A 4K6GA 1CUAA 1XZHA 1XZFA 5JD5A 3KXPA 1CUDA 5JZSA 5EHZA 3AZOA 3C8HA 4FHZA 5AOCA 1F6WA 4N8SA 5LZ2A 4B9AA 1YAJA 1THGA 5CT8A 1U65A 3N2ZB 3BJMA 4F5ZA 1WB4A 4MEBA 5ALLA 3CN7A 1O6FA 2WTNA 2YH2A 5DNWA 4Y2JA 3IVMA 1HL7A 4LIPD 2XE4A 4GHWA 1MPXA 4H35A 4MXDA 2W6CX 3PF9A 1HLGA 2ZYSA 1L7AA 4B0OA 2JBWA 3PI6A 3FNBA 4WY8A 1UOPA 1YA8A 3WYNA 3QMWA 1T2NA 2O2HA 4Y2RA 3V1NA 4DNOA 4AN1A 2QR5A 1N8SA 4ZREA 3O4IA 2CJPA 4IO0A 3CN9A 4HXGA 2DQZA 1E8MA 2XUAA 1WPXA 1YA4A 2CMFA 1LGYA 2ZYHA 3C8DA 1LBTA 2V96A 3A70A 5KWJA 3D59A 2RI6A 2CB9A 4EA6A 4DMKA 3H2IA 2AXEA 4YK7A 4Q3OA 3E4DA 2ZSIA 3L1HA 4G9EA 5K3CA 1O6GA 1MAAA 4LHEA 5I7UA 4NZZA 3FLAA 1B41A 1H2ZA 4HS9A 4BAZA 1VXRA 2WILA 1Q83A 5IVKA 5FDFA 4AXBA 4QDXA 4N5HX 4MWTA 4ROTA 3G0GA 4J0CA 2BUBA 1LPNA 4QZVA 2HRQA 3WL5A 2H1IA 3NOXA 2J3QA 3KD2A 1CFJA 1TCCA 1CRLA 2BUAA 4FNGA 3ESAA 1BN7A 1XZLA 2VATA 2RHTA 3ZPXA 3H1BA 2X76A 1AKNA 3M82A 2GYVA 4QLAA 2GYUA 4UFOA 1ZD3A 2QT9A 5EHNA 5T4FA 1QTRA 5HK9A 4I4CA 1DWOA 3HYSA 5CTAA 2HFJA 4C87A 2V97A 1FSSA 4H7IA 3LIIA 3H04A 5CH3A 2RHWA 4PSUA 2C7BA 1USWA 1VXOA 4Y2VA 3FVTA 3KSRA 5AKIA 4BCBA 4BYMA 3O9VA 4X95A 3ICVA 4PNZA 1BS9A 2JF0A 4Y2PA 1ODCA 4X85A 3WL8A 4BCDA 4UBNA 4C4ZA 2HU5A 2Z5GA 5K3FB 1DQZA 1XZEA 2GZSA 2O2GA 5C7YA 3D4LA 3WK9A 2AJLI 2GYWA 3I1YA 1XZDA 4UBKA 5C8ZA 4J03A 2JIDA 2ZVDA 3UMJA 2XUPA 1CUXA 4QNNA 2DR0A 2HA3A 4DNFA 5DTIA 5ALMA 2J4FA 5D3KA 2VT7A 2QKYA 4ZI5A 1CUWA 5CT9A 1GKKA 2I78A 1AUOA 3DNMA 5T4EA 4PW0A
chains in the Genus database with same CATH superfamily
1HE3A 4IG4A 4X63B 3ADCA 4X00A 1SKUA 1TKRA 1SO8A 4G4SP 2GAFA 1G4HA 4G1FA 3EF0A 3UWSA 3VHLB 4DLAA 5E0KB 5EZ5A 4G55A 4DLUA 3EEFA 2VP2A 5HJ2A 1UZLA 1K6XA 2EOAA 3JWHA 1ZIPA 3CRW1 1XYVA 2IU3A 4NCIA 2YY7A 4F8YA 3SXJA 1JLMA 5BMVF 3JVEA 3O8LA 1H22A 2ZSDA 4A16A 3OJFA 4HB3A 3COVA 4L4UA 3BD7A 3LPAA 5JAPA 3O1IC 2OESA 4PZZA 1KZHA 2HYIC 5ENZA 2UYGA 5IRCD 4RY0A 2H2GA 1KYZA 4YALA 1KP9A 4XLLA 3U19A 3VNQA 3LLCA 4IP0A 2A5GA 4XW2A 1E2QA 1U90A 2Q6TA 1MRNA 1AOXA 5LP6F 4EGCB 1G8FA 1PFUA 3DMTA 2DFVA 4P86A 1XJCA 4NC9A 4Y2YA 2LKCA 4GM4A 3TSAA 1GTVA 3C45A 2RSLA 4M1TA 4JSNC 5IWAB 1NJ5A 1VLJA 2IEBA 3JQBA 3MAAC 3T1OA 4KWCA 2QX9A 2GK3A 5C37A 4TKUA 2SKEA 4XEHA 2IYSA 2YUIA 4TTJA 1FYEA 5IWCA 9LDBA 1F0NA 1YS4A 4WOKA 3PPYA 3CEPB 2FCAA 4Y2UA 4KIWA 3E22A 2P75A 1NDHA 2EBFX 3KOMA 1KU0A 3RUPA 4ERZA 1CP2A 3JQ8A 3BC1A 1QYWA 5K1ZA 2NU9B 5EZ6B 1Z18A 4UHFA 4WXEA 1IEQA 1O5IA 4O4LF 1XKTA 4BJ1A 5I48A 1RHJA 5TT0A 4UMEA 2C99A 2XCTB 2VEOA 3JQAD 4HWRA 5D87A 3HMQA 3FYCA 3LQYA 4XD2A 3ED1A 1G6KA 4JU9A 4G01B 4Q3EA 4MI1A 4TWBA 2C3OA 3G82C 2GSWA 3RUIA 5IN4A 2QTAA 2RHDA 3NYIA 5ITZA 3IIJA 3ND5A 3RYFA 4ZTZB 1R4NB 4UTVA 1IMJA 2HEIA 4RACA 2FPPB 1NG9A 2EIDA 5EALA 4QGAA 2HHHB 3OPYB 4B34A 4ZZ3A 1V2HE 5IS2A 4Y6OA 1IM2A 1OI7A 1PVVA 3DG9A 2D5AA 2FHPA 4BDTA 1IH8A 1IB0A 3CF6R 4O1QD 4IRZA 1GPUA 1H2HA 2Y27A 3UJ6A 1NMSA 1T4GA 4KQWA 5HIAA 1B9XA 2HCBA 4NYMQ 1H2AS 1BXRB 2LWIA 2WG0A 2ZRNA 1BOFA 1M6VA 1OPXA 4DLBA 1SG9A 3L4SO 4NULA 2MYTA 1FUKA 3B13B 2Q5CA 4R0NA 4IJUA 4JH0A 5LWQA 3F3SA 3ZGXA 2JFWA 1CQIB 3HY4A 4FFRA 1KJWA 1V1RA 3PHIA 1M2OA 3L8HA 2XWQA 1UWCA 3GY0A 3OIUA 4DLPA 3L7YA 1KMHB 3RCBA 1BTOA 3AL8A 2PZJA 4HT3B 4KCGA 1DC5A 1WU8A 5LXTB 1VBKA 3EMHA 3HL4A 4KNVA 4YV0A 2Q2WA 4D9NA 4TS3A 4B6GA 1ISHA 3H1EA 5KQLA 4Q9LA 4C7VA 3JR3A 3D1VA 4O3MA 2GJKA 5A4FS 3HCEA 3ZHTA 1IBRA 3HSYA 3MTJA 1EVKA 2WYHA 2R6ZA 4LNAA 4ER3A 3HYCA 2GERA 5EESA 1U0RA 1XUOA 5EZYB 3GFRA 3ZQUA 2YYYA 4NEHB 1G4AE 4FOOA 1C8KA 2SHKA 1R9GA 1CX9B 1G55A 2AJ8A 5U1PA 1MH1A 2CSXA 1W5TA 5C8YA 1D2NA 3K9LA 5A7GA 3S0JA 3OT1B 4JSVC 4XA8A 5K0FA 5FUBA 2G25A 4MVYA 5G0SA 3ZE6A 4IKOA 3NZEA 3O7WA 1EHYA 3R1IA 1W36D 4OKIA 1MMFB 4P80A 4C3OB 1JJVA 1NN3A 4TWRA 4WFKA 3NAGA 1DUVG 1MAHA 3G1UA 1BOOA 4UHEA 3E0XA 5FFFA 3CJTA 1TU0A 4B6QA 5IUJC 4ZKDA 3L7LA 2ISQA 5DYWA 3FWYA 1QANA 1ETUA 1F5SA 1LD3A 3CZRA 3BCUA 3N6RA 1QP8A 3IPYA 4X20A 2RMKA 1UJNA 6YASA 2Q3FA 3KL2A 3F5SA 3KR9A 1L7EA 2GKOA 3H1GA 1WW3A 3WY9A 4UVGA 4DWWA 4MV8A 3SI7A 4P82A 3IJ0A 5E1DA 4UI9R 2JIQA 3IQEA 1IJEA 2Y71A 3LCRA 3ZJ5A 3CEMA 1BA3A 1WQ3A 4HN4B 3TQFA 2C59A 2OYCA 3PXDA 5KVCA 4I55F 2IE8A 4MUNA 4X1KA 2BCJQ 4XIFA 1HE5A 3F6PA 4C4AA 2WWXA 2WABA 2OD9A 2VTEA 1OMOA 3DOOA 4EENA 2ZVQX 4JLMA 3TLKA 5LPNA 3CFVA 4WOJA 2R4TA 4JC5A 3M6VA 4X3CA 1HRKA 3C75H 4KZKA 1KFEB 2RAFA 4GF5A 3V8PA 2HLDD 5ADWA 3BIFA 1P4GA 4BQNA 2BPOA 1YVUA 3ZIAA 3SYTA 3OTTA 2OCDA 2BDTA 2UZAA 1U80A 1QPGA 1CJVC 2KBEA 4BB6A 3NV7A 2IKSA 2UZ1A 4TV8A 1NVMB 1P5FA 3BHIA 2EV9A 4PM4A 5EEHA 3HJTA 2FN4A 1B8PA 1V3QE 4NYJR 3JZDA 4GRAA 1NPDA 3T7KA 2V9ZA 5TGTA 1LRJA 2W90A 1KOJA 1O77A 4KEAA 3PJEA 5TF2A 2ZB4A 1QUFA 1DIAA 2V7TA 3G5TA 3WQSB 3CLSD 5CBKA 3EOBI 2PRYA 2FMFA 5JSZB 3G49A 4FS3A 1SHLA 5JASA 3RAGA 4LJ9A 3DKVA 5GJVC 3E9DA 3R76A 3OP4A 1WR8A 2EC5A 4BNXA 5K19A 1VLMA 1T0PA 1PT8A 4RGVA 4MR8B 2YKGA 4FAND 4U8GA 2NZ8A 3MMPA 5FBVB 2XF2A 4PQGA 3EU7A 3INGA 3T52A 3AUJB 1PYDA 1OOEA 5L4LA 1ORDA 3LUCA 4NMMA 4PGMA 3OCXA 3CQ9A 1YJ8A 2GVZC 4PLGA 2CKDA 5C18A 1J9EA 4HF7A 1P0FA 2BHLA 5F98A 1X7WA 4RVUA 5FFNA 5BV7A 1T9HA 2CN3A 3DMPA 1V5FA 3PNMA 3R7WB 1U7HA 3MWKA 3M8KA 4M3NA 3RWMB 4XCXA 1CY8A 4OP1A 5EGNA 4LY6A 4FT2A 5JEDA 2V1XA 4KMRA 5ES3A 5JAOA 5JROA 4YECA 3RKUA 5JXGA 1OLXA 5L4SA 2MIIA 1RWQA 4AUKA 3IDOA 4NV0A 3LOPA 1ELOA 3JRNA 4ARAA 4R0VA 5JFGA 3HUTA 4CFZA 2JJ2D 4BO0A 3IP7A 3FVRA 3PR2B 7ABPA 3EFBA 1SVLA 1IRXA 4LF7B 4QLBA 3CG4A 2BCGY 5AICA 1OX5A 4B31A 2Q6OA 4ZJZA 4ZRDA 3F4BA 3MJDA 3GIWA 5IKXA 3BE8A 3VOBA 5FYQA 2R6HA 2BTQA 1NRXA 4N01A 1SAYA 1QE0A 4UPEA 1DKNA 4B74A 5LQUA 1RWNA 2F1KA 1GGVA 4FWBA 4DDTA 1NBMA 3HJHA 1TAGA 3QHQA 5HJ5A 1W9HA 1DEXA 2P7IA 5IAAA 4Q3AA 2C2HA 3TKLA 3LL4A 3AF5A 3OKWA 1ZS9A 2IYZA 2IEAA 4CEHB 1KAHA 2FFJA 3P9NA 2AR9A 1Q3HA 3VU8A 1N2JA 3ANYB 2VWQA 4QVKA 3NVMB 3K94A 4NCJA 1CDZA 2Q4OA 1MABA 2QC5A 2D2IA 4U7HA 4TGLA 2Y2VA 5FORA 3PQEA 4IILA 5AM0A 4DC9A 3KYDA 5CIQA 2VK2A 5B7NA 2Y1GA 4Z3DA 1IM8A 3W9YA 3GJSA 1TUBB 3FSGD 1A9YA 4BNZA 2AI2A 3FPFA 5SZIA 2CK3A 3MCVA 4CRWB 1UT8A 4KIJA 3RYIB 1GAWA 5K45A 221PA 2OAP1 5JPIA 3FZGA 1OD6A 3I01A 3KJFA 2REBA 3HDYA 3KQPA 2XZDA 1B3RA 3B85A 3GBPA 4R3NA 2QLBA 2IELA 2J4DA 3H0CA 3GEPA 1L8XA 1Y7LA 4F86A 4OU5A 2O8CB 5JANA 4RANA 4F4CA 1LPMA 3TOZA 4RD2A 5AVSA 5HM6A 4LRXA 3FOFC 2W2KA 5JZVA 5K0ZA 1UMBA 1HBJA 1N2EA 4MQFB 1V47A 4A7JA 4X1OA 3C7TA 3LX5A 5JSHA 3O4JA 5GADl 2DT5A 2BFDB 1RRMA 2OFPA 5HZGA 3CVXA 2FHSA 3A9WA 3UW1A 4L72A 1WV1A 4HI0E 4REMA 4WOBA 3S44A 4BUCA 4ID9A 3S28A 1XE3A 2QT1A 2CE8A 2X13A 3NU1A 3D0RA 2JPDA 1A2QA 4OB8A 1PGUA 4J9UE 3CONA 5IVDA 3VAYA 4MKRA 2G82A 1QRTA 1LS6A 1M1NA 4OI4A 1TYQC 2QTCA 4Y8VA 2PZEA 1ANKA 3OTQA 1TQHA 1FFEA 4QXMA 4TPKA 3QF4A 3JARA 4JQZA 5FLYA 3L7NA 4E1VA 1PAUA 3NALA 5JH7B 3BMOB 3ZH9B 2CZQA 4M7RA 3VOAA 3IPCA 4Y9DA 1RBZA 2ZUBA 5TARA 1RLOA 4YHHB 5FBKA 4M21A 1E1RA 4FJ0A 4LJRA 3BSSA 3T6KA 5AVTA 1DIOB 2WMYA 5F7ZA 2ZQZA 1KU6A 2WYVA 4LZLA 3W06A 5U4XA 1AQLA 4RXTA 4PGAA 5EMJA 4JYAB 3MERA 1K63A 4ETWA 3C8ZA 4EHBA 2HHAA 2ZJ5A 3P96A 4IR7A 1G7CA 3PTZA 5L6MB 1K8XB 3IVAA 4R5MA 4CLEA 1DU4A 1NUHA 4G0YA 2XIQA 3FM0A 4ZQEA 2Z04A 1JFTA 1GO2A 2BY4A 2V4MA 1K32A 1AK9A 2G1JA 1W1WA 4OM8A 1D3AA 2AHRA 3I09A 5GTDA 1QB7A 1COWA 1NYQA 3DCYA 5FTLA 3U4DA 3KHTA 1UQTA 1L8QA 1YQTA 4DSTA 2M9MA 3EDQA 4A1OA 1TMOA 3CPSA 2QW1A 1O97C 3CT6A 2DETA 3SN6A 1L4NA 1X8XA 3OQNA 4IJQA 5JXIA 1ZUHA 1S2LA 4YJKA 3RHFA 2G1UA 2AWNA 3OCJA 4LBVA 2Z5FA 3NVDA 4KREA 2SBTA 3RUCA 3L4EA 3CH5A 2J9GA 2R7LA 3KTFA 1DADA 1N6RA 4MGHA 3TSCA 3GA5A 3H5VA 4N4AA 4QE3A 4G36A 3MSCA 5GMOA 5KMGA 4C07A 1NUSA 1O94C 2P67A 3TG2A 4HH4A 2IIQA 4JI0B 2GBGA 3QVSA 5FWXB 3BK7A 2VTKA 1XSEA 4GWLA 2F90A 1A5BB 1URPA 3ZKAA 1WEKA 3ZDXA 1HYHA 3VTAA 1C4KA 2CVPA 3B1WA 1DV2A 3DCNA 1PV1A 2WIGA 1V5GA 2DJ5A 4BS9A 4TYPA 3D0OA 3FPLA 4HBGA 5AI6A 3RLFA 4RTQA 5LA6A 4BP3A 3WKDA 1QBKC 3H11B 4QTXA 4QPPA 5GGXA 4OSPA 3FTFA 4Y30A 1ADBA 5L3SA 1W4RA 4CL3A 3FGNA 1ZEJA 2HR1A 1REQA 5DGHA 1GHTA 5IVHA 2R6FA 3DB1A 1TCBA 2RK3A 1YVEI 3PNOA 5BUSA 4TQ9A 1M8JA 4ND1A 2HTFA 1P5HA 1Z0SA 4MWBA 3HO8A 4IGIA 4TWZA 2GO7A 3ICWA 1VBNA 4GX5A 4PG6A 3KZNA 2HJVA 2K6GA 2CL5A 4UJ3A 2MINB 5DYNA 4X91A 4ZC8A 1TK3A 1TA4A 1IY8A 4OI0A 1OI2A 3FX2A 4LV5B 2BGLA 1T5SA 3WNDA 1NXPA 1BHSA 5KYXA 1GG2A 821PA 3KEGA 3TAXA 1EFAA 2H13A 2WJWA 4DCCA 3KALA 4MEAA 1GKIA 3BTUA 4XUCA 2BIFA 1FLNA 2Z2KA 4DGQA 3TI9A 1FRNA 5CRIA 5E95A 4WY5A 4DUYB 5BO5A 1VZ3A 3Q41A 4RNDB 1GZ4A 4HWSA 2ZE5A 4MPDA 3OJEA 4GPAA 3I5AA 4NU6A 2WYWA 5BR1A 4ZOYA 1J1ZA 3AF2A 4AEZA 2IKQA 5IBPA 4ZEWA 4NBWA 2ASEA 4UNNA 3B3JA 1C3XA 3AHJA 5FHQA 1E6WA 2QN3A 4Y0VA 5HZMA 4HAUA 1W94A 3DMNA 1H69A 3KJEA 4CMEA 1E2FA 1HL7A 4KOAA 3BDAA 3UV3A 5DRYA 3M1AA 2JBWA 1OA1A 2CZGA 3TPFA 4QGFA 4WPGA 4DQKA 3DWLC 2VH1A 4YRGA 1OIXA 2CF6A 1C4WA 3WIVA 3LDUA 1SZPA 4XVHA 3PSCB 2ZXFA 2O2HA 2RGYA 4UUNA 1G20B 2NADA 3F46A 1N8SA 4B6RA 4HLDA 4RKRA 2QTWB 4DWVA 4JL5A 3W3ZB 1QF9A 3IHKA 4B4WA 5KC8A 4DY4A 2BEJA 5C0OE 2UYYA 1DFIA 3SDBA 2OCAA 1D6SA 6Q21A 4MV9A 2MSEB 5KU1A 2H17A 4ZIRB 3ZWAA 3VR4H 4FA4D 2A2ZA 4Z2YA 2HRQA 5BQOA 2HNBA 3MIZA 1FS6A 2NVUA 1T13A 1T2EA 3I6QA 3IUBA 4HDSA 3O9ZA 1BN7A 4U7AA 2VATA 4WV3A 4KR6A 4KFUA 4TVOA 1ENPA 1TAQA 2JFQA 2WVHA 1HT2E 3QY0A 2P9KC 1DWOA 4C87A 4G2NA 3C3CA 3S8EA 4OXNA 3TR0A 3UWKA 2RHWA 2Q62A 3KSRA 3C6KA 4L5JA 5AKIA 3ZK9A 4JBXA 2DHRA 3ICVA 4CLXA 2WW8A 1N6PA 1ZRSA 2HU5A 2FW0A 3ESYA 4CTOA 3SNHA 3ZE1B 1I3LA 5C7YA 3VSBA 1JDZA 4MW5A 4KO1S 1C1DB 4Y9UA 2AJLI 2NMVA 1PJRA 2GYWA 5CVEA 5K1CC 2XNCA 3TUZC 3AJ8A 5ALMA 2VT7A 2Y1CA 2PRIA 3ZQ6A 4MHSA 1Z7EA 3O75A 2HIHA 2RHCA 1N3BA 5EMKB 4Z4QA 1VC2A 1QHHA 4FOPA 1ZL0A 3QM1A 1G8GA 2D7JA 3DFMA 4RYDA 3DDWA 3KCIA 1I7LA 1YK1A 4DMGA 3UUFA 3F7OA 3RK1A 3BD6A 1THZA 5SYNA 3ZHZA 4GVXA 1MO5A 3IKJA 4D0GA 4MVJF 4OQNA 4LA4A 1WUYA 3CO5A 5JQGF 2R25B 4LZJA 4B3SB 4D3YA 1VL6A 4RYLA 4IIUA 4RCVA 4LOAA 2XLBA 3UICA 4KVFA 2P41A 2W4QA 3SIPA 4KGZA 3O8DA 5DV9A 3U09A 2R11A 4AZ0A 1VIMA 2Q5HA 4OAOA 1KJNA 3U3OA 2O7NA 4AYWA 3V8BA 4MV7A 1LPPA 3SFVA 3OETA 1VI6A 5ILOA 4F4FA 2B1GA 2FR0A 1RBMA 4UEQA 3GJTA 5KJFA 5E6SB 1WHTB 5IJ9B 4XH9B 1GKYA 2Z8XA 5CA0A 2YCLA 1J5EB 5IC6A 1X39A 2VDKA 3CUVA 2W2OA 2R8PA 1HXHA 3T54A 3IIWA 1AB6A 3E35A 1M2FA 2PEZA 5AJUA 3KL4A 1XALA 1Y8ZA 5H3LA 4JUDX 4F60A 2P1ZA 1W4LA 1B74A 2V6FA 2P6RA 2IWHA 3UKDA 1NF2A 1WSWA 1YDGA 3ICCA 4K9NA 5EIBC 3UGKA 2CMDA 1A8QA 2W2TA 3MILA 1GA4A 4HRXA 4DM4A 5E7JA 3TSOA 2Q6VA 4KIGA 3FPKA 4PFJA 2OXIA 4ZVSA 5CXCB 4MPRA 4QBKA 1M7BA 4BMPB 3UMBA 1CUUA 1XNQB 1M54A 4UTOA 4G67A 5K8LA 4JVOA 5BSRA 4C2TA 3RREA 3EHEA 2C8KA 1DKMA 1XTIA 1Y9ZA 2CUZA 3AT1A 3KR2A 5E2IA 3BAZA 3DMDA 5A06A 2B4QA 1S3GA 1GQFA 1JHYA 2OXEA 5JWOA 4L1MA 3T5PA 1W88A 2ZWVA 3U5TA 2B7BA 1OUMA 3EH1A 3I73A 3IBTA 4AJHA 2O8EB 3U5ZB 4TLBA 1UKBA 1SD1A 4IDDA 4D4JA 2QQEA 2HF9A 3DL7A 4YCCA 1II8A 2X14A 1EX6A 3GJ6A 4RMGA 4QPDA 2Q1XA 4QEZA 2R6DA 1LFDB 1R4AA 3ZOKA 2J55H 1XTKA 4Q03A 4UTZA 4ERXA 3F8WA 1A5ZA 4AZWA 3D7NA 1R0SA 2P9ZA 4JC4A 4RTNA 2QQFA 2V4UA 1R3UA 4UMFA 1UJ6A 1UFRA 2O3UA 1ML3A 3CE9A 5JMWA 4M53A 2XUZA 1H4TA 1EUCA 1NAIA 4UE3S 1W4CA 1L5LA 5GXIA 4KLCA 3WOVA 3LOUA 1CETA 4HVAA 5KC9A 4AECA 1Y4SA 5DHFA 3L7AA 4BMDA 3BBLA 4MGIR 3AWDA 3QA3E 1U2GA 3K09C 4A09B 5REQB 1R88A 3USCS 4KQEA 4PC0A 1PW7A 5H1YA 1YJCA 3AI2A 4LCBA 3LCJA 2HA2A 3LCVB 1SQFA 2EFDB 4AUMA 4C4OA 1NR7A 2R48A 3C48A 2AEFA 4H15A 2GNAA 3K96A 1YQUA 5LC1A 4X7BA 3IP6A 4Z9YA 4K8OA 3SQOA 3GCDA 2OFFA 2D62A 5AK4A 4X1IA 1G8KA 4OQLA 2IOFK 2CXNA 4LHWA 4U7JA 1DAEA 4C7XA 4I9FA 2NOAA 3LT0A 4XIYA 3RC3A 4MV0A 3TZBA 1GU1A 3N86A 2V0CA 4NWIA 1NJ1A 2YW9A 4Y7CA 3TVTA 4Q7EA 3ZU6A 3WAKA 5JAHA 4DANA 2F3UA 5BMOA 1SHZA 1RAIA 4A91A 4GNRA 2EAUA 3H9CA 5H81A 5AVOA 1JTDB 4IICA 4F21A 1QHSA 3S3TA 4V1CA 3A3KA 1ZM2A 3QOYA 3IDZA 3QKUA 1P4AA 5TMEA 2OAGA 1G66A 4DR7B 2EJTA 3ZE0A 2XPCA 1H8HA 4OQ4A 4UDOA 1MDAH 2C77A 1PQ4A 4H6WA 1DKUA 1T2AA 1KO8A 2ZWMA 5ILQA 4JHLA 4MYHA 3HGTA 4P1ZA 1WL8A 3H99A 3UANA 4WBNF 4YMGA 4UAJA 3A58B 1YTUA 1NFQA 3WLPA 3KQOA 4G1CA 3L0IB 2O50A 4PIVA 2TMGA 2BFNA 3MCTA 2IPAB 4YP5A 4CNBA 1E4YA 3GLSA 4CF3A 3IR5A 3EW7A 3KAKA 5CK4A 1N6IA 3IKOA 1RYDA 3FWHA 2QGZA 4TX1A 4HBZA 4KRYA 3LA8A 3A7DA 1G3MA 3G0OA 3OFKA 3X1ZA 3GLFA 3VR1A 3ZY3A 4DRYA 4LWPA 2AN4A 2F1JA 1KMNA 1O03A 1OJ7A 5UKDA 4Y1RB 2P4SA 4W1QA 2W11A 4U8HA 2DCUA 1FP4B 2PSJA 2BWJA 3U2QA 3NHYA 2LIVA 1A04A 1ZK3A 4QUGA 2ZKLA 4UAGA 2Q2NA 1KQ3A 1RC0A 3LQ4A 3TW4A 4EBFA 3A9RA 4OHMA 1D2GA 3UT5B 1U2QA 1RZRD 2ZRQA 1ZVQA 1K86A 3DLHA 4KQXA 1P1CA 3GROA 4LYFA 1DNPA 4YAKA 3FYUB 5A04A 1UPAA 2P4UA 2VYNA 4UFPA 4YPOA 5HRCA 2BGTA 4Z7OA 2CN2A 1EWQA 2J7KA 2FPUA 2EG9A 2RAUA 5FQNA 2DXIA 3DFFA 1WUIS 1VHDA 1ISRA 1S3IA 2P2DA 4H6PA 3GJZA 3NBKA 2Q1YA 5ALGA 3T4XA 3JZIA 2HB6A 4YRBA 3EDRA 5KJ1A 4ZYYA 3AJAA 1RVV1 3W8NA 3UCEA 1LI7A 2FE1A 4DLVA 3P27A 2XUOA 3VXKA 4XM1A 1X14A 1ZQ9A 3HADA 1E5LA 4X60A 3THRA 1JAHA 3AOEA 4U7GA 3GEIA 1F8GA 1VPEA 4HDMB 1TVCA 2EGUA 1FJHA 2D2FA 3WQBA 4KE7A 2BF4A 3I12A 5AJTA 3F0TA 3MVDK 1N3LA 4Y2TA 4QUEA 1JHXA 1QZTA 2ZIEA 2Q6IA 3AM5A 4NZMA 4U2BA 4BFXA 1WOMA 2H1LA 1CJTC 5HHTA 1K5PA 2GARA 1S5PA 1X0XA 4RHEA 2V7XA 2EF1A 4PTZA 3FCOA 1KH1A 1M0EA 2H2AA 4GVLA 4UNSA 3OQ1A 2OG2A 1J24A 1QCYA 2ID7A 3L7IA 5DMHA 3R5HA 4TZTA 4OBBA 1BQEA 2P8JA 1BD4A 3P0JA 3JQDA 4MWCA 5IXYA 4YRLA 2PTHA 1VRWA 3JQGA 3WWCA 1FUUA 1KFJB 3FAZA 3FD8A 4XDZA 3NPAA 3SM9A 1F1JA 3EB9A 2GBLA 3EBLA 2QV0A 2B5MA 4E5PA 2IGBA 3SMQA 1VMDA 4PSXB 4H1TA 3AI1A 1U9IC 3CA8A 2X9QA 1V1JA 2AVNA 1Y7TA 2K5UA 1C9NA 1SEVA 2EQAA 3ZBPA 4O2BF 4TTVA 4ME6A 4YDRA 2JGFA 2CV1A 1GGHA 4GR9A 1E77A 2O2SA 4HDCA 1YDEA 3M4NA 1WDLA 1UK6A 1UANA 2P4HX 3CNBA 2OXRA 3QU4A 3GA0A 4GSKA 3O8OA 3CX6A 4DV6B 1QO0D 1F48A 4M9UA 5HJEA 4YQFA 4IGEA 4OXKA 4JSRA 2GI4A 4DA7A 3QJGA 5H02A 1F8XA 8OHMA 3L49A 3KC2A 4R6XA 5HOEA 4DM3A 1U8CA 2ZPUA 2AOUB 1MHTA 4AROA 1R6TA 2PZLA 1RPAA 3PUKA 3V8RA 1K3UB 1NVVR 2PAFA 3OIYA 2WSIA 3TO5A 4P5PA 1SKYB 3VPHA 4G0WA 5CITA 1QJ4A 1BGVA 1KVRA 3HJUA 1NW9B 4LXQA 4J7CA 3K1YA 1Y6FA 3KPWA 3TD9A 1P2TA 3U7RA 5BRJA 4BJ5A 3VDRA 5CLFA 4PINA 3NT2A 2ONKA 2PZGA 5CVTA 2XNDA 3E3LA 4OLBA 4TTPA 3BXXA 2P9SC 2GJ9A 3W2TA 1Z07A 1QS0B 2WYIA 3I52A 4QUIA 1P0MA 2WWRA 4R2XA 2BBTA 2ZULA 2PLFA 1QGOA 2ZJAA 3LY9A 4IQ0A 2BC9A 3V4ZA 4HRVA 4MJXA 5T4HA 1WABA 3KOOA 3C3PA 3NHRA 4JJEA 3KZ1E 3JAKA 1Z6QA 3IFSA 3IIKA 2PXAA 1VRVA 1G2QA 3G9ZA 3HBAA 4HMOA 1D5WA 4WKPA 4C0QC 1WBBA 3DE1X 3CLRC 4AS3A 2ZREA 3VH0A 5DLPA 1O5TA 5DHPA 3DLPX 3V2HA 3IMCA 2QRVA 2ZAIA 2AT1A 3D9QX 2VDOA 4ZHQB 1VLHA 2B4RO 5F51A 4GEKA 2AEJA 2CHUA 2EP7A 4TVBA 3NWPA 3CNNA 3R75A 1OTHA 1BXGA 1C41A 2B36A 3ZDDA 4DGSA 2E82A 4RD6A 1NNUA 1W0KA 5MF6A 2ZATA 3A26A 1J2EA 1B6TA 3MLEA 2Z5LA 4B3GA 2J9RA 3EA0A 2PX8A 4XEUA 1IATA 3FI9A 4PYQA 4OEHA 1M2HA 2X5XA 2VDQA 1O4WA 3LF1A 2R7NA 1LW7A 2A0FA 1ZCZA 4B3JA 4FYXA 5DSTA 2HUNA 2Q9AA 4ESOA 3DLAA 2GLUA 4BRSA 3L0PA 3K0CC 4L2IA 4K5QA 2C78A 3GHHA 1PFYA 3D5QA 3FRXA 4TZ0A 3GJQA 4IMIB 1XB2A 3O1HB 4P3OA 3GH3A 1WMDA 4AS1A 1ORRA 3L0SA 5K5EA 3I04M 4Z9XA 2B8NA 4WJLA 4Q4DA 4K6CA 4LRQA 1OB5A 1KY5A 1TEHA 4D25A 4UEKA 3BB1A 3FHJA 3CT4A 4HMQA 5JC8A 1J20A 2ZRPA 4X24A 2VJQA 3Q98A 2HO5A 1KTVA 3IAFA 1Y3FE 1JSZA 4LXUA 4A3SA 5KYUA 2QENA 4HQFA 5JWZA 4X7PA 1DCMA 3TAHA 5JD4A 4IV5A 2JIRA 3GH1A 3P2MA 3NT5A 1VCIA 4YAGA 2HNAA 3BGSA 5FF9A 1X2BA 4Q7KA 4Z8XA 2HBQA 3IR6A 4ZZ1A 1ZJ6A 1GLNA 4X93A 1SEPA 3K16A 3PIIA 2IP2A 5FUQA 2BFMA 4FYHA 2C7GA 3O8BA 1NDQA 2WHYA 2PKEA 1F2VA 4B44A 3QX3A 2ECKA 2G70A 2GPNA 2NW6A 4IDFA 3PITA 1V8PA 1ZGBA 1EQUA 3QFHA 3RMZD 3DDSA 2YHIA 4CN8A 3KQTA 4UARA 2CLFB 2YCBA 4UTXA 5KNDA 1ZGCA 4WECA 2OIZA 3WQQA 3NVAA 3SR3A 4BLWA 1YQWA 3QJ5A 1IXRC 1FFGA 1SC4A 1JSCA 3T3HA 4DR1B 6ADHA 3R0QA 1NLUA 4FCTA 4BNJA 2W6QA 3ZHXA 1O89A 2G9UA 4BNWA 5DHAA 5BWBA 1PSWA 2CCKA 3FTCA 4MV3A 4DPKA 4B85A 2FP3A 1SKYE 3PX7A 4IW3B 2ZSEA 4FSDA 2I33A 2QZZA 3R74A 2V6GA 1NNEA 4KAJA 3QBEA 5I4IA 1AHPA 3QUTA 3ECAA 3DZDA 1TM1E 5D5PA 4ZPXA 4DG9A 2I55A 5DCLA 2WSLA 1X7GA 4C43A 4FGJA 4LWZA 5GIOE 1NJSA 4OHFA 1F0KA 1JSRA 1TO1E 3NBUA 2H4JA 2XH8A 4ND8A 5SY4A 3L1VA 1OE0A 4KJZA 4NCKA 4MR7B 2CLDX 4U63A 3TX2A 4B6FA 2ORYA 4HZIA 2HU7A 5IJ0A 2M6LA 4CFSA 3KT3A 3GMDA 3IRVA 3H7IA 1DOZA 2IYWA 3GARA 4HLUA 4Z54A 3HXMA 1Z6ZA 4COOA 3G02A 1LJ8A 3H4VA 3MMYA 1MUUA 1OYYA 3FZQA 3JV7A 4BMXA 1PNVA 4AN0A 1GPAA 3SICE 3JAMg 5EPOA 4JBNA 4XWWA 4ZT3A 3SU8A 4TQUS 2D5CA 2XXJA 3H84A 4JB0A 2ZUSA 3W8DA 4X8MA 5BW6B 2ZPAA 2B20A 1SXPA 2ENUA 4GMFA 4OK3A 2BVNA 1JNYA 4KO2S 4YRZA 4IOKA 3ACDA 3C6XA 1NUQA 5JRJA 3F4KA 3UPUA 3ODGA 4LSGA 4AMUA 1G7TA 2IPMA 4FGKA 1RHMA 3GJ0A 3EG9A 3FGPA 4LZOA 2P9LC 3ER6A 4AJPA 1O96B 1U9CA 1XAHA 4J9VA 3VNVA 1N7GA 3G8CA 2X8JA 2WTXA 5KHLB 1OYVA 2B4TO 3TQOA 1V8BA 2Q3CA 3V2GA 5MDHA 4F45A 1S2OA 2QSJA 4RHTA 1BCSB 5CA1F 4EEXA 4YCDA 5DISB 2HK6A 2Z08A 2R751 1UTCA 3K5IA 2O3JA 1H1TA 4CTNA 1LS1A 3UPDA 2FZ5A 5EA2A 2V5VA 1TVMA 4WKBA 4ZV4A 2W6CX 1KF0A 1YKSA 4C20A 2J0VA 3NTLA 4NYMR 3E9EA 5I47A 2FZKA 1WY7A 4OUDB 3WG9A 1SVOA 3I53A 3H8SA 2GPJA 1E1CB 5TPZA 1OI3A 2NZVG 3MINA 4O4JF 4BECA 4H6XA 1QNLA 1CERA 3EDMA 4NS1A 1WPXA 4CTMA 1MG0A 3GGSA 5MN5A 4XPIB 3RVQA 4DMKA 5CVUA 4BX3A 4J43A 1BWRA 1F20A 1YE5A 3UT6A 3EA4A 1OH5A 4G9EA 1HDZA 1MAAA 1B1AA 1Y8QA 5HYNB 3SDSA 1B41A 4NCXA 2E55A 3B3AA 3WLNA 2ZANA 4JA2A 2WILA 3LWBA 2X4DA 5HVNA 3KU1A 3M33A 2IS2A 1DRJA 2Q8QA 2QVLA 1U8UA 5KVVA 2J6BA 5H16A 4QZVA 3UJCA 3RANA 2IUYA 4F5WA 4MMYA 4OGWA 4IHJA 2X76A 1RP7A 2WJAA 3RSOA 5CEFA 3JALB 1K4KA 1FLVA 2QVZX 5DOVA 3I7OA 4JHPC 3FCCA 1SXQA 2I6TA 4ZVTA 3LIIA 3FR8A 4PXSA 1IONA 3OP1A 1U4CA 2CGEA 3OEEA 1E6CA 1SHUX 3O9VA 1GRQA 4X95A 1V3UA 4D3SA 4BNUA 4PYIA 5IYZB 4HH3C 1GGMA 2X7XA 4RZ3A 2O2GA 4DUGD 4EGFA 5E6UA 2IU0A 1E3JA 1RJ9B 3S55A 2HWYA 1JJUB 4QTYA 4BQSA 1PJZA 3CUKA 3PFKA 3PUXA 3Q87B 3FF1A 4V0ME 2P90A 3CVWA 2IXFA 4KH1A 3HP1A 4EHAA 3UJ7A 4LMAA 2JD2A 3NC4A 2IUEA 3UKOA 2QG6A 1ZICA 1PLKA 2Y0PA 3ETLA 2H1RA 1QIGA 1CNMA 1OILA 5K8UA 1TIPA 1U8ZA 5DLQC 4RELA 4CR8A 4KN6A 2L17A 3U3ZA 2BMDA 3U4HA 4Q6WA 1P4JA 1T3ZA 3D2CA 2I34A 3MN1A 3HN7A 1SNYA 4JYMA 5IBCA 1RBYA 2YL2A 2BSAA 3KJXA 1RQRA 2C9MA 2AJDA 2VAVA 4EDFA 2JI9A 1AKEA 4UOZA 3HXKA 2DSNA 1YOVB 2WM9B 1XLVA 2CXUA 2HRCA 2ZKIA 1CJSA 2UXCB 4PZLA 1H85A 5FXYA 4EUKA 3T1HB 3RFFA 5BSTA 4XSGA 1KMQA 2L2QA 4G81A 2Z2NA 4W63A 1SN7A 4M9RA 2YQ4A 4RY8A 1V5WA 3KB1A 4D99A 4RLSA 2ZTLA 1N2OA 3UB3A 5FV4A 1OLSB 4M22A 4PNHA 1KMMA 1J39A 4HJRA 1U3CA 1H0SA 2VK4A 3GFGA 2ZS9A 2REQA 4RPCA 1NVKA 4XCVA 3BK1A 1M6NA 4D6VA 3FBWA 1OFUA 1XEXB 4UUQA 4D9GA 4ON9A 4BQEA 4NR0A 3PTAA 3FAKA 5K8TA 4OFZA 4DOMA 2NYUA 3DR5A 1I7QB 1PD0A 2JAQA 3AEXA 2D1YA 2WIDA 1JB1A 2CUTA 4N3AA 4YRNA 2BISA 3DKPA 5FCDA 2OQ2A 3FM9A 4L95C 4K9SA 2UZYB 3AH8A 4U6NA 4NZPA 4MA4A 4WCVA 2DFLA 1V9CA 2OFOA 4QQEA 1PDOA 2OMKA 5HS6A 2H6NA 1I14A 2GR9A 4WXPA 3CLRD 3DPIA 4KX5A 4EA9A 2YXPX 4B48A 4EG3A 5BV0A 1QGED 2ILVA 2P2LA 4LI0A 2PEYA 1VE1A 4B82A 4G6ZA 4AG3A 2LV8A 3IEVA 2FZLA 5DNEA 1OFIA 2IYEA 1SCQA 5DXFA 5ELXA 3BK2A 3BWYA 4MH0R 1TMGE 1OVGA 1TI7A 4Q37A 5K4AA 4RPGA 4LHYA 4HDKB 2BR4A 3AETB 5AKKA 3EE6A 4DQXA 4XTRA 5J5VA 3ROPA 3H1FA 3VZCA 1P9RA 3G88A 1VCMA 2IJGX 3OC6A 4JYZA 2DHCA 1Z0ZA 5F1PA 1J0BA 3SAJA 4ZYVA 3VKUA 4J7AA 4DE5A 1XNJA 3NC0C 3FBTA 1VI2A 1E0JA 1JV2B 2BGRA 3CV3A 2C7OA 4DSZA 3PDCA 2PGDA 2UXDB 3PLRA 1S2MA 5LOVA 5EI5A 4R0MA 2Z6AA 1L4KA 1NXVA 2N42A 4J77A 1VA5A 3WFJA 4D3DA 2X19A 1UMCA 1CRZA 4ZYZA 2AN3A 4A9AA 4OHVA 2EARA 3TFWA 3HR4A 3IQIX 1H5NA 4P08A 2PX5A 2H6KA 3HFGA 3WKBA 3ROMA 2Z58A 1ESMA 2PMWB 4UC0A 5MGBA 4J3NA 1HLFA 4PXWA 2HRBA 4FONA 1F6DA 2ZOSA 1E9SA 1GR1A 5GJBA 1AUXA 2BKVA 5I8ZA 3CTPA 3EZ6A 1QHEA 5I4BA 4TTIA 4LWOA 3H5LA 2R1TA 4JXZA 2GNPA 2GCPA 2ZJ4A 2ECFA 2HDNB 4G5FA 4CR7A 4QATA 4QO7A 1J7KA 3IXLA 2P91A 1US8B 3WGLA 4ZI7B 5TMDA 5E9QA 1D1PA 4GSLA 5HQGA 1LK0A 2EHJA 5L3VA 3HKBB 5BSUA 3AUTA 4YBRA 1PJSA 3OWHA 1SQGA 1NQUA 1EFDN 5ALTA 5HZKA 2YIMA 4B3IA 4QTTB 2AMJA 4ALJA 3R7SA 1O3YA 1LC0A 4DNXA 3RC7A 1Q19A 1RCFA 3JQAA 5KYGA 1AGXA 1P8AA 4TL9A 1F12A 4MP8A 4IHAA 1TVKA 3EZ9A 1D6MA 4LMRA 4TUYF 4K88A 4CJXA 1EDEA 3A6ZA 5C4MA 5B2FA 3MB5A 4WASA 2WYOA 2FWIA 2BFBB 4M0MA 3O2SB 1M0TA 4BO8A 4EY4A 3P9RA 4WNYA 1QR2A 3VU9A 4YASA 5COAA 4A4DA 1SXJB 1LVGA 1G291 1TM3E 4OD0A 2NUAB 1ZISA 4BGEA 3DJYA 3F8TA 1EDBA 1CC1S 2HM7A 3P0FA 1FFXB 2IY9A 5BSWA 2O6LA 3STWA 4RH3A 4Y9TA 3WOHA 3PXUA 3PVWB 2QK4A 3WB0A 1DC6A 4DQUA 3IKTA 1OZGA 1X13A 3O0DA 1V4VA 4M46A 3S2YA 5LYJB 3PGXA 3DZIA 4G89A 1FTWA 5DBEX 1RT9A 4LY9A 4PX2A 5CD9A 3NEYA 4BZQA 2B98A 2RHGB 3ROZA 1ISMA 1D4OA 1C3VA 3GFVA 3W7BA 1G21B 1KYVA 1MT0A 5BMVA 2WJIA 3IMGA 1XIPA 4L7VA 4BN4A 2JVJA 1XBTA 3LY5A 4NP6A 4AQ7A 2NU7A 3F6RA 4WJKB 3OL2A 1G5RA 4DLZA 1Q5PA 3U6BA 3NOOA 3ZXXA 3TTTA 5GINE 3HI6A 1ENOA 1MTOA 1JKFA 2G3YA 3K9BA 2CE2X 5KPDA 2YINC 3NDBB 3AHGA 4ISBA 1KBQA 1CW2B 2WPDA 1NP3A 5LP6A 3VR4D 3AK4A 1X7YA 1Q84A 4NBNA 3UGTA 3RASA 4TTTS 4RTLA 1UJ4A 3RVDA 1NTOA 3ESXA 5L51A 3TZCA 2H0RA 1OPRA 2FSVA 2QRKA 2X40A 1PLJA 2CFOA 4CL8A 5EM2B 1JG1A 2WMOB 5AXBA 2Q99A 3EHDA 1JYFA 1XX6A 1NUPA 2BFPA 5CB4F 4DLNA 4HNSA 3QELA 4XVRA 1JQKA 2YN2A 4JKIA 1RXYA 4MARA 1HNWB 4BNFA 2WIKA 3L01A 4D9CA 2WJ3A 4F1JA 3NUQA 1XCBA 2NU8A 2Z2IA 4LOJA 4YWJA 1L5OA 2XVYA 4FB4A 5IGQA 2Q5QA 1AM4D 4P33A 1ZUWA 2YWJA 4W5JA 2GHTA 4B5LA 4O4LA 4OX9Y 2OLEA 3H9QA 4AZSA 5DM1A 2EFJA 4QRHA 1O8CA 3VNSA 4EHDA 5E9JA 4JX8A 1ZMBA 3ENVA 4DCJA 3FPBA 5K2OA 3FHCB 4GP9A 3NIGA 4DMHA 1YJ5A 3S2ZA 2F8TA 4ZC1A 1SBZA 4PQFA 4H7EA 4CQJA 4EMBA 5FLKA 3BBPA 3AEUB 1GSAA 2YV1A 4MV4A 2Q9CA 3SZRA 1DBSA 4OFWA 1MN6A 5JNRA 5IHXA 5T3UA 4BKRA 1YUMA 4BU0A 2MSWA 3C98A 1P7YA 1K7XB 1GOFA 2HPZA 1E1YA 5DKFA 2CFSA 2AGWA 3P2KA 3PKZA 2FEMA 4MINA 5AVZA 5K4HA 1IN4A 3G8BA 2ZCJA 3V9FA 4H7DA 1Y6RA 4Q9JA 1XT6A 1FDIA 4GOJA 3VISA 3R9KA 4MWZA 1ZJ4A 1ZN2A 3RG2A 4CQLA 4H1HA 1POWA 3U62A 1TM2A 5JQWA 1Q15A 4FEAA 5F3WB 3H7AA 2IXBA 1R0YA 3RPEA 4ALNA 1L5HA 4FR2A 3H5IA 2VTVA 5HMMA 2ZWOA 5GONB 3T7TA 4J0DA 4FGUA 4MQEB 4UBMA 2G8NA 1E3WA 3MZKA 2Q29A 4ZI2A 1F4PA 1HEUA 1DQNA 3TLEA 5JI3E 1ABEA 3VJKA 4Y6RA 2GEUA 1EX9A 3GVHA 4PVCA 3LYUA 4M0DA 2GC7A 4EB3A 3T5AA 1KO1A 1PQPA 4OL0A 3AZQA 5GAJA 1SH7A 3DP7A 1FFSA 4KQGA 5HE9A 1U99A 2PGXA 2H1VA 4C7JA 1VKJA 4WK6A 3PC4A 1AS0A 3QLVA 1NEXB 2DPXA 1QX3A 3E0QA 3LHSA 1NPTO 3M6LA 2XMCA 5B6IA 3PC8C 3FYUC 2V3CC 2WE7A 2V7VA 4OLFA 1L5WA 1N5MA 4XDYA 3MTBA 1Z5VA 4LMBA 1G21E 3QWIA 2FN9A 1FIUA 3OH8A 3PRKE 2Z4SA 4KN9S 4UXJA 3UFXB 1WZEA 3SNKA 5HFNA 1JR2A 3CPJB 5AKZA 2VDPB 5T64A 4IVQA 4D41A 2PGLA 3PXAA 5LDDC 2Q49A 3PQ2A 5L8VA 2B69A 3W4KA 4BKUA 3FVQA 4KZPA 4XCQA 2ZSKA 1NYLA 3UBTA 4P9NA 2HADA 2JJ1D 1AO0A 4EEZA 3MXOA 5BQ5A 3VZRA 1XQ6A 3RHTA 2BRUA 1SUDA 3ET4A 4M36A 4CKXA 3NHPA 4MB6A 2B2CA 2VJLA 1FXWF 3TNLA 3CZAA 2W42A 2IPLA 3QNMA 2O1EA 5BRNA 4JB8A 3IPXA 3AKEA 2CHQA 4M7PA 5KNBD 3GZTB 3DMRA 2IHUA 4A26A 3ZZUA 2Z6UA 3DAPA 2KLBA 2DSTA 2H5LA 3DFZA 4NU8X 1E4VA 3IOCA 3BHJA 1NBEA 4RENA 1UXOA 2GBCA 1K92A 1SOMA 3MXTA 3LWZA 3NWBA 2RBEA 3QHAA 1DS6A 3OWOA 3LH5A 4F9EA 4U39A 2BFFA 4LBYA 5A4IS 5JDCC 1VBMA 4GPD1 1MV5A 4I55A 3WRYC 3MOIA 4URVR 2B61A 4EG1A 4JAVC 1XPOA 1XOIA 2HF7A 1ZUNA 4KK4A 2C42A 1MO3A 4B81A 5K3AA 4JI8B 1SVNA 3TLBA 4C22A 5BW8A 1BXZA 1I10A 2FRDA 4JLUA 1PV4A 4OB6A 1UJMA 1M5RA 3KP1A 2W2LD 1A50B 3HVJA 1VRCA 4MW0A 4DZTA 2UUCB 3NG1A 1OXKB 1JHOA 2ISSD 1T36A 1XTZA 4UKDA 4W5RA 3BRWD 2P1DA 5CPFA 2H6QA 1TJNA 1G98A 4R8SA 2XBMA 2M6SA 3U4AA 4LNUB 4U2DA 4HNUA 2W8ZA 3AR4A 1YB1A 5HIKA 4U2CA 4YRMA 2WWIA 1GYQA 5TGDA 2JCXA 1P77A 3OOYA 1PTJC 2R0QC 3F9RA 2WHPA 1OR8A 3NPMA 1ZVJA 3WA6A 4CLOA 3HHEA 5DH9A 4RJKA 5HXAA 1Z4IA 4MLZA 2IYXA 5G0UA 3FI0A 1IAQA 5DT9A 3TZEA 4E2YA 4GM9A 4AJ4A 3SVLA 3KIPA 4G5GA 4HD8A 3OO0A 5BYBA 1I2DA 2C2BA 3F9CA 2P9IC 1CUIA 3ZJYA 1Q21A 2F4VB 2GD0A 2GKGA 1J0XO 4O6VA 4ZCLA 3RNOA 2OBMA 2H00A 4ILKA 4B3XA 3WB9A 3QVJA 4UW9A 1AA6A 3MGAA 4OJKA 4EW6A 1N9GB 3BZWA 2J08A 2OKGA 1RWKA 5HQ3B 4LISA 3B9QA 1L5GA 3CWZA 1E58A 4XGRA 1IXKA 2HBYA 2XVAA 2JFHA 2RGNC 4AZ3B 1DXOA 9GPBA 5LQDA 3I1JA 1WUJS 3M1YA 2ZT5A 3SR0A 4YCAA 1VB3A 4XDGA 4UU7A 4D3ZA 5T41A 2ORED 3OT5A 3L8FA 5FA5B 1Z15A 3OZCA 2YWBA 2AQ5A 2JGLA 4MCAA 3COJA 4MPJA 2WAMA 3JD0A 2ZRGA 2D0IA 2YV2A 4LAFA 3EGEA 3DGEC 1G9XA 3D6NB 2I8AA 2Y76A 2RJ3A 2OXFA 4NKRA 3AP3A 3IDSA 1ZI8A 1Y6JA 4DSAA 2VDVE 2JIMA 4EMUA 1H2FA 1MO4A 3WNCA 5JALA 1C1XA 2YV4A 3IJRA 2VPIA 4LPSA 4I1PA 1S3FA 1G20E 1Q0SA 5GY7A 5ALKA 3IQGX 3OTIA 2O3TA 2W18A 4PIMA 5TMBA 5AI4A 3L92A 2QGNA 5CX4A 4WFIA 1Y7HA 1R66A 1R0ZA 2HAEA 2OFXA 2BAGA 2Z30A 2R1VA 1IC6A 2YYAA 3D81A 4G4GA 3CVOA 2VBIA 2WA2A 1KK0A 4UNRA 2FLWA 3INYA 4YUAA 3KHUA 3F3GA 2C5BA 3RU3A 3UG6A 5G3YA 4DNWA 3ZHCA 1F9AA 3DL2A 2WZBA 3GZJA 3V5NA 4RM3A 2OZEA 1JU3A 1K27A 1P7PA 4XJVA 3KX2A 3SOZA 5KNBH 2E21A 3LJKA 2GPBA 2B9EA 2GH1A 4W7HA 4ZVVA 1I1QB 5KHOC 4YMHA 4IUDS 4MPPA 3KJZA 1B6RA 2VDWB 1BDMA 1G8JA 1OAOC 3TEMA 4R1MA 1KEKA 2B82A 3D3EA 4FFBA 5LWHA 3L0OA 3R5FA 2HMUA 2TS1A 2PRKA 1V41E 1VIVA 5I5JA 3UV6A 1FW8A 4BMVA 4DB4A 4W6QA 4CT4B 4IGAA 4ZOLB 3VM6A 3TB6A 4TL8A 5M04A 4NNPA 1ESDA 4GGDA 1D7OA 1CIVA 3F7NA 1T0JB 1CRWG 5J63A 5HKKD 1LBQA 1ULUA 1GCAA 2P2ZA 3EQ2A 1VFNA 2J3KA 2BYTA 2VSNA 3FDXA 2Q4EA 3H8WA 2FFAA 1E2HA 1IQ0A 3ZNQA 3HWWA 2POQX 4WXRA 4Y2GA 3DFIA 3WIDA 5IJWA 3ILHA 2XGSA 4N7RA 5A1TA 1U3GA 1RKBA 1EM8B 3MBKA 4FQ8A 4AN1A 2H48A 4QYWA 4XB6B 3NORA 1M34B 1O97D 3TW8B 2NP6A 2XUAA 4O9DA 2PNFA 1Q7RA 3C8DA 1YR1A 4ZOXA 4LOLA 2EBSA 1L9KA 5BVGB 2VYVD 2G17A 1KSGA 1B00A 1R12A 1OT5A 3ND8A 2MTBA 3H2ZA 5F7XA 2ZUVA 5JYEA 4FKMA 1W4AA 1EYZA 3FPSA 4EGAA 4PHHA 4ABTA 3PI7A 5C52B 3NOXA 4FNOA 1UL1X 2ATCA 1O94D 3ROKA 3CZQA 4PGGA 1TOAA 1IXZA 1STOA 1OGIA 2VHVA 3GRFA 1OFVA 5GXHA 4Y6QA 1MQ8B 4BNIA 3AF1A 2PQ0A 3EXHA 3HU5A 3UH1A 4N5NA 5HPYB 1P62B 3FKQA 4H6VA 5ENDA 4QM6A 2WI8A 4ZN6A 2EBWA 4X85A 5JO0A 2P77A 4OMFG 4HUTA 5IBQA 5K3FB 3DXFA 4L9RA 3G2LA 2MU1A 3EBPA 4PE5B 5CYKB 2W48A 5K7SA 2V7QA 2EHDA 3SFZA 4PTLA 4MZXA 4ZHSA 2OV1A 4PGFA 1ZN8A 1VYUA 4Q0MA 5D3KA 4WERA 4MICA 2B1IA 2I78A 1RWWA 3IDQA 5CB4A 5DLYA 4MOWA 4E51A 4FE3A 4RU1A 4D8VA 1FRVA 4TMZA 2O48X 2NO5A 4B6OA 3H5NA 1HEYA 1ZIYA 1S0UA 3BE5A 2A9VA 3ZDZA 1FFCA 2RONA 4Q4HB 3ITDA 4IV0A 4EY3A 4LYYA 5CLIA 3ZV3A 3U9TA 3IJ1A 4GI1A 4RSMA 3EIEA 1C9LA 5ALUA 2WF9A 3AKCA 3F3YA 3IQFA 5HUJA 4GXTA 1XTBA 5I8PA 3K5PA 4QULA 4FGZA 4F91B 5JYBA 5LMNB 5GM1A 1KPGA 2FGKA 5LSAA 1PG5A 3V5WB 4MV6A 5I01A 4ER5A 3GFQA 2OTCA 3HJNA 4XAQA 1KDYA 3AFGA 4AL4A 4XARA 1NC3A 1QIIA 2EERA 4FFMA 1PD1A 1QCZA 1W73A 2EBUA 4C88A 3GBSA 3NO4A 3CNHA 3P26A 2Q9UA 3WISA 2J9ZB 4M1QA 5ICEA 4FILA 4MWOA 1QG4A 1N2HA 2GXUA 2BMEA 2ZIAA 4S3MA 2DUNA 4GPTA 4XUGB 5L95A 3N6VA 3NTUA 3R6TA 4D45A 3GT4A 4MS4A 4BBJA 4U7WA 1EQAA 1RYNA 1Y9AA 3BSFA 4NDZA 3QW4B 2J0QA 3L8GA 4XX1A 4KXMA 1SC9A 4RPHA 4CV2A 4BO9A 1IG3A 1P2GA 2N9UA 2ODWA 4L8YA 1Z4NA 1SU7A 3H9UA 1N6LA 1ENYA 2IURA 3QPWA 4FNMA 3Q2KA 4DNVA 2OPHA 2JFPA 1SPBS 1KK2A 3OQBA 5AI9A 4F8EA 3W5CA 1ZG3A 2ETXA 3SMRA 2P8SA 1GL7A 1XTRA 5ECGC 1GCGA 5B1IA 2B8JA 4GDFA 3EI2A 3ACBA 5LQKA 2XYPA 4EPRA 2NUTA 3ZE2B 1Q7EA 4BEVA 2G4LA 1G6HA 4M9QA 4KKXB 3WK6A 1M34E 4ZU6X 5TDHA 5IZ4A 1QIJA 2GTHA 4RULA 1PJTA 1ZGAA 1GSHA 3GGPA 1DT3A 4H7KA 3EGOA 3GDWA 2I4IA 4BDSA 4EKNB 4MK4A 4IJWA 4Q4AA 2G71A 4W1RA 4AUEA 4FLEA 1XD8A 3FMIA 4E2WA 1UZAA 3N87A 1SUAA 4W1SA 1WMBA 2Z3WA 3B5JA 3FUWA 2GX6A 2QRQA 1S4MA 4UUMA 1QHGA 5DYTA 3OFSA 3L1JA 5E4JA 5FOQA 3JQQA 4S0XA 2QTVA 2OC9A 4XUDA 5JSYA 2SCUB 1O9GA 3KWJA 3A4IA 3A6FA 3TKAA 4LDRA 4I2VA 3JPYA 4YRTA 2YB8B 4MRSA 4HO1X 4LMPA 5K2MA 3GOHA 3EAFA 1G0OA 4GYYA 3DMFA 1QDLB 3T34A 4M0KA 4FX5A 4R1NA 3HBMA 4IIVA 2JEYA 5ALSA 4IF6A 2Z6QA 5F5NA 2QL5A 1F2UA 5DBFA 3ZV6A 1I0LA 3INNA 1NI4A 1SWWA 3D6FA 1GEEA 3AR9A 1YHYA 2VHCA 5CAEA 3NEPX 1VCNA 2IWFA 5JEEA 4KQ2A 2Q2VA 4URZR 3DQZA 1QIEA 2KW5A 5T6BA 2J5BA 4UM9A 1ZRMA 3QLUC 2WZDA 1E62A 1JG7A 5AOVA 4NU5A 2GAAA 1YFKA 1JYEA 4WUTA 5KYWB 1JDSA 2NSJA 3CLUC 3S8MA 1R6UA 2XUDA 4RHXA 2CHVA 1R2QA 5ARDA 1U4OA 2ZS8A 4B47A 3STHA 3DYIA 3X2SA 3OZEA 2FYTA 3BFJA 1KEEB 2OB1A 1X1EA 1Q44A 2C5EA 1QIMA 1PI3A 4AVYA 4HAZA 3RSLA 3UT0A 5EZQA 4DS3A 3B6EA 2NIPA 3WLEA 1JB9A 3IUNA 2O20A 3UZUA 1BMTA 2P0YA 3DLIA 2JFGA 1DO8A 2O2CA 1XQ9A 5E9AA 1NQXA 1VMIA 1V7PC 2NPIA 4B4DA 3HCWA 4RHFA 4DY6A 1C0IA 1V96A 3LPMA 2SKCA 5EIBD 4NFHA 3HVKA 3QE4A 4LJAA 1QZ3A 4A8PA 3MBIA 2BBOA 1ZOSA 2VFAA 1GT6A 4ECAA 4L6CA 3SF8A 2V7WA 1K97A 4ZOCA 4KLAA 1YAHA 5E2BA 3RHSA 2F9FA 1WVMA 3T35A 1JQBA 5CH5A 1NUUA 2QYSA 2EXXA 3TIXB 1IN8A 2CEAA 1WKCA 3FNRA 4NZNA 4M0EA 3KXDA 2F7SA 1NQAO 4YX9A 4MVJA 3CIKB 3FR7A 3E8SA 1L7OA 3TQRA 3D6AA 3EUEA 1ZDMA 4B7XA 1AE1A 2AH1A 3PCXA 3QPCA 5JQGA 3G5MA 3DV9A 4DLXA 1ZHOA 2Q3JA 2OCGA 1E18A 3UMCA 5EUQB 3LT4A 4A0BA 2I2XB 5BWCA 4OHUA 4G1MA 4BLOA 1UXKA 5JNWA 3CMCO 3EISA 1GPKA 5AW2A 4FD3A 5LBTA 4I1YA 2V5AA 1IYZA 4NY1A 1KAEA 5FJIA 3IVCA 1CUVA 4N1AA 2HX1A 3B48A 3U7HB 1C1HA 4ENVA 2CVHA 1DC8A 3WMGA 1C9DB 1KVUA 2O2YA 4IBOA 2FSFA 5JRDS 1YL6A 1DAFA 3DT8A 2C0CA 2IHBA 3QSYA 1B2LA 3E5MA 4LGCA 4YMWA 4JEUA 3A3PA 2LE0A 4NVRA 1DBWA 1QRAA 4BKMA 1NQTA 3OE4A 4QYIA 4YLYA 1IBCA 2OM6A 5EJ2A 4JXJA 1CQPA 4LTNA 4M1MA 3LX8A 5FOWA 2GXAA 4JGBA 5AKXA 1C1YA 3L41A 3WLLA 4ZDIA 5LXTF 4CPDA 4DQLA 5B57C 3TQHA 1W59A 5K4GA 1O1YA 2A0KA 4NJEA 1U3VA 2VC2B 3QKTA 1H66A 4H1UA 1ZMRA 3F2IA 3HY6A 4F9GA 4W5WA 4TKMA 3CW2A 1NVEA 1SCKA 5B3JC 1SA0A 3TZLA 9LDTA 4I81A 4K9DA 4F7DA 4HEHA 3FOWA 3TLCA 4QXAA 3HJRA 3EODA 3VVCA 5EZYF 1JLLA 4ZQFA 2KPOA 5CNMA 2FUCA 2OHFA 1SUEA 1N5IA 3AJRA 3ZKWA 3S1SA 1QIKA 1SXJC 3R40A 3NHLA 1T4MA 5FLEX 3I58A 2XQIA 3AFMA 3ICQB 3PGJA 4MO9A 4UXIA 4X90A 4R1PA 2FDCA 4YMSA 2W6MA 2BGIA 1E60A 2Z4TA 4XJTA 2I6SA 3FWKA 1UDRA 1DE0A 3OEYA 4AO6A 2GA8A 4R9SA 5EMLB 1NY5A 4EJFA 3IX7A 2D0OB 1PJQA 5EGSA 1BVHA 4K40A 5CCDA 4LYDA 1NQOA 4IWXA 2OBYA 4K6FA 3JAWB 3C2QA 4MYCA 3CEAA 2OE2A 3BTOA 3QYJA 1KRWA 3EIOA 1WW8A 4OKNA 3INRA 1GOTB 1BWSA 4BX9A 1NV8A 2AA3A 3UMRA 3MTGA 1VQ1A 5H82A 4C2UA 4I6EA 3EIXA 3GEEA 5HDBB 4R1OA 3SBDA 5IT0A 2ACVA 3N59A 1Q92A 3GNSA 4BNTA 1WM1A 1T8YA 2I87A 1ZOPA 1DBIA 3W0LB 4MJLA 1LSOA 3ANTA 1IHUA 1N92A 2V65A 1JKXA 2C2XA 5FULA 3IUMA 3DOHA 3IKVA 3VKWA 1UJCA 5SZKB 3TDNA 3Q7PA 1H8EA 3RBAA 4FLFA 1AVTA 2X22A 1DEAA 1T26A 2B92A 4RJJA 1YS7A 5P21A 3BWEA 13PKA 1HQDA 3HKDA 1QYIA 5ALYA 4F6CA 3MHTA 1KYWA 1F51E 1H9BA 5KAMA 3SJUA 1WRBA 1Q12A 3VDMA 3AB3A 1EFHA 1MXHA 5FNZA 3BTSA 2IF2A 1FS4A 3OZBA 2OP1A 2YJGA 3JQ7A 4YUZA 4IH4A 2C7VA 5ELMA 3RDPA 4OHKA 4TXLA 3PK0A 3GJ4A 2CJWB 1ILWA 2JATA 5ESXA 5LQAA 3FIJA 1E4OA 1PT7A 2PMBA 3OLWA 4Q9NA 2PHZA 4HQOA 3LM8A 3VR3A 4FM9A 1E1KA 4D0RA 1HTTA 5E6RB 3G85A 1MO6A 1WX1A 2BEVB 4LRSB 1YC5A 3OM8A 1SQ5A 4NOJA 5FPHA 2V3VA 4MIYA 1ZA1A 4EHKA 1M76A 2XV1A 2Q2OA 3STUA 5C2JB 3D02A 5HQJA 3J7TA 4QBIA 3BXGA 4EYEA 4ENTA 4PBYA 4L4YA 1K7SN 3WLRA 5DK6A 4WBNA 2WD8A 4PC7A 3KBBA 5EYPA 1A9PA 2RE8A 3ROFA 2QZ9A 5LD2C 1TZJA 1IEWA 2GAOA 5IAEA 1AKQA 4P31A 4KL8S 4BZZA 1PKEA 4X71A 2P2CA 2GPAA 4LGYA 1X38A 1TZ2A 2ZUWA 3AR3A 2NZ2A 2XR1A 2IGTA 3NRJA 1ND6A 4KMMA 3TD6A 2XGMA 2GHIA 5J5CA 5DLEA 5TRTA 3CUSA 4E4TA 1OLUB 3UF0A 1I2CA 4F9TA 1ZO8A 4DPLA 1C0EA 1AHNA 3X0DA 1SUSA 1YE8A 4NG5A 3GYBA 3L8CA 5I7RA 2Q2QA 4UHKA 1H1LA 5C5CA 1X9GA 3DOFA 4UREA 4W9NA 2HWXA 1Z4OA 4ONEA 3GD5A 5IC7A 1AGPA 1OH7A 1CP3A 4TT3D 2FEOA 3DTVB 4J87A 1J99A 3W5DA 4R1LA 3S40A 4C6SA 1P45A 5TEVA 1EWYA 5LMUB 4RD3A 4RPLA 2BEWA 3U1VA 3B1YA 1CQJB 1YGPA 5AHXA 4CIXA 2QPTA 1C29B 1D4ZA 4D4MA 4R7ZA 5DT2A 1GLVA 2CDAA 1NUTA 3UAYA 4KJXA 1QIFA 3QLTA 2FKAA 3EXFB 2YVUA 3TYXA 2AMLA 1IN7A 4U1RA 3PXXA 3VHQA 2QJWA 5BR4A 1YS1X 5DYIA 1TIBA 1EB9A 1ZD2P 4N6OA 5AO9A 1L4LA 4M60A 1DAOA 4C0XA 3DKKA 2JVKA 1J0AA 2VJDA 2O2JA 1L4GA 2PL5A 2Q5OA 2Z1NA 1DHRA 3KKOA 1V9SA 2I3SA 3OMLA 2ACWA 1VLQA 4ND4A 4Z1MA 5FQOA 1VJ0A 3U80A 4ENQA 5IBRA 4ZXFA 4E5MA 1JIVA 4IZHA 1J06A 2XYIA 4ECEA 3OZIA 2C98A