2H68A

Histone h3 recognition and presentation by the wdr5 module of the mll1 complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 102
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h68A00
2P9PC 5JWZA 5FLXg 3J80g 5HYNB 1PI6A 4O45A 4ZOYA 4J8BA 3BG1A 2YNOA 3JZGA 4IA9A 4L3HD 2HKRA 2XYIA 4J86A 4A2LA 2EBSA 2HJBA 3DM0A 2OJYA 1N6FA 1U4CA 3NVXA 4NSXA 3MKSB 1MG2A 3ORVD 4FAND 4A0BB 1L0QA 4EWRA 2XU7A 1N6EA 3AL9A 4FA1D 4CI8A 3RLMD 2CO0C 4OZUA 4PC0A 3OKWA 3NVNA 4GGAA 4ZOXA 1VYHC 3SFZA 3P4FA 2GC4A 4FA5D 3N0DA 3OKTA 5EARA 4J77A 2OVRB 4K3JB 3OKYA 2IUQA 4BUJC 2AGZA 5EMMB 4GZ8A 4J8GA 2IWKA 4J87A 3NVQA 3EI3B 3C5MA 3ODTA 3MZKA 3FM0A 2H9NA 3CIKB 5AFU3 2H13A 2CE9A 4O3TB 3V9FA 4IMMA 5FA5B 3EI4A 5H1MA 5TF2A 3JB9L 3JZHA 5IJ8E 3I7NA 3SLED 3RN1D 4XEIC 1XKSA 3HFQA 4PBYA 5FKTA 3RFHA 2CE8A 5EALA 4QRJA 3PE7A 2Q7QA 3JROA 3C9CA 3IIWA 3AL8B 5AMSA 4I79A 4X3EA 2B5MA 2HYEA 2H9LA 4U1EI 3UVMA 4K3ID 4PSWB 4A0AA 4ZOVA 2H6KA 3C99A 3CFVA 2J56H 4BL0A 2AH1A 5H17A 2B5NA 5EAMA 4O9DA 2Z2NA 4A09B 4GGDA 3RSEC 2J55H 1TBGA 3V5WB 3VH0A 2J57G 2PM7B 2UZXB 4JT6C 2P9LC 4E5ZB 5SXMA 3SBRA 2I0RA 2OK4A 4ERYA 1FWXA 3EI2B 1K32A 4KFMB 3JPXA 2AH0A 4XYHA 3SJLD 4CY1A 5B4WA 4A08B 4GQ2P 5IGOA 4ERZA 5HE2B 4CY5A 1MDAH 2P9UC 4JSNC 4A0BA 5HE1B 5GXIA 5GXHA 5CXCB 4A2MA 4J73A 3IJCA 3OW8A 2HKMA 3RFGA 3OL2B 4MK0B 4JXMA 2P9KC 4TZ4A 2AGXA 1R5MA 2IAAA 3PVUB 3DSMA 4FAVD 5KDOB 4JD2C 2OK6A 2P9NC 2YB8B 2IUVA 2AGLA 4O1QD 1A0RB 3EI3A 2CO0A 5I5MA 1S4UX 2GC7A 4H5JA 3I89A 3EI1B 3MXXA 2PM6B 2P9IC 4JSVC 4LGNA 4FA4D 5EMKB 4FHLA 4QT8A 1PBYB 4PNKB 4E54B 4UI9R 4CY3A 4OWRA 5EM2B 3DXMC 4GM3A 2XL3A 2YBAA 5FQDA 3BG0A 3F3PA 1N6DA 3B7FA 3VA6A 5THAA 2AGYA 4AEZA 4FWWA 4J84A 3MMYA 4LG8A 4AOWA 3JRPA 4J81A 2CN2A 1YFQA 2H6QA 1PGUA 4A7JA 2H68A 4A09A 2O9KA 2CN3A 2QC5A 3I7OA 4E5ZA 2IUPA 3MKQA 1OLZA 2I3SA 3UR4A 1MG3A 3EU7A 5TDHB 2PM9B 3EI2A 3GREA 5FKQA 2YMUA 1ERJA 3VGZA 2MTAH 3I7PA 2I0SA 1GXRA 4D6VA 3F3FA 4J78A 3EWEA 4J0WA 4A08A 5EMLB 5TEEA 2AGWA 2IWFA 3E0CA 3IIYA 3C75H 3JZNA 4J79A 4R7AB 4GM8A 3SXTD 5GSAA 3DWLC 1TYQC 1SQJA 3V7DB 3SWSD 2CNXA 2OVQB 2W18A 4PXWA 5I5JA 1B9XA 4CY2A 5CXCA 2P9SC 3UKRC 4ZN4A 3OL2A 4QL1A 2AQ5A 3I7KA 4Y5RD 5I5IA 3IKOA 4JSXC 4X63B 3I8CA 3A0FA 3PXWD 1XIPA 4CZYA 5IJ7E 4PBZA 5H14A 2HJ4A 1U2VC 3SN6B 2I0TA 2YNPA 4CZVA 3I7HA 1JMXB 1RI6A 4O3UB 5K1CC 3ZWLB 3EI1A 4FA9D 3PSCB 4X61B 5IGQA 2PBIB 5HQGA 1JMZB 5C2VB 3I7LA 3KRXB 3L4OD 4A11B 1JOFA 4E54A 4GGCA 2HESX 3I8EA 5CXBB 4BH6A 5EM2A 2H3XA 5A2Qg 3OTTA 5CYKB 5C9ZB 5GMKn 3PXSD 4GQ1A 1GOTB 4Y7RA 4GM9A 4ERQA 1QNIA 2Z2OA 3IJ1A 4GQBB 2H9MA 3J81g 5FKSA 3AH8B 4Z8LA 2H9PA 3CFSB 5FXYA 3FRXA 5TEFA 4PSXB 5EAPA 1P22A 2UZYB 3DXKC 3ULEC 4JSPC 3AL8A 5IC7A 4J82A 3UVKA 3AFCA 4CC9A 2YNNA 2PM9A 1B9YA 3BWSA 3UVNA 3RMZD 3MZLA 1OMWB 5K19A 4LG9A 2I3TA 4ESGA 4N14A 1NR0A 1SHYB 1Q47A 2TRCB 3I2NA 3K27A 1K8KC 5EMJB 5FKRA 1SQ9A 2BBKH 3N0EA 5C2WB 4L1QD 4HDJA 1PEVA 2OIZA 2G99A 4J0XA 5HE0B 3PSLA 4U7AA 3W15A 2OVPB 2HXCA 4G56B 5AJAA 3F3GA 3OKYB 3FGBA 3K26A 4CI3A 3SVWD 2H14A 1NEXB 4JT5C 3PVWB 1JJUB 3U4YA 3UVOA 4L3GD 4QQEA 3SCYA 4XYIA 3EMHA 4ES0A 3SMRA 3IJ0A 2Z2PA 4CZXA 2H47A 2QXVA 1GP2B 5IT9g 3EI4B 2H6NA 4L9OA 4CI2A 4CI1A 3KRWB 4X60B 2BCJB 4ZOZA 4A11A 3GFCA 4D0KA 5HE3B 2G9AA 2B4EA 2XL2A 3UVLA 3UKUC 5CXBA 3JAMg 4A0AB 4H5IA 2B5LA 5CYKA 3SHFA 3L4MD 3RRMC 3RN0D 1GG2B 4FB1D 3SBPA 3SBQA 3EG6A 3PXTD 4GMBA 4YVDA 1XHMA 2IURA 2GNQA
chains in the Genus database with same CATH superfamily
2P9PC 5JWZA 5FLXg 3J80g 5HYNB 1PI6A 1BPOA 4O45A 4ZOYA 4J8BA 1C9IA 3BG1A 2YNOA 3JZGA 4IA9A 4L3HD 2HKRA 2XYIA 4J86A 4A2LA 2EBSA 3EQ9A 2HJBA 3DM0A 2OJYA 4IRZA 3ZE0A 1N6FA 1U4CA 1JV2A 3NVXA 4NSXA 3NIDA 3MKSB 1MG2A 3ORVD 4FAND 4A0BB 2VDMA 1L0QA 4RE5A 3IUMA 3MVDK 3K72A 1E8MA 4EWRA 4Z7QA 2VDNA 2XU7A 1N6EA 3AL9A 4FA1D 4CI8A 3RLMD 1O6FA 2CO0C 1GOGA 4OZUA 4PC0A 3OKWA 3NVNA 1U8CA 4G1MA 4GGAA 4ZOXA 1VYHC 3SFZA 3P4FA 2GC4A 4FA5D 3N0DA 3OKTA 5EARA 4J77A 2OVRB 2VDLA 3OKYA 4G1EA 4K3JB 2IUQA 3VI4A 4BUJC 2AGZA 5EMMB 3IUQA 4GZ8A 4J8GA 2IWKA 4J87A 3NVQA 3EI3B 3C5MA 3IUNA 3ODTA 3MZKA 2JKXA 3FM0A 4JHNA 2H9NA 2VDPA 3CIKB 5HDBA 5AFU3 2H13A 2CE9A 4O3TB 1K3IA 3V9FA 4IMMA 5FA5B 3EI4A 5H1MA 5TF2A 3JB9L 3JZHA 5IJ8E 3I7NA 3SLED 1QFMA 3RN1D 4XEIC 1XKSA 3HFQA 4PBYA 5FKTA 3RFHA 2CE8A 3VI3A 5EALA 4NAAA 2EIEA 4QRJA 3PE7A 2Q7QA 3JROA 3C9CA 3IIWA 3AL8B 3EQ7A 5AMSA 4I79A 4X3EA 1L5GA 2B5MA 2HYEA 2H9LA 4U1EI 3UVMA 4K3ID 4PSWB 4A0AA 4ZOVA 2H6KA 3C99A 3CFVA 3ZDZA 2J56H 4BL0A 2AH1A 5H17A 2B5NA 5EAMA 4O9DA 2Z2NA 4A09B 4GGDA 3RSEC 2J55H 1TBGA 3V5WB 3VH0A 2J57G 2PM7B 2UZXB 2P9LC 4JT6C 4E5ZB 5SXMA 3SBRA 2I0RA 2OK4A 2WQ8A 3GD1I 4ERYA 1FWXA 3EI2B 1K32A 4KFMB 3JPXA 2AH0A 4XYHA 1H2ZA 2BKLA 3SJLD 4CY1A 5B4WA 4MMZA 4A08B 4D9SA 4GQ2P 1M1XA 5IGOA 1VZ2A 4ERZA 5HE2B 4CY5A 1MDAH 2P9UC 4JSNC 2VZ3A 2XDWA 4DNVA 4A0BA 1UOPA 4BP8A 1C9LA 5HE1B 5GXIA 5GXHA 5CXCB 4A2MA 3FCSA 4J73A 5E6SA 3ZE2A 3IJCA 3OW8A 2HKMA 3RFGA 3OL2B 4MK0B 4JXMA 2P9KC 4TZ4A 2AGXA 1R5MA 2IAAA 3FCUA 3PVUB 3DSMA 4FAVD 5KDOB 3MUOA 2OK6A 4JD2C 2P9NC 2YB8B 2IUVA 1GOHA 1VE6A 2AGLA 3NIFA 4O1QD 1A0RB 3EI3A 2CO0A 3IULA 4AMZA 2VDRA 2XE4A 5I5MA 1I2MB 1S4UX 2GC7A 4H5JA 3I89A 1QFSA 3MXXA 3EI1B 2PM6B 2P9IC 3IUJA 4JSVC 4LGNA 5M5SA 4FA4D 4RE6A 5EMKB 2EIBA 4FHLA 4QT8A 4BCBA 1PBYB 3NIGA 4PNKB 4E54B 4UI9R 4CY3A 4OWRA 5EM2B 1E8NA 3T3PA 3DXMC 4GM3A 4Z7OA 2XL3A 3T3MA 2YBAA 5FQDA 3O4HA 3BG0A 3F3PA 4BP9A 4QAMA 1N6DA 3B7FA 3VA6A 5THAA 2AGYA 4AEZA 4FWWA 4J84A 4O2WA 5M5TA 3O4JA 3MMYA 4LG8A 4AOWA 3JRPA 4J81A 1T2XA 2CN2A 4AMYA 1YFQA 2H6QA 2QZPA 1PGUA 4A7JA 5M5UA 1E5TA 2H68A 1JTDB 4A09A 2O9KA 2CN3A 2QC5A 3I7OA 4E5ZA 2IUPA 3MKQA 1OLZA 2I3SA 2VDKA 3ZDYA 3UR4A 1MG3A 3EQ8A 2HU7A 3EU7A 5TDHB 2PM9B 3EI2A 3GREA 5FKQA 2YMUA 1ERJA 3VGZA 2VC2A 2MTAH 3I7PA 2I0SA 1GXRA 4D6VA 3F3FA 4J78A 3EWEA 4J0WA 4A08A 5EMLB 5TEEA 2AGWA 2VDQA 2IWFA 3E0CA 3IIYA 5FFOA 3C75H 3JZNA 4J79A 4JHPC 4R7AB 4GM8A 3SXTD 4NENA 5GSAA 3DWLC 1TYQC 1SQJA 3IVMA 3GC3B 3SWSD 3V7DB 2CNXA 3QHYB 2OVQB 2W18A 4PXWA 5I5JA 4G55A 1B9XA 4CY2A 1H2XA 5CXCA 2P9SC 3UKRC 4ZN4A 3OL2A 4QL1A 2AQ5A 3I7KA 4Y5RD 5I5IA 3IKOA 3OF7A 3K6SA 4JSXC 4X63B 3I8CA 3A0FA 3PXWD 5E6RA 1XIPA 4CZYA 5IJ7E 4PBZA 5H14A 2HJ4A 1U2VC 3SN6B 2I0TA 5M5RA 2YNPA 4CZVA 1H2YA 3I7HA 1JMXB 1TYEA 1RI6A 4O3UB 5K1CC 3ZWLB 3EI1A 4FA9D 3PSCB 4X61B 4AN0A 5IGQA 2PBIB 5HQGA 1JMZB 2EIDA 5C2VB 3I7LA 3KRXB 4UM9A 3L4OD 4A11B 3IJEA 1JOFA 2VZ1A 4E54A 4GGCA 2HESX 3I8EA 5CXBB 2HU5A 4BH6A 5EM2A 2H3XA 5A2Qg 3OTTA 5CYKB 5C9ZB 5GMKn 4O02A 3PXSD 4GQ1A 1GOTB 4NBMA 4Y7RA 4L1MA 2VDOA 2XZGA 4GM9A 4ERQA 1QNIA 3IURA 4Z7NA 5C86A 2Z2OA 3IJ1A 4GQBB 4MMYA 2H9MA 4AX4A 3J81g 5FKSA 3AH8B 4Z8LA 3V4VA 2H9PA 3CFSB 5FXYA 3FRXA 5TEFA 5M5VA 4PSXB 5EAPA 1P22A 2UZYB 3DXKC 3MUNA 3ULEC 4JSPC 3AL8A 1UOOA 5IC7A 4J82A 3UVKA 3AFCA 4CC9A 2YNNA 2PM9A 1B9YA 3BWSA 3UVNA 3RMZD 1UOQA 3MZLA 1OMWB 1A12A 5K19A 4LG9A 4BCCA 2I3TA 4ESGA 4N14A 1NR0A 1SHYB 1Q47A 2TRCB 3I2NA 3K27A 1YR2A 1K8KC 5EMJB 5FKRA 1H2WA 1SQ9A 2BBKH 5M61A 3N0EA 4WJKA 5C2WB 3ZE1A 4AN1A 4L1QD 2HU8A 4HDJA 5E6UA 1PEVA 2OIZA 2G99A 4J0XA 5HE0B 1VE7A 1O6GA 3PSLA 4U7AA 3W15A 3K71A 4UM8A 4BCDA 2OVPB 2HXCA 4G56B 4WK2A 5AJAA 3F3GA 3OKYB 3FGBA 3K26A 4CI3A 3V4PA 3SVWD 2H14A 1NEXB 4WK4A 4JT5C 3PVWB 1JJUB 3U4YA 3UVOA 2QR5A 4L3GD 4QQEA 3SCYA 4XYIA 3EMHA 4ES0A 3O4GA 3SMRA 3IJ0A 2Z2PA 4CZXA 2H47A 2QXVA 1GP2B 5IT9g 3EI4B 2H6NA 4L9OA 4CI2A 4CI1A 3QI0A 4WK0A 3KRWB 5FFGA 4X60B 4DNWA 2BCJB 4ZOZA 4A11A 1GOFA 3GFCA 4DNUA 4D0KA 3DDUA 5HE3B 2G9AA 1UTCA 2B4EA 2XL2A 1VZ3A 3UVLA 3UKUC 5CXBA 3JAMg 4A0AB 4H5IA 2B5LA 5CYKA 3SHFA 3L4MD 5C92A 3RRMC 3ZDXA 2EICA 3RN0D 1GG2B 3O4IA 4FB1D 3SBPA 4MMXA 3SBQA 3EG6A 3PXTD 4GMBA 4YVDA 4NC4A 1XHMA 3KCIA 2IURA 2GNQA
chains in the Genus database with same CATH topology
2P9PC 5JWZA 5FLXg 3J80g 5HYNB 1PI6A 4O45A 4ZOYA 4J8BA 3BG1A 2YNOA 3JZGA 4IA9A 4L3HD 2HKRA 2XYIA 4J86A 4A2LA 2EBSA 2HJBA 3DM0A 2OJYA 1N6FA 1U4CA 3NVXA 4NSXA 3MKSB 1MG2A 3ORVD 4FAND 4A0BB 1L0QA 4EWRA 2XU7A 1N6EA 3AL9A 4FA1D 4CI8A 3RLMD 2CO0C 4OZUA 4PC0A 3OKWA 3NVNA 4GGAA 4ZOXA 1VYHC 3SFZA 3P4FA 2GC4A 4FA5D 3N0DA 3OKTA 5EARA 4J77A 2OVRB 4K3JB 3OKYA 2IUQA 4BUJC 2AGZA 5EMMB 4GZ8A 4J8GA 2IWKA 4J87A 3NVQA 3EI3B 3C5MA 3ODTA 3MZKA 3FM0A 2H9NA 3CIKB 5AFU3 2H13A 2CE9A 4O3TB 3V9FA 4IMMA 5FA5B 3EI4A 5H1MA 5TF2A 3JB9L 3JZHA 5IJ8E 3I7NA 3SLED 3RN1D 4XEIC 1XKSA 3HFQA 4PBYA 5FKTA 3RFHA 2CE8A 5EALA 4QRJA 3PE7A 2Q7QA 3JROA 3C9CA 3IIWA 3AL8B 5AMSA 4I79A 4X3EA 2B5MA 2HYEA 2H9LA 4U1EI 3UVMA 4K3ID 4PSWB 4A0AA 4ZOVA 2H6KA 3C99A 3CFVA 2J56H 4BL0A 2AH1A 5H17A 2B5NA 5EAMA 4O9DA 2Z2NA 4A09B 4GGDA 3RSEC 2J55H 1TBGA 3V5WB 3VH0A 2J57G 2PM7B 2UZXB 4JT6C 2P9LC 4E5ZB 5SXMA 3SBRA 2I0RA 2OK4A 4ERYA 1FWXA 3EI2B 1K32A 4KFMB 3JPXA 2AH0A 4XYHA 3SJLD 4CY1A 5B4WA 4A08B 4GQ2P 5IGOA 4ERZA 5HE2B 4CY5A 1MDAH 2P9UC 4JSNC 4A0BA 5HE1B 5GXIA 5GXHA 5CXCB 4A2MA 4J73A 3IJCA 3OW8A 2HKMA 3RFGA 3OL2B 4MK0B 4JXMA 2P9KC 4TZ4A 2AGXA 1R5MA 2IAAA 3PVUB 3DSMA 4FAVD 5KDOB 4JD2C 2OK6A 2P9NC 2YB8B 2IUVA 2AGLA 4O1QD 1A0RB 3EI3A 2CO0A 5I5MA 1S4UX 2GC7A 4H5JA 3I89A 3EI1B 3MXXA 2PM6B 2P9IC 4JSVC 4LGNA 4FA4D 5EMKB 4FHLA 4QT8A 1PBYB 4PNKB 4E54B 4UI9R 4CY3A 4OWRA 5EM2B 3DXMC 4GM3A 2XL3A 2YBAA 5FQDA 3BG0A 3F3PA 1N6DA 3B7FA 3VA6A 5THAA 2AGYA 4AEZA 4FWWA 4J84A 3MMYA 4LG8A 4AOWA 3JRPA 4J81A 2CN2A 1YFQA 2H6QA 1PGUA 4A7JA 2H68A 4A09A 2O9KA 2CN3A 2QC5A 3I7OA 4E5ZA 2IUPA 3MKQA 1OLZA 2I3SA 3UR4A 1MG3A 3EU7A 5TDHB 2PM9B 3EI2A 3GREA 5FKQA 2YMUA 1ERJA 3VGZA 2MTAH 3I7PA 2I0SA 1GXRA 4D6VA 3F3FA 4J78A 3EWEA 4J0WA 4A08A 5EMLB 5TEEA 2AGWA 2IWFA 3E0CA 3IIYA 3C75H 3JZNA 4J79A 4R7AB 4GM8A 3SXTD 5GSAA 3DWLC 1TYQC 1SQJA 3V7DB 3SWSD 2CNXA 2OVQB 2W18A 4PXWA 5I5JA 1B9XA 4CY2A 5CXCA 2P9SC 3UKRC 4ZN4A 3OL2A 4QL1A 2AQ5A 3I7KA 4Y5RD 5I5IA 3IKOA 4JSXC 4X63B 3I8CA 3A0FA 3PXWD 1XIPA 4CZYA 5IJ7E 4PBZA 5H14A 2HJ4A 1U2VC 3SN6B 2I0TA 2YNPA 4CZVA 3I7HA 1JMXB 1RI6A 4O3UB 5K1CC 3ZWLB 3EI1A 4FA9D 3PSCB 4X61B 5IGQA 2PBIB 5HQGA 1JMZB 5C2VB 3I7LA 3KRXB 3L4OD 4A11B 1JOFA 4E54A 4GGCA 2HESX 3I8EA 5CXBB 4BH6A 5EM2A 2H3XA 5A2Qg 3OTTA 5CYKB 5C9ZB 5GMKn 3PXSD 4GQ1A 1GOTB 4Y7RA 4GM9A 4ERQA 1QNIA 2Z2OA 3IJ1A 4GQBB 2H9MA 3J81g 5FKSA 3AH8B 4Z8LA 2H9PA 3CFSB 5FXYA 3FRXA 5TEFA 4PSXB 5EAPA 1P22A 2UZYB 3DXKC 3ULEC 4JSPC 3AL8A 5IC7A 4J82A 3UVKA 3AFCA 4CC9A 2YNNA 2PM9A 1B9YA 3BWSA 3UVNA 3RMZD 3MZLA 1OMWB 5K19A 4LG9A 2I3TA 4ESGA 4N14A 1NR0A 1SHYB 1Q47A 2TRCB 3I2NA 3K27A 1K8KC 5EMJB 5FKRA 1SQ9A 2BBKH 3N0EA 5C2WB 4L1QD 4HDJA 1PEVA 2OIZA 2G99A 4J0XA 5HE0B 3PSLA 4U7AA 3W15A 2OVPB 2HXCA 4G56B 5AJAA 3F3GA 3OKYB 3FGBA 3K26A 4CI3A 3SVWD 2H14A 1NEXB 4JT5C 3PVWB 1JJUB 3U4YA 3UVOA 4L3GD 4QQEA 3SCYA 4XYIA 3EMHA 4ES0A 3SMRA 3IJ0A 2Z2PA 4CZXA 2H47A 2QXVA 1GP2B 5IT9g 3EI4B 2H6NA 4L9OA 4CI2A 4CI1A 3KRWB 4X60B 2BCJB 4ZOZA 4A11A 3GFCA 4D0KA 5HE3B 2G9AA 2B4EA 2XL2A 3UVLA 3UKUC 5CXBA 3JAMg 4A0AB 4H5IA 2B5LA 5CYKA 3SHFA 3L4MD 3RRMC 3RN0D 1GG2B 4FB1D 3SBPA 3SBQA 3EG6A 3PXTD 4GMBA 4YVDA 1XHMA 2IURA 2GNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9P C;  5JWZ A;  5FLX g;  3J80 g;  5HYN B;  1PI6 A;  4O45 A;  4ZOY A;  4J8B A;  3BG1 A;  2YNO A;  3JZG A;  4IA9 A;  4L3H D;  2HKR A;  2XYI A;  4J86 A;  4A2L A;  2EBS A;  2HJB A;  3DM0 A;  2OJY A;  1N6F A;  1U4C A;  3NVX A;  4NSX A;  3MKS B;  1MG2 A;  3ORV D;  4FAN D;  4A0B B;  1L0Q A;  4EWR A;  2XU7 A;  1N6E A;  3AL9 A;  4FA1 D;  4CI8 A;  3RLM D;  2CO0 C;  4OZU A;  4PC0 A;  3OKW A;  3NVN A;  4GGA A;  4ZOX A;  1VYH C;  3SFZ A;  3P4F A;  2GC4 A;  4FA5 D;  3N0D A;  3OKT A;  5EAR A;  4J77 A;  2OVR B;  4K3J B;  3OKY A;  2IUQ A;  4BUJ C;  2AGZ A;  5EMM B;  4GZ8 A;  4J8G A;  2IWK A;  4J87 A;  3NVQ A;  3EI3 B;  3C5M A;  3ODT A;  3MZK A;  3FM0 A;  2H9N A;  3CIK B;  5AFU 3;  2H13 A;  2CE9 A;  4O3T B;  3V9F A;  4IMM A;  5FA5 B;  3EI4 A;  5H1M A;  5TF2 A;  3JB9 L;  3JZH A;  5IJ8 E;  3I7N A;  3SLE D;  3RN1 D;  4XEI C;  1XKS A;  3HFQ A;  4PBY A;  5FKT A;  3RFH A;  2CE8 A;  5EAL A;  4QRJ A;  3PE7 A;  2Q7Q A;  3JRO A;  3C9C A;  3IIW A;  3AL8 B;  5AMS A;  4I79 A;  4X3E A;  2B5M A;  2HYE A;  2H9L A;  4U1E I;  3UVM A;  4K3I D;  4PSW B;  4A0A A;  4ZOV A;  2H6K A;  3C99 A;  3CFV A;  2J56 H;  4BL0 A;  2AH1 A;  5H17 A;  2B5N A;  5EAM A;  4O9D A;  2Z2N A;  4A09 B;  4GGD A;  3RSE C;  2J55 H;  1TBG A;  3V5W B;  3VH0 A;  2J57 G;  2PM7 B;  2UZX B;  4JT6 C;  2P9L C;  4E5Z B;  5SXM A;  3SBR A;  2I0R A;  2OK4 A;  4ERY A;  1FWX A;  3EI2 B;  1K32 A;  4KFM B;  3JPX A;  2AH0 A;  4XYH A;  3SJL D;  4CY1 A;  5B4W A;  4A08 B;  4GQ2 P;  5IGO A;  4ERZ A;  5HE2 B;  4CY5 A;  1MDA H;  2P9U C;  4JSN C;  4A0B A;  5HE1 B;  5GXI A;  5GXH A;  5CXC B;  4A2M A;  4J73 A;  3IJC A;  3OW8 A;  2HKM A;  3RFG A;  3OL2 B;  4MK0 B;  4JXM A;  2P9K C;  4TZ4 A;  2AGX A;  1R5M A;  2IAA A;  3PVU B;  3DSM A;  4FAV D;  5KDO B;  4JD2 C;  2OK6 A;  2P9N C;  2YB8 B;  2IUV A;  2AGL A;  4O1Q D;  1A0R B;  3EI3 A;  2CO0 A;  5I5M A;  1S4U X;  2GC7 A;  4H5J A;  3I89 A;  3EI1 B;  3MXX A;  2PM6 B;  2P9I C;  4JSV C;  4LGN A;  4FA4 D;  5EMK B;  4FHL A;  4QT8 A;  1PBY B;  4PNK B;  4E54 B;  4UI9 R;  4CY3 A;  4OWR A;  5EM2 B;  3DXM C;  4GM3 A;  2XL3 A;  2YBA A;  5FQD A;  3BG0 A;  3F3P A;  1N6D A;  3B7F A;  3VA6 A;  5THA A;  2AGY A;  4AEZ A;  4FWW A;  4J84 A;  3MMY A;  4LG8 A;  4AOW A;  3JRP A;  4J81 A;  2CN2 A;  1YFQ A;  2H6Q A;  1PGU A;  4A7J A;  2H68 A;  4A09 A;  2O9K A;  2CN3 A;  2QC5 A;  3I7O A;  4E5Z A;  2IUP A;  3MKQ A;  1OLZ A;  2I3S A;  3UR4 A;  1MG3 A;  3EU7 A;  5TDH B;  2PM9 B;  3EI2 A;  3GRE A;  5FKQ A;  2YMU A;  1ERJ A;  3VGZ A;  2MTA H;  3I7P A;  2I0S A;  1GXR A;  4D6V A;  3F3F A;  4J78 A;  3EWE A;  4J0W A;  4A08 A;  5EML B;  5TEE A;  2AGW A;  2IWF A;  3E0C A;  3IIY A;  3C75 H;  3JZN A;  4J79 A;  4R7A B;  4GM8 A;  3SXT D;  5GSA A;  3DWL C;  1TYQ C;  1SQJ A;  3V7D B;  3SWS D;  2CNX A;  2OVQ B;  2W18 A;  4PXW A;  5I5J A;  1B9X A;  4CY2 A;  5CXC A;  2P9S C;  3UKR C;  4ZN4 A;  3OL2 A;  4QL1 A;  2AQ5 A;  3I7K A;  4Y5R D;  5I5I A;  3IKO A;  4JSX C;  4X63 B;  3I8C A;  3A0F A;  3PXW D;  1XIP A;  4CZY A;  5IJ7 E;  4PBZ A;  5H14 A;  2HJ4 A;  1U2V C;  3SN6 B;  2I0T A;  2YNP A;  4CZV A;  3I7H A;  1JMX B;  1RI6 A;  4O3U B;  5K1C C;  3ZWL B;  3EI1 A;  4FA9 D;  3PSC B;  4X61 B;  5IGQ A;  2PBI B;  5HQG A;  1JMZ B;  5C2V B;  3I7L A;  3KRX B;  3L4O D;  4A11 B;  1JOF A;  4E54 A;  4GGC A;  2HES X;  3I8E A;  5CXB B;  4BH6 A;  5EM2 A;  2H3X A;  5A2Q g;  3OTT A;  5CYK B;  5C9Z B;  5GMK n;  3PXS D;  4GQ1 A;  1GOT B;  4Y7R A;  4GM9 A;  4ERQ A;  1QNI A;  2Z2O A;  3IJ1 A;  4GQB B;  2H9M A;  3J81 g;  5FKS A;  3AH8 B;  4Z8L A;  2H9P A;  3CFS B;  5FXY A;  3FRX A;  5TEF A;  4PSX B;  5EAP A;  1P22 A;  2UZY B;  3DXK C;  3ULE C;  4JSP C;  3AL8 A;  5IC7 A;  4J82 A;  3UVK A;  3AFC A;  4CC9 A;  2YNN A;  2PM9 A;  1B9Y A;  3BWS A;  3UVN A;  3RMZ D;  3MZL A;  1OMW B;  5K19 A;  4LG9 A;  2I3T A;  4ESG A;  4N14 A;  1NR0 A;  1SHY B;  1Q47 A;  2TRC B;  3I2N A;  3K27 A;  1K8K C;  5EMJ B;  5FKR A;  1SQ9 A;  2BBK H;  3N0E A;  5C2W B;  4L1Q D;  4HDJ A;  1PEV A;  2OIZ A;  2G99 A;  4J0X A;  5HE0 B;  3PSL A;  4U7A A;  3W15 A;  2OVP B;  2HXC A;  4G56 B;  5AJA A;  3F3G A;  3OKY B;  3FGB A;  3K26 A;  4CI3 A;  3SVW D;  2H14 A;  1NEX B;  4JT5 C;  3PVW B;  1JJU B;  3U4Y A;  3UVO A;  4L3G D;  4QQE A;  3SCY A;  4XYI A;  3EMH A;  4ES0 A;  3SMR A;  3IJ0 A;  2Z2P A;  4CZX A;  2H47 A;  2QXV A;  1GP2 B;  5IT9 g;  3EI4 B;  2H6N A;  4L9O A;  4CI2 A;  4CI1 A;  3KRW B;  4X60 B;  2BCJ B;  4ZOZ A;  4A11 A;  3GFC A;  4D0K A;  5HE3 B;  2G9A A;  2B4E A;  2XL2 A;  3UVL A;  3UKU C;  5CXB A;  3JAM g;  4A0A B;  4H5I A;  2B5L A;  5CYK A;  3SHF A;  3L4M D;  3RRM C;  3RN0 D;  1GG2 B;  4FB1 D;  3SBP A;  3SBQ A;  3EG6 A;  3PXT D;  4GMB A;  4YVD A;  1XHM A;  2IUR A;  2GNQ A; 
#chains in the Genus database with same CATH topology
 2P9P C;  5JWZ A;  5FLX g;  3J80 g;  5HYN B;  1PI6 A;  1BPO A;  4O45 A;  4ZOY A;  4J8B A;  1C9I A;  3BG1 A;  2YNO A;  3JZG A;  4IA9 A;  4L3H D;  2HKR A;  2XYI A;  4J86 A;  4A2L A;  2EBS A;  3EQ9 A;  2HJB A;  3DM0 A;  2OJY A;  4IRZ A;  3ZE0 A;  1N6F A;  1U4C A;  1JV2 A;  3NVX A;  4NSX A;  3NID A;  3MKS B;  1MG2 A;  3ORV D;  4FAN D;  4A0B B;  2VDM A;  1L0Q A;  4RE5 A;  3IUM A;  3MVD K;  3K72 A;  1E8M A;  4EWR A;  4Z7Q A;  2VDN A;  2XU7 A;  1N6E A;  3AL9 A;  4FA1 D;  4CI8 A;  3RLM D;  1O6F A;  2CO0 C;  1GOG A;  4OZU A;  4PC0 A;  3OKW A;  3NVN A;  1U8C A;  4G1M A;  4GGA A;  4ZOX A;  1VYH C;  3SFZ A;  3P4F A;  2GC4 A;  4FA5 D;  3N0D A;  3OKT A;  5EAR A;  4J77 A;  2OVR B;  2VDL A;  3OKY A;  4G1E A;  4K3J B;  2IUQ A;  3VI4 A;  4BUJ C;  2AGZ A;  5EMM B;  3IUQ A;  4GZ8 A;  4J8G A;  2IWK A;  4J87 A;  3NVQ A;  3EI3 B;  3C5M A;  3IUN A;  3ODT A;  3MZK A;  2JKX A;  3FM0 A;  4JHN A;  2H9N A;  2VDP A;  3CIK B;  5HDB A;  5AFU 3;  2H13 A;  2CE9 A;  4O3T B;  1K3I A;  3V9F A;  4IMM A;  5FA5 B;  3EI4 A;  5H1M A;  5TF2 A;  3JB9 L;  3JZH A;  5IJ8 E;  3I7N A;  3SLE D;  1QFM A;  3RN1 D;  4XEI C;  1XKS A;  3HFQ A;  4PBY A;  5FKT A;  3RFH A;  2CE8 A;  3VI3 A;  5EAL A;  4NAA A;  2EIE A;  4QRJ A;  3PE7 A;  2Q7Q A;  3JRO A;  3C9C A;  3IIW A;  3AL8 B;  3EQ7 A;  5AMS A;  4I79 A;  4X3E A;  1L5G A;  2B5M A;  2HYE A;  2H9L A;  4U1E I;  3UVM A;  4K3I D;  4PSW B;  4A0A A;  4ZOV A;  2H6K A;  3C99 A;  3CFV A;  3ZDZ A;  2J56 H;  4BL0 A;  2AH1 A;  5H17 A;  2B5N A;  5EAM A;  4O9D A;  2Z2N A;  4A09 B;  4GGD A;  3RSE C;  2J55 H;  1TBG A;  3V5W B;  3VH0 A;  2J57 G;  2PM7 B;  2UZX B;  2P9L C;  4JT6 C;  4E5Z B;  5SXM A;  3SBR A;  2I0R A;  2OK4 A;  2WQ8 A;  3GD1 I;  4ERY A;  1FWX A;  3EI2 B;  1K32 A;  4KFM B;  3JPX A;  2AH0 A;  4XYH A;  1H2Z A;  2BKL A;  3SJL D;  4CY1 A;  5B4W A;  4MMZ A;  4A08 B;  4D9S A;  4GQ2 P;  1M1X A;  5IGO A;  1VZ2 A;  4ERZ A;  5HE2 B;  4CY5 A;  1MDA H;  2P9U C;  4JSN C;  2VZ3 A;  2XDW A;  4DNV A;  4A0B A;  1UOP A;  4BP8 A;  1C9L A;  5HE1 B;  5GXI A;  5GXH A;  5CXC B;  4A2M A;  3FCS A;  4J73 A;  5E6S A;  3ZE2 A;  3IJC A;  3OW8 A;  2HKM A;  3RFG A;  3OL2 B;  4MK0 B;  4JXM A;  2P9K C;  4TZ4 A;  2AGX A;  1R5M A;  2IAA A;  3FCU A;  3PVU B;  3DSM A;  4FAV D;  5KDO B;  3MUO A;  2OK6 A;  4JD2 C;  2P9N C;  2YB8 B;  2IUV A;  1GOH A;  1VE6 A;  2AGL A;  3NIF A;  4O1Q D;  1A0R B;  3EI3 A;  2CO0 A;  3IUL A;  4AMZ A;  2VDR A;  2XE4 A;  5I5M A;  1I2M B;  1S4U X;  2GC7 A;  4H5J A;  3I89 A;  1QFS A;  3MXX A;  3EI1 B;  2PM6 B;  2P9I C;  3IUJ A;  4JSV C;  4LGN A;  5M5S A;  4FA4 D;  4RE6 A;  5EMK B;  2EIB A;  4FHL A;  4QT8 A;  4BCB A;  1PBY B;  3NIG A;  4PNK B;  4E54 B;  4UI9 R;  4CY3 A;  4OWR A;  5EM2 B;  1E8N A;  3T3P A;  3DXM C;  4GM3 A;  4Z7O A;  2XL3 A;  3T3M A;  2YBA A;  5FQD A;  3O4H A;  3BG0 A;  3F3P A;  4BP9 A;  4QAM A;  1N6D A;  3B7F A;  3VA6 A;  5THA A;  2AGY A;  4AEZ A;  4FWW A;  4J84 A;  4O2W A;  5M5T A;  3O4J A;  3MMY A;  4LG8 A;  4AOW A;  3JRP A;  4J81 A;  1T2X A;  2CN2 A;  4AMY A;  1YFQ A;  2H6Q A;  2QZP A;  1PGU A;  4A7J A;  5M5U A;  1E5T A;  2H68 A;  1JTD B;  4A09 A;  2O9K A;  2CN3 A;  2QC5 A;  3I7O A;  4E5Z A;  2IUP A;  3MKQ A;  1OLZ A;  2I3S A;  2VDK A;  3ZDY A;  3UR4 A;  1MG3 A;  3EQ8 A;  2HU7 A;  3EU7 A;  5TDH B;  2PM9 B;  3EI2 A;  3GRE A;  5FKQ A;  2YMU A;  1ERJ A;  3VGZ A;  2VC2 A;  2MTA H;  3I7P A;  2I0S A;  1GXR A;  4D6V A;  3F3F A;  4J78 A;  3EWE A;  4J0W A;  4A08 A;  5EML B;  5TEE A;  2AGW A;  2VDQ A;  2IWF A;  3E0C A;  3IIY A;  5FFO A;  3C75 H;  3JZN A;  4J79 A;  4JHP C;  4R7A B;  4GM8 A;  3SXT D;  4NEN A;  5GSA A;  3DWL C;  1TYQ C;  1SQJ A;  3IVM A;  3GC3 B;  3SWS D;  3V7D B;  2CNX A;  3QHY B;  2OVQ B;  2W18 A;  4PXW A;  5I5J A;  4G55 A;  1B9X A;  4CY2 A;  1H2X A;  5CXC A;  2P9S C;  3UKR C;  4ZN4 A;  3OL2 A;  4QL1 A;  2AQ5 A;  3I7K A;  4Y5R D;  5I5I A;  3IKO A;  3OF7 A;  3K6S A;  4JSX C;  4X63 B;  3I8C A;  3A0F A;  3PXW D;  5E6R A;  1XIP A;  4CZY A;  5IJ7 E;  4PBZ A;  5H14 A;  2HJ4 A;  1U2V C;  3SN6 B;  2I0T A;  5M5R A;  2YNP A;  4CZV A;  1H2Y A;  3I7H A;  1JMX B;  1TYE A;  1RI6 A;  4O3U B;  5K1C C;  3ZWL B;  3EI1 A;  4FA9 D;  3PSC B;  4X61 B;  4AN0 A;  5IGQ A;  2PBI B;  5HQG A;  1JMZ B;  2EID A;  5C2V B;  3I7L A;  3KRX B;  4UM9 A;  3L4O D;  4A11 B;  3IJE A;  1JOF A;  2VZ1 A;  4E54 A;  4GGC A;  2HES X;  3I8E A;  5CXB B;  2HU5 A;  4BH6 A;  5EM2 A;  2H3X A;  5A2Q g;  3OTT A;  5CYK B;  5C9Z B;  5GMK n;  4O02 A;  3PXS D;  4GQ1 A;  1GOT B;  4NBM A;  4Y7R A;  4L1M A;  2VDO A;  2XZG A;  4GM9 A;  4ERQ A;  1QNI A;  3IUR A;  4Z7N A;  5C86 A;  2Z2O A;  3IJ1 A;  4GQB B;  4MMY A;  2H9M A;  4AX4 A;  3J81 g;  5FKS A;  3AH8 B;  4Z8L A;  3V4V A;  2H9P A;  3CFS B;  5FXY A;  3FRX A;  5TEF A;  5M5V A;  4PSX B;  5EAP A;  1P22 A;  2UZY B;  3DXK C;  3MUN A;  3ULE C;  4JSP C;  3AL8 A;  1UOO A;  5IC7 A;  4J82 A;  3UVK A;  3AFC A;  4CC9 A;  2YNN A;  2PM9 A;  1B9Y A;  3BWS A;  3UVN A;  3RMZ D;  1UOQ A;  3MZL A;  1OMW B;  1A12 A;  5K19 A;  4LG9 A;  4BCC A;  2I3T A;  4ESG A;  4N14 A;  1NR0 A;  1SHY B;  1Q47 A;  2TRC B;  3I2N A;  3K27 A;  1YR2 A;  1K8K C;  5EMJ B;  5FKR A;  1H2W A;  1SQ9 A;  2BBK H;  5M61 A;  3N0E A;  4WJK A;  5C2W B;  3ZE1 A;  4AN1 A;  4L1Q D;  2HU8 A;  4HDJ A;  5E6U A;  1PEV A;  2OIZ A;  2G99 A;  4J0X A;  5HE0 B;  1VE7 A;  1O6G A;  3PSL A;  4U7A A;  3W15 A;  3K71 A;  4UM8 A;  4BCD A;  2OVP B;  2HXC A;  4G56 B;  4WK2 A;  5AJA A;  3F3G A;  3OKY B;  3FGB A;  3K26 A;  4CI3 A;  3V4P A;  3SVW D;  2H14 A;  1NEX B;  4WK4 A;  4JT5 C;  3PVW B;  1JJU B;  3U4Y A;  3UVO A;  2QR5 A;  4L3G D;  4QQE A;  3SCY A;  4XYI A;  3EMH A;  4ES0 A;  3O4G A;  3SMR A;  3IJ0 A;  2Z2P A;  4CZX A;  2H47 A;  2QXV A;  1GP2 B;  5IT9 g;  3EI4 B;  2H6N A;  4L9O A;  4CI2 A;  4CI1 A;  3QI0 A;  4WK0 A;  3KRW B;  5FFG A;  4X60 B;  4DNW A;  2BCJ B;  4ZOZ A;  4A11 A;  1GOF A;  3GFC A;  4DNU A;  4D0K A;  3DDU A;  5HE3 B;  2G9A A;  1UTC A;  2B4E A;  2XL2 A;  1VZ3 A;  3UVL A;  3UKU C;  5CXB A;  3JAM g;  4A0A B;  4H5I A;  2B5L A;  5CYK A;  3SHF A;  3L4M D;  5C92 A;  3RRM C;  3ZDX A;  2EIC A;  3RN0 D;  1GG2 B;  3O4I A;  4FB1 D;  3SBP A;  4MMX A;  3SBQ A;  3EG6 A;  3PXT D;  4GMB A;  4YVD A;  4NC4 A;  1XHM A;  3KCI A;  2IUR A;  2GNQ A; 
#chains in the Genus database with same CATH homology
 2P9P C;  5JWZ A;  5FLX g;  3J80 g;  5HYN B;  1PI6 A;  4O45 A;  4ZOY A;  4J8B A;  3BG1 A;  2YNO A;  3JZG A;  4IA9 A;  4L3H D;  2HKR A;  2XYI A;  4J86 A;  4A2L A;  2EBS A;  2HJB A;  3DM0 A;  2OJY A;  1N6F A;  1U4C A;  3NVX A;  4NSX A;  3MKS B;  1MG2 A;  3ORV D;  4FAN D;  4A0B B;  1L0Q A;  4EWR A;  2XU7 A;  1N6E A;  3AL9 A;  4FA1 D;  4CI8 A;  3RLM D;  2CO0 C;  4OZU A;  4PC0 A;  3OKW A;  3NVN A;  4GGA A;  4ZOX A;  1VYH C;  3SFZ A;  3P4F A;  2GC4 A;  4FA5 D;  3N0D A;  3OKT A;  5EAR A;  4J77 A;  2OVR B;  4K3J B;  3OKY A;  2IUQ A;  4BUJ C;  2AGZ A;  5EMM B;  4GZ8 A;  4J8G A;  2IWK A;  4J87 A;  3NVQ A;  3EI3 B;  3C5M A;  3ODT A;  3MZK A;  3FM0 A;  2H9N A;  3CIK B;  5AFU 3;  2H13 A;  2CE9 A;  4O3T B;  3V9F A;  4IMM A;  5FA5 B;  3EI4 A;  5H1M A;  5TF2 A;  3JB9 L;  3JZH A;  5IJ8 E;  3I7N A;  3SLE D;  3RN1 D;  4XEI C;  1XKS A;  3HFQ A;  4PBY A;  5FKT A;  3RFH A;  2CE8 A;  5EAL A;  4QRJ A;  3PE7 A;  2Q7Q A;  3JRO A;  3C9C A;  3IIW A;  3AL8 B;  5AMS A;  4I79 A;  4X3E A;  2B5M A;  2HYE A;  2H9L A;  4U1E I;  3UVM A;  4K3I D;  4PSW B;  4A0A A;  4ZOV A;  2H6K A;  3C99 A;  3CFV A;  2J56 H;  4BL0 A;  2AH1 A;  5H17 A;  2B5N A;  5EAM A;  4O9D A;  2Z2N A;  4A09 B;  4GGD A;  3RSE C;  2J55 H;  1TBG A;  3V5W B;  3VH0 A;  2J57 G;  2PM7 B;  2UZX B;  4JT6 C;  2P9L C;  4E5Z B;  5SXM A;  3SBR A;  2I0R A;  2OK4 A;  4ERY A;  1FWX A;  3EI2 B;  1K32 A;  4KFM B;  3JPX A;  2AH0 A;  4XYH A;  3SJL D;  4CY1 A;  5B4W A;  4A08 B;  4GQ2 P;  5IGO A;  4ERZ A;  5HE2 B;  4CY5 A;  1MDA H;  2P9U C;  4JSN C;  4A0B A;  5HE1 B;  5GXI A;  5GXH A;  5CXC B;  4A2M A;  4J73 A;  3IJC A;  3OW8 A;  2HKM A;  3RFG A;  3OL2 B;  4MK0 B;  4JXM A;  2P9K C;  4TZ4 A;  2AGX A;  1R5M A;  2IAA A;  3PVU B;  3DSM A;  4FAV D;  5KDO B;  4JD2 C;  2OK6 A;  2P9N C;  2YB8 B;  2IUV A;  2AGL A;  4O1Q D;  1A0R B;  3EI3 A;  2CO0 A;  5I5M A;  1S4U X;  2GC7 A;  4H5J A;  3I89 A;  3EI1 B;  3MXX A;  2PM6 B;  2P9I C;  4JSV C;  4LGN A;  4FA4 D;  5EMK B;  4FHL A;  4QT8 A;  1PBY B;  4PNK B;  4E54 B;  4UI9 R;  4CY3 A;  4OWR A;  5EM2 B;  3DXM C;  4GM3 A;  2XL3 A;  2YBA A;  5FQD A;  3BG0 A;  3F3P A;  1N6D A;  3B7F A;  3VA6 A;  5THA A;  2AGY A;  4AEZ A;  4FWW A;  4J84 A;  3MMY A;  4LG8 A;  4AOW A;  3JRP A;  4J81 A;  2CN2 A;  1YFQ A;  2H6Q A;  1PGU A;  4A7J A;  2H68 A;  4A09 A;  2O9K A;  2CN3 A;  2QC5 A;  3I7O A;  4E5Z A;  2IUP A;  3MKQ A;  1OLZ A;  2I3S A;  3UR4 A;  1MG3 A;  3EU7 A;  5TDH B;  2PM9 B;  3EI2 A;  3GRE A;  5FKQ A;  2YMU A;  1ERJ A;  3VGZ A;  2MTA H;  3I7P A;  2I0S A;  1GXR A;  4D6V A;  3F3F A;  4J78 A;  3EWE A;  4J0W A;  4A08 A;  5EML B;  5TEE A;  2AGW A;  2IWF A;  3E0C A;  3IIY A;  3C75 H;  3JZN A;  4J79 A;  4R7A B;  4GM8 A;  3SXT D;  5GSA A;  3DWL C;  1TYQ C;  1SQJ A;  3V7D B;  3SWS D;  2CNX A;  2OVQ B;  2W18 A;  4PXW A;  5I5J A;  1B9X A;  4CY2 A;  5CXC A;  2P9S C;  3UKR C;  4ZN4 A;  3OL2 A;  4QL1 A;  2AQ5 A;  3I7K A;  4Y5R D;  5I5I A;  3IKO A;  4JSX C;  4X63 B;  3I8C A;  3A0F A;  3PXW D;  1XIP A;  4CZY A;  5IJ7 E;  4PBZ A;  5H14 A;  2HJ4 A;  1U2V C;  3SN6 B;  2I0T A;  2YNP A;  4CZV A;  3I7H A;  1JMX B;  1RI6 A;  4O3U B;  5K1C C;  3ZWL B;  3EI1 A;  4FA9 D;  3PSC B;  4X61 B;  5IGQ A;  2PBI B;  5HQG A;  1JMZ B;  5C2V B;  3I7L A;  3KRX B;  3L4O D;  4A11 B;  1JOF A;  4E54 A;  4GGC A;  2HES X;  3I8E A;  5CXB B;  4BH6 A;  5EM2 A;  2H3X A;  5A2Q g;  3OTT A;  5CYK B;  5C9Z B;  5GMK n;  3PXS D;  4GQ1 A;  1GOT B;  4Y7R A;  4GM9 A;  4ERQ A;  1QNI A;  2Z2O A;  3IJ1 A;  4GQB B;  2H9M A;  3J81 g;  5FKS A;  3AH8 B;  4Z8L A;  2H9P A;  3CFS B;  5FXY A;  3FRX A;  5TEF A;  4PSX B;  5EAP A;  1P22 A;  2UZY B;  3DXK C;  3ULE C;  4JSP C;  3AL8 A;  5IC7 A;  4J82 A;  3UVK A;  3AFC A;  4CC9 A;  2YNN A;  2PM9 A;  1B9Y A;  3BWS A;  3UVN A;  3RMZ D;  3MZL A;  1OMW B;  5K19 A;  4LG9 A;  2I3T A;  4ESG A;  4N14 A;  1NR0 A;  1SHY B;  1Q47 A;  2TRC B;  3I2N A;  3K27 A;  1K8K C;  5EMJ B;  5FKR A;  1SQ9 A;  2BBK H;  3N0E A;  5C2W B;  4L1Q D;  4HDJ A;  1PEV A;  2OIZ A;  2G99 A;  4J0X A;  5HE0 B;  3PSL A;  4U7A A;  3W15 A;  2OVP B;  2HXC A;  4G56 B;  5AJA A;  3F3G A;  3OKY B;  3FGB A;  3K26 A;  4CI3 A;  3SVW D;  2H14 A;  1NEX B;  4JT5 C;  3PVW B;  1JJU B;  3U4Y A;  3UVO A;  4L3G D;  4QQE A;  3SCY A;  4XYI A;  3EMH A;  4ES0 A;  3SMR A;  3IJ0 A;  2Z2P A;  4CZX A;  2H47 A;  2QXV A;  1GP2 B;  5IT9 g;  3EI4 B;  2H6N A;  4L9O A;  4CI2 A;  4CI1 A;  3KRW B;  4X60 B;  2BCJ B;  4ZOZ A;  4A11 A;  3GFC A;  4D0K A;  5HE3 B;  2G9A A;  2B4E A;  2XL2 A;  3UVL A;  3UKU C;  5CXB A;  3JAM g;  4A0A B;  4H5I A;  2B5L A;  5CYK A;  3SHF A;  3L4M D;  3RRM C;  3RN0 D;  1GG2 B;  4FB1 D;  3SBP A;  3SBQ A;  3EG6 A;  3PXT D;  4GMB A;  4YVD A;  1XHM A;  2IUR A;  2GNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...