2H68A

Histone h3 recognition and presentation by the wdr5 module of the mll1 complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords WD-repeat protein 5
publication title Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h68A00
3RMZD 3B7FA 4OWRA 1MG3A 3I8EA 4U7AA 2TRCB 5I5IA 2AQ5A 3N0EA 3RSEC 3VH0A 4CZYA 3F3GA 4J84A 4LGNA 4KFMB 4ESGA 4CI8A 3NVXA 5EAPA 4FB1D 4A0BB 4FAVD 5B4WA 5CXCB 5H14A 5IGOA 3I89A 4O9DA 3AL9A 2OK6A 3DM0A 2P9IC 5K19A 5I5MA 1GG2B 4CC9A 3EI3B 4K3JB 4CI3A 2IUPA 3F3FA 3KRXB 3PXWD 5FA5B 3PXSD 3SN6B 3SBQA 4A09A 5EM2B 2B4EA 3EWEA 1R5MA 3EI4B 2OVPB 4K3ID 1K32A 4R7AB 3AFCA 4A11B 4J0WA 3I2NA 4FHLA 2Z2NA 4QL1A 2H14A 3SMRA 4GZ8A 1YFQA 2PM7B 5IJ8E 5HE3B 2I0SA 5H1MA 4NSXA 3IJ0A 3MZKA 3I7NA 2AGLA 2CO0C 5TDHB 1SQ9A 4PNKB 3JZHA 2P9UC 3IIWA 3SBRA 3AH8B 4A7JA 4PSWB 4IA9A 4GGCA 1PGUA 2H3XA 4JSVC 3IJCA 2P9KC 5EAMA 4LG9A 2IAAA 2GNQA 2J56H 5HE0B 5TEFA 2HJBA 3MXXA 4ERZA 3MZLA 5HE1B 1PI6A 3C9CA 2G9AA 3UVKA 5FQDA 3EI1B 3JZGA 4TZ4A 5FKSA 4J0XA 2CN3A 3FGBA 3AL8A 4HDJA 4L3GD 2H6NA 2HXCA 5C9ZB 4O45A 5EARA 2PM9B 3CFSB 2OVQB 5EMJB 4XEIC 3SVWD 2IURA 3SLED 5CXBB 5HQGA 5JWZA 3L4OD 2XL2A 5C2VB 3JROA 5CYKA 4FA1D 4A08B 5FKQA 2CE8A 4JSPC 1SHYB 3OKYA 4FA5D 4GGDA 2CO0A 3L4MD 3IKOA 2QC5A 2XU7A 1GP2B 4PSXB 3UKRC 3DSMA 3MKSB 5IJ7E 1L0QA 1N6EA 3NVNA 4J87A 3J80g 4QQEA 4X3EA 4JT5C 4GQ2P 2H47A 3ULEC 5IC7A 4FA9D 3RRMC 2I0TA 2H6KA 2H6QA 2W18A 3JAMg 4E54B 3KRWB 3NVQA 4JT6C 3CIKB 4CY5A 4L9OA 2AGXA 3BWSA 4J79A 5CXCA 5GSAA 1NEXB 2YNPA 5EMLB 4N14A 2EBSA 2B5MA 3VGZA 5THAA 2UZYB 3SWSD 1OMWB 2AGWA 4CZVA 3EG6A 3V9FA 3IIYA 4GQBB 3OKWA 2QXVA 1U4CA 3EI3A 4L3HD 4FAND 3J81g 4A09B 1OLZA 3DWLC 3OL2A 3ZWLB 3UKUC 2BBKH 2I3TA 4J86A 1FWXA 4H5JA 1MG2A 4FWWA 4PXWA 3SCYA 3EI4A 4A11A 2YNOA 2PBIB 4L1QD 3HFQA 4GQ1A 3SJLD 4GMBA 4A0AB 2CE9A 3ORVD 5FLXg 1SQJA 4AOWA 2P9LC 2AGZA 3MKQA 3SHFA 4BL0A 5C2WB 2GC7A 3RN0D 1PBYB 2YB8B 3E0CA 2XL3A 1ERJA 5I5JA 4LG8A 1PEVA 2O9KA 4A2LA 2Z2PA 2AH1A 3JPXA 4AEZA 4D0KA 2P9PC 4CY1A 1VYHC 4XYIA 5KDOB 2MTAH 2UZXB 1S4UX 3V5WB 3I7KA 3I7OA 4CY3A 3PXTD 3I8CA 1JMZB 2J55H 3MMYA 5SXMA 3SBPA 3EI1A 3VA6A 4E5ZB 2GC4A 2I0RA 3CFVA 4ZOVA 2YBAA 3UVOA 3PVUB 4OZUA 4X60B 3ODTA 2HKRA 2PM9A 3RFHA 1A0RB 3EU7A 4O3TB 3RLMD 3DXMC 5CYKB 5CXBA 5AJAA 5K1CC 3K27A 1P22A 4CI2A 4YVDA 1N6FA 3SFZA 1TBGA 2AGYA 3EI2A 4JXMA 5AFU3 4UI9R 3I7LA 5FKRA 5AMSA 4QT8A 3GREA 2H9LA 5EMMB 1N6DA 3IJ1A 4J73A 4FA4D 1U2VC 2IWKA 2BCJB 3RFGA 2OK4A 2HKMA 4GM3A 5TEEA 4Z8LA 4CY2A 4A0BA 2PM6B 1B9YA 5EALA 2OIZA 4O3UB 2YMUA 3RN1D 3UVMA 4E54A 5GXIA 1K8KC 2I3SA 3PVWB 2P9NC 4I79A 2P9SC 1JOFA 2J57G 4G56B 1QNIA 1NR0A 3I7HA 3UVNA 5IGQA 3UR4A 2OVRB 3JRPA 1JJUB 4Y5RD 5H17A 1GOTB 2Z2OA 3F3PA 1XKSA 1MDAH 3A0FA 5EM2A 4ES0A 1XHMA 3OL2B 3V7DB 2B5LA 3JB9L 2OJYA 2AH0A 5A2Qg 3BG1A 2HESX 3U4YA 2CN2A 4GM9A 4BH6A 4J81A 3DXKC 1JMXB 3BG0A 2H9NA 3FM0A 2XYIA 4J8BA 3W15A 4A0AA 4J78A 4ERQA 4JD2C 1Q47A 3I7PA 2H13A 3C99A 4J82A 2H9MA 4GM8A 2IUVA 3P4FA 1RI6A 2H68A 4X63B 3FRXA 3OTTA 4ZOYA 4MK0B 2CNXA 3JZNA 4QRJA 5EMKB 4J8GA 4BUJC 3AL8B 1XIPA 3PE7A 3SXTD 3UVLA 4JSNC 4J77A 3EMHA 4H5IA 4CZXA 2HYEA 5GMKn 4X61B 5IT9g 3OW8A 4PBYA 4ERYA 2YNNA 3C5MA 5TF2A 2IWFA 4JSXC 1TYQC 4D6VA 4E5ZA 4IMMA 5FKTA 4PC0A 3N0DA 3GFCA 3OKYB 4A2MA 4PBZA 5HYNB 2B5NA 4EWRA 4A08A 1GXRA 3K26A 3PSCB 2H9PA 4XYHA 3OKTA 4ZOXA 4ZOZA 2G99A 4U1EI 4Y7RA 5HE2B 3C75H 2Q7QA 2IUQA 3EI2B 5GXHA 4GGAA 1B9XA 5FXYA 4ZN4A 4O1QD 2HJ4A 4CI1A 3PSLA
chains in the Genus database with same CATH superfamily
3RMZD 3B7FA 4OWRA 1MG3A 3I8EA 1JTDB 4U7AA 2TRCB 5I5IA 2AQ5A 3N0EA 3RSEC 3VH0A 4CZYA 3F3GA 4J84A 4LGNA 3V4VA 4KFMB 4ESGA 4CI8A 3GD1I 3NVXA 5EAPA 4FB1D 4A0BB 4FAVD 5B4WA 2VDRA 3QHYB 5CXCB 5H14A 2VDLA 5IGOA 2VC2A 3I89A 2HU7A 4O9DA 1JV2A 3AL9A 2OK6A 5FFGA 3DM0A 2P9IC 5K19A 4D9SA 4RE6A 4NC4A 5I5MA 1H2WA 1GG2B 4CC9A 3EI3B 4K3JB 3O4HA 4CI3A 4WK2A 2IUPA 3F3FA 3KRXB 3PXWD 5FA5B 3PXSD 3SN6B 3SBQA 4A09A 4O2WA 5EM2B 2B4EA 3EWEA 1R5MA 3EI4B 2OVPB 3IUNA 1K32A 4K3ID 3AFCA 4NENA 4J0WA 4R7AB 1H2YA 3I2NA 4A11B 4FHLA 2Z2NA 4QL1A 2H14A 3SMRA 4GZ8A 4JHNA 1YFQA 2PM7B 5IJ8E 5HE3B 2I0SA 4MMZA 5H1MA 4NSXA 3IJ0A 3MZKA 2QZPA 3I7NA 2AGLA 2CO0C 5TDHB 1GOGA 1SQ9A 4PNKB 3JZHA 2P9UC 3IIWA 3SBRA 1QFMA 3K71A 3AH8B 1C9IA 4A7JA 4PSWB 5M5SA 4IA9A 4GGCA 1PGUA 1VZ3A 2H3XA 4JSVC 3IJCA 2P9KC 5EAMA 4LG9A 2IAAA 5C92A 2GNQA 1E8NA 2J56H 5HE0B 5TEFA 2HJBA 3MXXA 3NIFA 4ERZA 1T2XA 3MZLA 3DDUA 5HE1B 1PI6A 4BCBA 3C9CA 4JHPC 2G9AA 3UVKA 5FQDA 3ZE0A 3EI1B 3JZGA 4TZ4A 5FKSA 4J0XA 2CN3A 3FGBA 3NIGA 3QI0A 3AL8A 4HDJA 4L3GD 2H6NA 2JKXA 2HXCA 3IULA 3IUJA 2WQ8A 4O45A 2PM9B 5EARA 5C9ZB 3CFSB 5M5RA 2OVQB 5EMJB 4XEIC 3SVWD 1A12A 2IURA 1UOQA 5CXBB 3SLED 5M5VA 5HQGA 5JWZA 3L4OD 1VZ2A 2XL2A 5C2VB 3JROA 5CYKA 4FA1D 2EICA 4A08B 5FKQA 1K3IA 2CE8A 4JSPC 1SHYB 3OKYA 4FA5D 3MUOA 4GGDA 3ZE2A 2CO0A 3L4MD 3IKOA 1O6FA 2QC5A 4AMZA 1M1XA 1GP2B 2XU7A 4PSXB 3T3PA 3UKRC 3DSMA 3MKSB 5IJ7E 1L0QA 1N6EA 3ZDZA 3NVNA 3MUNA 2VDOA 5C86A 1C9LA 4J87A 3J80g 4O02A 4NAAA 4NBMA 4QQEA 4X3EA 2HU5A 4JT5C 4GQ2P 2H47A 3ULEC 5IC7A 4FA9D 3RRMC 2I0TA 2H6KA 2H6QA 2W18A 3JAMg 4AX4A 4E54B 1GOHA 3KRWB 3NVQA 4JT6C 1E5TA 3CIKB 3OF7A 4CY5A 4L9OA 2AGXA 3BWSA 4J79A 5CXCA 3FCUA 5GSAA 1NEXB 2YNPA 5EMLB 4N14A 4Z7NA 2EBSA 2B5MA 3VGZA 5THAA 2UZYB 3SWSD 1OMWB 2AGWA 4CZVA 3EG6A 3V9FA 4DNVA 3IIYA 4GQBB 4G1EA 1H2XA 3OKWA 3ZDXA 2VZ3A 2QXVA 4DNUA 1U4CA 3EI3A 4L3HD 4FAND 3J81g 4A09B 1OLZA 3DWLC 3OL2A 3ZWLB 3UKUC 2BBKH 2I3TA 4J86A 1FWXA 1UTCA 4H5JA 1MG2A 4FWWA 4PXWA 3SCYA 3EI4A 3K72A 4A11A 2YNOA 2PBIB 4L1QD 4WK4A 2BKLA 3HFQA 1I2MB 4GQ1A 3SJLD 4GMBA 4A0AB 2CE9A 3ORVD 2VDNA 5FLXg 4BP9A 1SQJA 4AOWA 2P9LC 4AN1A 2AGZA 3MKQA 3SHFA 4BL0A 5C2WB 2GC7A 3T3MA 3RN0D 1PBYB 1VE7A 2YB8B 3E0CA 2XL3A 1ERJA 5I5JA 4LG8A 3O4IA 1PEVA 2O9KA 4A2LA 2Z2PA 4UM8A 1QFSA 2AH1A 3JPXA 4AEZA 4BP8A 4D0KA 2P9PC 4CY1A 1VYHC 4DNWA 3GC3B 4XYIA 2VDMA 5KDOB 3IUMA 2MTAH 2UZXB 1S4UX 3V5WB 4MMXA 4Z7QA 3I7KA 4BCCA 3I7OA 4CY3A 3PXTD 3I8CA 1JMZB 4MMYA 2J55H 3MMYA 3ZDYA 5SXMA 3SBPA 3EI1A 3VA6A 3EQ7A 2EIDA 4E5ZB 2GC4A 2I0RA 1BPOA 4RE5A 3CFVA 4ZOVA 2YBAA 3UVOA 3PVUB 4OZUA 4X60B 3ODTA 2HKRA 2PM9A 3RFHA 3V4PA 1A0RB 3EU7A 4O3TB 3RLMD 3DXMC 3EQ9A 5CYKB 5CXBA 3IURA 3KCIA 5AJAA 5K1CC 3K27A 1P22A 4CI2A 4YVDA 5E6RA 1N6FA 3SFZA 1TBGA 2AGYA 2VDQA 3EI2A 4JXMA 5AFU3 3O4GA 3ZE1A 4UI9R 3I7LA 5FKRA 1VE6A 5AMSA 4QT8A 3GREA 2H9LA 5EMMB 1N6DA 3IJ1A 4J73A 4FA4D 1U2VC 4WJKA 2IWKA 2BCJB 4QAMA 3RFGA 2OK4A 2EIBA 2HKMA 4GM3A 5TEEA 5FFOA 4Z8LA 4CY2A 2VDKA 4A0BA 3IUQA 2PM6B 1B9YA 5EALA 2OIZA 4O3UB 2YMUA 3RN1D 3UVMA 1E8MA 4E54A 2QR5A 5GXIA 1K8KC 2I3SA 3PVWB 2P9NC 4I79A 2P9SC 1JOFA 2J57G 4G56B 1QNIA 1NR0A 3I7HA 1U8CA 3UVNA 4Z7OA 5IGQA 3UR4A 2OVRB 2XE4A 3JRPA 1JJUB 4Y5RD 5H17A 3IJEA 4BCDA 1GOTB 2Z2OA 1GOFA 4UM9A 3F3PA 1XKSA 3VI3A 1MDAH 3A0FA 5EM2A 4ES0A 1XHMA 3OL2B 3V7DB 5E6UA 2XZGA 2B5LA 5M5TA 3JB9L 2OJYA 5M61A 2AH0A 5A2Qg 5M5UA 3BG1A 3EQ8A 2HESX 3VI4A 3U4YA 2CN2A 4G1MA 4GM9A 4BH6A 4J81A 3DXKC 1JMXB 3BG0A 5E6SA 2H9NA 3FM0A 2XYIA 4J8BA 3W15A 4A0AA 4J78A 4ERQA 4JD2C 1Q47A 2VZ1A 3O4JA 3I7PA 3K6SA 1YR2A 2H13A 3C99A 4J82A 2H9MA 3IVMA 3NIDA 4AMYA 4GM8A 2EIEA 2IUVA 3P4FA 1RI6A 2H68A 4X63B 2HU8A 3FRXA 4WK0A 3OTTA 4ZOYA 4MK0B 2CNXA 3JZNA 4QRJA 5EMKB 4J8GA 2XDWA 4BUJC 3AL8B 1XIPA 3PE7A 3SXTD 3UVLA 4JSNC 4J77A 3EMHA 1UOOA 4H5IA 4CZXA 1O6GA 2HYEA 5GMKn 4X61B 2VDPA 5IT9g 3OW8A 1H2ZA 4PBYA 4ERYA 2YNNA 3C5MA 5TF2A 2IWFA 4JSXC 1TYQC 4D6VA 4E5ZA 3FCSA 4IMMA 5FKTA 4PC0A 3N0DA 1L5GA 3GFCA 3OKYB 4A2MA 4PBZA 5HYNB 3MVDK 2B5NA 4EWRA 4A08A 1GXRA 4G55A 3K26A 3PSCB 2H9PA 4XYHA 3OKTA 4ZOXA 4ZOZA 2G99A 4AN0A 4U1EI 4Y7RA 5HE2B 3C75H 2Q7QA 2IUQA 4L1MA 3EI2B 5GXHA 4GGAA 1B9XA 5FXYA 4ZN4A 4O1QD 4IRZA 2HJ4A 4CI1A 1TYEA 5HDBA 3PSLA 1UOPA
chains in the Genus database with same CATH topology
3RMZD 3B7FA 4OWRA 1MG3A 3I8EA 4U7AA 2TRCB 5I5IA 2AQ5A 3N0EA 3RSEC 3VH0A 4CZYA 3F3GA 4J84A 4LGNA 4KFMB 4ESGA 4CI8A 3NVXA 5EAPA 4FB1D 4A0BB 4FAVD 5B4WA 5CXCB 5H14A 5IGOA 3I89A 4O9DA 3AL9A 2OK6A 3DM0A 2P9IC 5K19A 5I5MA 1GG2B 4CC9A 3EI3B 4K3JB 4CI3A 2IUPA 3F3FA 3KRXB 3PXWD 5FA5B 3PXSD 3SN6B 3SBQA 4A09A 5EM2B 2B4EA 3EWEA 1R5MA 3EI4B 2OVPB 4K3ID 1K32A 4R7AB 3AFCA 4A11B 4J0WA 3I2NA 4FHLA 2Z2NA 4QL1A 2H14A 3SMRA 4GZ8A 1YFQA 2PM7B 5IJ8E 5HE3B 2I0SA 5H1MA 4NSXA 3IJ0A 3MZKA 3I7NA 2AGLA 2CO0C 5TDHB 1SQ9A 4PNKB 3JZHA 2P9UC 3IIWA 3SBRA 3AH8B 4A7JA 4PSWB 4IA9A 4GGCA 1PGUA 2H3XA 4JSVC 3IJCA 2P9KC 5EAMA 4LG9A 2IAAA 2GNQA 2J56H 5HE0B 5TEFA 2HJBA 3MXXA 4ERZA 3MZLA 5HE1B 1PI6A 3C9CA 2G9AA 3UVKA 5FQDA 3EI1B 3JZGA 4TZ4A 5FKSA 4J0XA 2CN3A 3FGBA 3AL8A 4HDJA 4L3GD 2H6NA 2HXCA 5C9ZB 4O45A 5EARA 2PM9B 3CFSB 2OVQB 5EMJB 4XEIC 3SVWD 2IURA 3SLED 5CXBB 5HQGA 5JWZA 3L4OD 2XL2A 5C2VB 3JROA 5CYKA 4FA1D 4A08B 5FKQA 2CE8A 4JSPC 1SHYB 3OKYA 4FA5D 4GGDA 2CO0A 3L4MD 3IKOA 2QC5A 2XU7A 1GP2B 4PSXB 3UKRC 3DSMA 3MKSB 5IJ7E 1L0QA 1N6EA 3NVNA 4J87A 3J80g 4QQEA 4X3EA 4JT5C 4GQ2P 2H47A 3ULEC 5IC7A 4FA9D 3RRMC 2I0TA 2H6KA 2H6QA 2W18A 3JAMg 4E54B 3KRWB 3NVQA 4JT6C 3CIKB 4CY5A 4L9OA 2AGXA 3BWSA 4J79A 5CXCA 5GSAA 1NEXB 2YNPA 5EMLB 4N14A 2EBSA 2B5MA 3VGZA 5THAA 2UZYB 3SWSD 1OMWB 2AGWA 4CZVA 3EG6A 3V9FA 3IIYA 4GQBB 3OKWA 2QXVA 1U4CA 3EI3A 4L3HD 4FAND 3J81g 4A09B 1OLZA 3DWLC 3OL2A 3ZWLB 3UKUC 2BBKH 2I3TA 4J86A 1FWXA 4H5JA 1MG2A 4FWWA 4PXWA 3SCYA 3EI4A 4A11A 2YNOA 2PBIB 4L1QD 3HFQA 4GQ1A 3SJLD 4GMBA 4A0AB 2CE9A 3ORVD 5FLXg 1SQJA 4AOWA 2P9LC 2AGZA 3MKQA 3SHFA 4BL0A 5C2WB 2GC7A 3RN0D 1PBYB 2YB8B 3E0CA 2XL3A 1ERJA 5I5JA 4LG8A 1PEVA 2O9KA 4A2LA 2Z2PA 2AH1A 3JPXA 4AEZA 4D0KA 2P9PC 4CY1A 1VYHC 4XYIA 5KDOB 2MTAH 2UZXB 1S4UX 3V5WB 3I7KA 3I7OA 4CY3A 3PXTD 3I8CA 1JMZB 2J55H 3MMYA 5SXMA 3SBPA 3EI1A 3VA6A 4E5ZB 2GC4A 2I0RA 3CFVA 4ZOVA 2YBAA 3UVOA 3PVUB 4OZUA 4X60B 3ODTA 2HKRA 2PM9A 3RFHA 1A0RB 3EU7A 4O3TB 3RLMD 3DXMC 5CYKB 5CXBA 5AJAA 5K1CC 3K27A 1P22A 4CI2A 4YVDA 1N6FA 3SFZA 1TBGA 2AGYA 3EI2A 4JXMA 5AFU3 4UI9R 3I7LA 5FKRA 5AMSA 4QT8A 3GREA 2H9LA 5EMMB 1N6DA 3IJ1A 4J73A 4FA4D 1U2VC 2IWKA 2BCJB 3RFGA 2OK4A 2HKMA 4GM3A 5TEEA 4Z8LA 4CY2A 4A0BA 2PM6B 1B9YA 5EALA 2OIZA 4O3UB 2YMUA 3RN1D 3UVMA 4E54A 5GXIA 1K8KC 2I3SA 3PVWB 2P9NC 4I79A 2P9SC 1JOFA 2J57G 4G56B 1QNIA 1NR0A 3I7HA 3UVNA 5IGQA 3UR4A 2OVRB 3JRPA 1JJUB 4Y5RD 5H17A 1GOTB 2Z2OA 3F3PA 1XKSA 1MDAH 3A0FA 5EM2A 4ES0A 1XHMA 3OL2B 3V7DB 2B5LA 3JB9L 2OJYA 2AH0A 5A2Qg 3BG1A 2HESX 3U4YA 2CN2A 4GM9A 4BH6A 4J81A 3DXKC 1JMXB 3BG0A 2H9NA 3FM0A 2XYIA 4J8BA 3W15A 4A0AA 4J78A 4ERQA 4JD2C 1Q47A 3I7PA 2H13A 3C99A 4J82A 2H9MA 4GM8A 2IUVA 3P4FA 1RI6A 2H68A 4X63B 3FRXA 3OTTA 4ZOYA 4MK0B 2CNXA 3JZNA 4QRJA 5EMKB 4J8GA 4BUJC 3AL8B 1XIPA 3PE7A 3SXTD 3UVLA 4JSNC 4J77A 3EMHA 4H5IA 4CZXA 2HYEA 5GMKn 4X61B 5IT9g 3OW8A 4PBYA 4ERYA 2YNNA 3C5MA 5TF2A 2IWFA 4JSXC 1TYQC 4D6VA 4E5ZA 4IMMA 5FKTA 4PC0A 3N0DA 3GFCA 3OKYB 4A2MA 4PBZA 5HYNB 2B5NA 4EWRA 4A08A 1GXRA 3K26A 3PSCB 2H9PA 4XYHA 3OKTA 4ZOXA 4ZOZA 2G99A 4U1EI 4Y7RA 5HE2B 3C75H 2Q7QA 2IUQA 3EI2B 5GXHA 4GGAA 1B9XA 5FXYA 4ZN4A 4O1QD 2HJ4A 4CI1A 3PSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMZ D;  3B7F A;  4OWR A;  1MG3 A;  3I8E A;  4U7A A;  2TRC B;  5I5I A;  2AQ5 A;  3N0E A;  3RSE C;  3VH0 A;  4CZY A;  3F3G A;  4J84 A;  4LGN A;  4KFM B;  4ESG A;  4CI8 A;  3NVX A;  5EAP A;  4FB1 D;  4A0B B;  4FAV D;  5B4W A;  5CXC B;  5H14 A;  5IGO A;  3I89 A;  4O9D A;  3AL9 A;  2OK6 A;  3DM0 A;  2P9I C;  5K19 A;  5I5M A;  1GG2 B;  4CC9 A;  3EI3 B;  4K3J B;  4CI3 A;  2IUP A;  3F3F A;  3KRX B;  3PXW D;  5FA5 B;  3PXS D;  3SN6 B;  3SBQ A;  4A09 A;  5EM2 B;  2B4E A;  3EWE A;  1R5M A;  3EI4 B;  2OVP B;  4K3I D;  1K32 A;  4R7A B;  3AFC A;  4A11 B;  4J0W A;  3I2N A;  4FHL A;  2Z2N A;  4QL1 A;  2H14 A;  3SMR A;  4GZ8 A;  1YFQ A;  2PM7 B;  5IJ8 E;  5HE3 B;  2I0S A;  5H1M A;  4NSX A;  3IJ0 A;  3MZK A;  3I7N A;  2AGL A;  2CO0 C;  5TDH B;  1SQ9 A;  4PNK B;  3JZH A;  2P9U C;  3IIW A;  3SBR A;  3AH8 B;  4A7J A;  4PSW B;  4IA9 A;  4GGC A;  1PGU A;  2H3X A;  4JSV C;  3IJC A;  2P9K C;  5EAM A;  4LG9 A;  2IAA A;  2GNQ A;  2J56 H;  5HE0 B;  5TEF A;  2HJB A;  3MXX A;  4ERZ A;  3MZL A;  5HE1 B;  1PI6 A;  3C9C A;  2G9A A;  3UVK A;  5FQD A;  3EI1 B;  3JZG A;  4TZ4 A;  5FKS A;  4J0X A;  2CN3 A;  3FGB A;  3AL8 A;  4HDJ A;  4L3G D;  2H6N A;  2HXC A;  5C9Z B;  4O45 A;  5EAR A;  2PM9 B;  3CFS B;  2OVQ B;  5EMJ B;  4XEI C;  3SVW D;  2IUR A;  3SLE D;  5CXB B;  5HQG A;  5JWZ A;  3L4O D;  2XL2 A;  5C2V B;  3JRO A;  5CYK A;  4FA1 D;  4A08 B;  5FKQ A;  2CE8 A;  4JSP C;  1SHY B;  3OKY A;  4FA5 D;  4GGD A;  2CO0 A;  3L4M D;  3IKO A;  2QC5 A;  2XU7 A;  1GP2 B;  4PSX B;  3UKR C;  3DSM A;  3MKS B;  5IJ7 E;  1L0Q A;  1N6E A;  3NVN A;  4J87 A;  3J80 g;  4QQE A;  4X3E A;  4JT5 C;  4GQ2 P;  2H47 A;  3ULE C;  5IC7 A;  4FA9 D;  3RRM C;  2I0T A;  2H6K A;  2H6Q A;  2W18 A;  3JAM g;  4E54 B;  3KRW B;  3NVQ A;  4JT6 C;  3CIK B;  4CY5 A;  4L9O A;  2AGX A;  3BWS A;  4J79 A;  5CXC A;  5GSA A;  1NEX B;  2YNP A;  5EML B;  4N14 A;  2EBS A;  2B5M A;  3VGZ A;  5THA A;  2UZY B;  3SWS D;  1OMW B;  2AGW A;  4CZV A;  3EG6 A;  3V9F A;  3IIY A;  4GQB B;  3OKW A;  2QXV A;  1U4C A;  3EI3 A;  4L3H D;  4FAN D;  3J81 g;  4A09 B;  1OLZ A;  3DWL C;  3OL2 A;  3ZWL B;  3UKU C;  2BBK H;  2I3T A;  4J86 A;  1FWX A;  4H5J A;  1MG2 A;  4FWW A;  4PXW A;  3SCY A;  3EI4 A;  4A11 A;  2YNO A;  2PBI B;  4L1Q D;  3HFQ A;  4GQ1 A;  3SJL D;  4GMB A;  4A0A B;  2CE9 A;  3ORV D;  5FLX g;  1SQJ A;  4AOW A;  2P9L C;  2AGZ A;  3MKQ A;  3SHF A;  4BL0 A;  5C2W B;  2GC7 A;  3RN0 D;  1PBY B;  2YB8 B;  3E0C A;  2XL3 A;  1ERJ A;  5I5J A;  4LG8 A;  1PEV A;  2O9K A;  4A2L A;  2Z2P A;  2AH1 A;  3JPX A;  4AEZ A;  4D0K A;  2P9P C;  4CY1 A;  1VYH C;  4XYI A;  5KDO B;  2MTA H;  2UZX B;  1S4U X;  3V5W B;  3I7K A;  3I7O A;  4CY3 A;  3PXT D;  3I8C A;  1JMZ B;  2J55 H;  3MMY A;  5SXM A;  3SBP A;  3EI1 A;  3VA6 A;  4E5Z B;  2GC4 A;  2I0R A;  3CFV A;  4ZOV A;  2YBA A;  3UVO A;  3PVU B;  4OZU A;  4X60 B;  3ODT A;  2HKR A;  2PM9 A;  3RFH A;  1A0R B;  3EU7 A;  4O3T B;  3RLM D;  3DXM C;  5CYK B;  5CXB A;  5AJA A;  5K1C C;  3K27 A;  1P22 A;  4CI2 A;  4YVD A;  1N6F A;  3SFZ A;  1TBG A;  2AGY A;  3EI2 A;  4JXM A;  5AFU 3;  4UI9 R;  3I7L A;  5FKR A;  5AMS A;  4QT8 A;  3GRE A;  2H9L A;  5EMM B;  1N6D A;  3IJ1 A;  4J73 A;  4FA4 D;  1U2V C;  2IWK A;  2BCJ B;  3RFG A;  2OK4 A;  2HKM A;  4GM3 A;  5TEE A;  4Z8L A;  4CY2 A;  4A0B A;  2PM6 B;  1B9Y A;  5EAL A;  2OIZ A;  4O3U B;  2YMU A;  3RN1 D;  3UVM A;  4E54 A;  5GXI A;  1K8K C;  2I3S A;  3PVW B;  2P9N C;  4I79 A;  2P9S C;  1JOF A;  2J57 G;  4G56 B;  1QNI A;  1NR0 A;  3I7H A;  3UVN A;  5IGQ A;  3UR4 A;  2OVR B;  3JRP A;  1JJU B;  4Y5R D;  5H17 A;  1GOT B;  2Z2O A;  3F3P A;  1XKS A;  1MDA H;  3A0F A;  5EM2 A;  4ES0 A;  1XHM A;  3OL2 B;  3V7D B;  2B5L A;  3JB9 L;  2OJY A;  2AH0 A;  5A2Q g;  3BG1 A;  2HES X;  3U4Y A;  2CN2 A;  4GM9 A;  4BH6 A;  4J81 A;  3DXK C;  1JMX B;  3BG0 A;  2H9N A;  3FM0 A;  2XYI A;  4J8B A;  3W15 A;  4A0A A;  4J78 A;  4ERQ A;  4JD2 C;  1Q47 A;  3I7P A;  2H13 A;  3C99 A;  4J82 A;  2H9M A;  4GM8 A;  2IUV A;  3P4F A;  1RI6 A;  2H68 A;  4X63 B;  3FRX A;  3OTT A;  4ZOY A;  4MK0 B;  2CNX A;  3JZN A;  4QRJ A;  5EMK B;  4J8G A;  4BUJ C;  3AL8 B;  1XIP A;  3PE7 A;  3SXT D;  3UVL A;  4JSN C;  4J77 A;  3EMH A;  4H5I A;  4CZX A;  2HYE A;  5GMK n;  4X61 B;  5IT9 g;  3OW8 A;  4PBY A;  4ERY A;  2YNN A;  3C5M A;  5TF2 A;  2IWF A;  4JSX C;  1TYQ C;  4D6V A;  4E5Z A;  4IMM A;  5FKT A;  4PC0 A;  3N0D A;  3GFC A;  3OKY B;  4A2M A;  4PBZ A;  5HYN B;  2B5N A;  4EWR A;  4A08 A;  1GXR A;  3K26 A;  3PSC B;  2H9P A;  4XYH A;  3OKT A;  4ZOX A;  4ZOZ A;  2G99 A;  4U1E I;  4Y7R A;  5HE2 B;  3C75 H;  2Q7Q A;  2IUQ A;  3EI2 B;  5GXH A;  4GGA A;  1B9X A;  5FXY A;  4ZN4 A;  4O1Q D;  2HJ4 A;  4CI1 A;  3PSL A; 
#chains in the Genus database with same CATH topology
 3RMZ D;  3B7F A;  4OWR A;  1MG3 A;  3I8E A;  1JTD B;  4U7A A;  2TRC B;  5I5I A;  2AQ5 A;  3N0E A;  3RSE C;  3VH0 A;  4CZY A;  3F3G A;  4J84 A;  4LGN A;  3V4V A;  4KFM B;  4ESG A;  4CI8 A;  3GD1 I;  3NVX A;  5EAP A;  4FB1 D;  4A0B B;  4FAV D;  5B4W A;  2VDR A;  3QHY B;  5CXC B;  5H14 A;  2VDL A;  5IGO A;  2VC2 A;  3I89 A;  2HU7 A;  4O9D A;  1JV2 A;  3AL9 A;  2OK6 A;  5FFG A;  3DM0 A;  2P9I C;  5K19 A;  4D9S A;  4RE6 A;  4NC4 A;  5I5M A;  1H2W A;  1GG2 B;  4CC9 A;  3EI3 B;  4K3J B;  3O4H A;  4CI3 A;  4WK2 A;  2IUP A;  3F3F A;  3KRX B;  3PXW D;  5FA5 B;  3PXS D;  3SN6 B;  3SBQ A;  4A09 A;  4O2W A;  5EM2 B;  2B4E A;  3EWE A;  1R5M A;  3EI4 B;  2OVP B;  3IUN A;  1K32 A;  4K3I D;  3AFC A;  4NEN A;  4J0W A;  4R7A B;  1H2Y A;  3I2N A;  4A11 B;  4FHL A;  2Z2N A;  4QL1 A;  2H14 A;  3SMR A;  4GZ8 A;  4JHN A;  1YFQ A;  2PM7 B;  5IJ8 E;  5HE3 B;  2I0S A;  4MMZ A;  5H1M A;  4NSX A;  3IJ0 A;  3MZK A;  2QZP A;  3I7N A;  2AGL A;  2CO0 C;  5TDH B;  1GOG A;  1SQ9 A;  4PNK B;  3JZH A;  2P9U C;  3IIW A;  3SBR A;  1QFM A;  3K71 A;  3AH8 B;  1C9I A;  4A7J A;  4PSW B;  5M5S A;  4IA9 A;  4GGC A;  1PGU A;  1VZ3 A;  2H3X A;  4JSV C;  3IJC A;  2P9K C;  5EAM A;  4LG9 A;  2IAA A;  5C92 A;  2GNQ A;  1E8N A;  2J56 H;  5HE0 B;  5TEF A;  2HJB A;  3MXX A;  3NIF A;  4ERZ A;  1T2X A;  3MZL A;  3DDU A;  5HE1 B;  1PI6 A;  4BCB A;  3C9C A;  4JHP C;  2G9A A;  3UVK A;  5FQD A;  3ZE0 A;  3EI1 B;  3JZG A;  4TZ4 A;  5FKS A;  4J0X A;  2CN3 A;  3FGB A;  3NIG A;  3QI0 A;  3AL8 A;  4HDJ A;  4L3G D;  2H6N A;  2JKX A;  2HXC A;  3IUL A;  3IUJ A;  2WQ8 A;  4O45 A;  2PM9 B;  5EAR A;  5C9Z B;  3CFS B;  5M5R A;  2OVQ B;  5EMJ B;  4XEI C;  3SVW D;  1A12 A;  2IUR A;  1UOQ A;  5CXB B;  3SLE D;  5M5V A;  5HQG A;  5JWZ A;  3L4O D;  1VZ2 A;  2XL2 A;  5C2V B;  3JRO A;  5CYK A;  4FA1 D;  2EIC A;  4A08 B;  5FKQ A;  1K3I A;  2CE8 A;  4JSP C;  1SHY B;  3OKY A;  4FA5 D;  3MUO A;  4GGD A;  3ZE2 A;  2CO0 A;  3L4M D;  3IKO A;  1O6F A;  2QC5 A;  4AMZ A;  1M1X A;  1GP2 B;  2XU7 A;  4PSX B;  3T3P A;  3UKR C;  3DSM A;  3MKS B;  5IJ7 E;  1L0Q A;  1N6E A;  3ZDZ A;  3NVN A;  3MUN A;  2VDO A;  5C86 A;  1C9L A;  4J87 A;  3J80 g;  4O02 A;  4NAA A;  4NBM A;  4QQE A;  4X3E A;  2HU5 A;  4JT5 C;  4GQ2 P;  2H47 A;  3ULE C;  5IC7 A;  4FA9 D;  3RRM C;  2I0T A;  2H6K A;  2H6Q A;  2W18 A;  3JAM g;  4AX4 A;  4E54 B;  1GOH A;  3KRW B;  3NVQ A;  4JT6 C;  1E5T A;  3CIK B;  3OF7 A;  4CY5 A;  4L9O A;  2AGX A;  3BWS A;  4J79 A;  5CXC A;  3FCU A;  5GSA A;  1NEX B;  2YNP A;  5EML B;  4N14 A;  4Z7N A;  2EBS A;  2B5M A;  3VGZ A;  5THA A;  2UZY B;  3SWS D;  1OMW B;  2AGW A;  4CZV A;  3EG6 A;  3V9F A;  4DNV A;  3IIY A;  4GQB B;  4G1E A;  1H2X A;  3OKW A;  3ZDX A;  2VZ3 A;  2QXV A;  4DNU A;  1U4C A;  3EI3 A;  4L3H D;  4FAN D;  3J81 g;  4A09 B;  1OLZ A;  3DWL C;  3OL2 A;  3ZWL B;  3UKU C;  2BBK H;  2I3T A;  4J86 A;  1FWX A;  1UTC A;  4H5J A;  1MG2 A;  4FWW A;  4PXW A;  3SCY A;  3EI4 A;  3K72 A;  4A11 A;  2YNO A;  2PBI B;  4L1Q D;  4WK4 A;  2BKL A;  3HFQ A;  1I2M B;  4GQ1 A;  3SJL D;  4GMB A;  4A0A B;  2CE9 A;  3ORV D;  2VDN A;  5FLX g;  4BP9 A;  1SQJ A;  4AOW A;  2P9L C;  4AN1 A;  2AGZ A;  3MKQ A;  3SHF A;  4BL0 A;  5C2W B;  2GC7 A;  3T3M A;  3RN0 D;  1PBY B;  1VE7 A;  2YB8 B;  3E0C A;  2XL3 A;  1ERJ A;  5I5J A;  4LG8 A;  3O4I A;  1PEV A;  2O9K A;  4A2L A;  2Z2P A;  4UM8 A;  1QFS A;  2AH1 A;  3JPX A;  4AEZ A;  4BP8 A;  4D0K A;  2P9P C;  4CY1 A;  1VYH C;  4DNW A;  3GC3 B;  4XYI A;  2VDM A;  5KDO B;  3IUM A;  2MTA H;  2UZX B;  1S4U X;  3V5W B;  4MMX A;  4Z7Q A;  3I7K A;  4BCC A;  3I7O A;  4CY3 A;  3PXT D;  3I8C A;  1JMZ B;  4MMY A;  2J55 H;  3MMY A;  3ZDY A;  5SXM A;  3SBP A;  3EI1 A;  3VA6 A;  3EQ7 A;  2EID A;  4E5Z B;  2GC4 A;  2I0R A;  1BPO A;  4RE5 A;  3CFV A;  4ZOV A;  2YBA A;  3UVO A;  3PVU B;  4OZU A;  4X60 B;  3ODT A;  2HKR A;  2PM9 A;  3RFH A;  3V4P A;  1A0R B;  3EU7 A;  4O3T B;  3RLM D;  3DXM C;  3EQ9 A;  5CYK B;  5CXB A;  3IUR A;  3KCI A;  5AJA A;  5K1C C;  3K27 A;  1P22 A;  4CI2 A;  4YVD A;  5E6R A;  1N6F A;  3SFZ A;  1TBG A;  2AGY A;  2VDQ A;  3EI2 A;  4JXM A;  5AFU 3;  3O4G A;  3ZE1 A;  4UI9 R;  3I7L A;  5FKR A;  1VE6 A;  5AMS A;  4QT8 A;  3GRE A;  2H9L A;  5EMM B;  1N6D A;  3IJ1 A;  4J73 A;  4FA4 D;  1U2V C;  4WJK A;  2IWK A;  2BCJ B;  4QAM A;  3RFG A;  2OK4 A;  2EIB A;  2HKM A;  4GM3 A;  5TEE A;  5FFO A;  4Z8L A;  4CY2 A;  2VDK A;  4A0B A;  3IUQ A;  2PM6 B;  1B9Y A;  5EAL A;  2OIZ A;  4O3U B;  2YMU A;  3RN1 D;  3UVM A;  1E8M A;  4E54 A;  2QR5 A;  5GXI A;  1K8K C;  2I3S A;  3PVW B;  2P9N C;  4I79 A;  2P9S C;  1JOF A;  2J57 G;  4G56 B;  1QNI A;  1NR0 A;  3I7H A;  1U8C A;  3UVN A;  4Z7O A;  5IGQ A;  3UR4 A;  2OVR B;  2XE4 A;  3JRP A;  1JJU B;  4Y5R D;  5H17 A;  3IJE A;  4BCD A;  1GOT B;  2Z2O A;  1GOF A;  4UM9 A;  3F3P A;  1XKS A;  3VI3 A;  1MDA H;  3A0F A;  5EM2 A;  4ES0 A;  1XHM A;  3OL2 B;  3V7D B;  5E6U A;  2XZG A;  2B5L A;  5M5T A;  3JB9 L;  2OJY A;  5M61 A;  2AH0 A;  5A2Q g;  5M5U A;  3BG1 A;  3EQ8 A;  2HES X;  3VI4 A;  3U4Y A;  2CN2 A;  4G1M A;  4GM9 A;  4BH6 A;  4J81 A;  3DXK C;  1JMX B;  3BG0 A;  5E6S A;  2H9N A;  3FM0 A;  2XYI A;  4J8B A;  3W15 A;  4A0A A;  4J78 A;  4ERQ A;  4JD2 C;  1Q47 A;  2VZ1 A;  3O4J A;  3I7P A;  3K6S A;  1YR2 A;  2H13 A;  3C99 A;  4J82 A;  2H9M A;  3IVM A;  3NID A;  4AMY A;  4GM8 A;  2EIE A;  2IUV A;  3P4F A;  1RI6 A;  2H68 A;  4X63 B;  2HU8 A;  3FRX A;  4WK0 A;  3OTT A;  4ZOY A;  4MK0 B;  2CNX A;  3JZN A;  4QRJ A;  5EMK B;  4J8G A;  2XDW A;  4BUJ C;  3AL8 B;  1XIP A;  3PE7 A;  3SXT D;  3UVL A;  4JSN C;  4J77 A;  3EMH A;  1UOO A;  4H5I A;  4CZX A;  1O6G A;  2HYE A;  5GMK n;  4X61 B;  2VDP A;  5IT9 g;  3OW8 A;  1H2Z A;  4PBY A;  4ERY A;  2YNN A;  3C5M A;  5TF2 A;  2IWF A;  4JSX C;  1TYQ C;  4D6V A;  4E5Z A;  3FCS A;  4IMM A;  5FKT A;  4PC0 A;  3N0D A;  1L5G A;  3GFC A;  3OKY B;  4A2M A;  4PBZ A;  5HYN B;  3MVD K;  2B5N A;  4EWR A;  4A08 A;  1GXR A;  4G55 A;  3K26 A;  3PSC B;  2H9P A;  4XYH A;  3OKT A;  4ZOX A;  4ZOZ A;  2G99 A;  4AN0 A;  4U1E I;  4Y7R A;  5HE2 B;  3C75 H;  2Q7Q A;  2IUQ A;  4L1M A;  3EI2 B;  5GXH A;  4GGA A;  1B9X A;  5FXY A;  4ZN4 A;  4O1Q D;  4IRZ A;  2HJ4 A;  4CI1 A;  1TYE A;  5HDB A;  3PSL A;  1UOP A; 
#chains in the Genus database with same CATH homology
 3RMZ D;  3B7F A;  4OWR A;  1MG3 A;  3I8E A;  4U7A A;  2TRC B;  5I5I A;  2AQ5 A;  3N0E A;  3RSE C;  3VH0 A;  4CZY A;  3F3G A;  4J84 A;  4LGN A;  4KFM B;  4ESG A;  4CI8 A;  3NVX A;  5EAP A;  4FB1 D;  4A0B B;  4FAV D;  5B4W A;  5CXC B;  5H14 A;  5IGO A;  3I89 A;  4O9D A;  3AL9 A;  2OK6 A;  3DM0 A;  2P9I C;  5K19 A;  5I5M A;  1GG2 B;  4CC9 A;  3EI3 B;  4K3J B;  4CI3 A;  2IUP A;  3F3F A;  3KRX B;  3PXW D;  5FA5 B;  3PXS D;  3SN6 B;  3SBQ A;  4A09 A;  5EM2 B;  2B4E A;  3EWE A;  1R5M A;  3EI4 B;  2OVP B;  4K3I D;  1K32 A;  4R7A B;  3AFC A;  4A11 B;  4J0W A;  3I2N A;  4FHL A;  2Z2N A;  4QL1 A;  2H14 A;  3SMR A;  4GZ8 A;  1YFQ A;  2PM7 B;  5IJ8 E;  5HE3 B;  2I0S A;  5H1M A;  4NSX A;  3IJ0 A;  3MZK A;  3I7N A;  2AGL A;  2CO0 C;  5TDH B;  1SQ9 A;  4PNK B;  3JZH A;  2P9U C;  3IIW A;  3SBR A;  3AH8 B;  4A7J A;  4PSW B;  4IA9 A;  4GGC A;  1PGU A;  2H3X A;  4JSV C;  3IJC A;  2P9K C;  5EAM A;  4LG9 A;  2IAA A;  2GNQ A;  2J56 H;  5HE0 B;  5TEF A;  2HJB A;  3MXX A;  4ERZ A;  3MZL A;  5HE1 B;  1PI6 A;  3C9C A;  2G9A A;  3UVK A;  5FQD A;  3EI1 B;  3JZG A;  4TZ4 A;  5FKS A;  4J0X A;  2CN3 A;  3FGB A;  3AL8 A;  4HDJ A;  4L3G D;  2H6N A;  2HXC A;  5C9Z B;  4O45 A;  5EAR A;  2PM9 B;  3CFS B;  2OVQ B;  5EMJ B;  4XEI C;  3SVW D;  2IUR A;  3SLE D;  5CXB B;  5HQG A;  5JWZ A;  3L4O D;  2XL2 A;  5C2V B;  3JRO A;  5CYK A;  4FA1 D;  4A08 B;  5FKQ A;  2CE8 A;  4JSP C;  1SHY B;  3OKY A;  4FA5 D;  4GGD A;  2CO0 A;  3L4M D;  3IKO A;  2QC5 A;  2XU7 A;  1GP2 B;  4PSX B;  3UKR C;  3DSM A;  3MKS B;  5IJ7 E;  1L0Q A;  1N6E A;  3NVN A;  4J87 A;  3J80 g;  4QQE A;  4X3E A;  4JT5 C;  4GQ2 P;  2H47 A;  3ULE C;  5IC7 A;  4FA9 D;  3RRM C;  2I0T A;  2H6K A;  2H6Q A;  2W18 A;  3JAM g;  4E54 B;  3KRW B;  3NVQ A;  4JT6 C;  3CIK B;  4CY5 A;  4L9O A;  2AGX A;  3BWS A;  4J79 A;  5CXC A;  5GSA A;  1NEX B;  2YNP A;  5EML B;  4N14 A;  2EBS A;  2B5M A;  3VGZ A;  5THA A;  2UZY B;  3SWS D;  1OMW B;  2AGW A;  4CZV A;  3EG6 A;  3V9F A;  3IIY A;  4GQB B;  3OKW A;  2QXV A;  1U4C A;  3EI3 A;  4L3H D;  4FAN D;  3J81 g;  4A09 B;  1OLZ A;  3DWL C;  3OL2 A;  3ZWL B;  3UKU C;  2BBK H;  2I3T A;  4J86 A;  1FWX A;  4H5J A;  1MG2 A;  4FWW A;  4PXW A;  3SCY A;  3EI4 A;  4A11 A;  2YNO A;  2PBI B;  4L1Q D;  3HFQ A;  4GQ1 A;  3SJL D;  4GMB A;  4A0A B;  2CE9 A;  3ORV D;  5FLX g;  1SQJ A;  4AOW A;  2P9L C;  2AGZ A;  3MKQ A;  3SHF A;  4BL0 A;  5C2W B;  2GC7 A;  3RN0 D;  1PBY B;  2YB8 B;  3E0C A;  2XL3 A;  1ERJ A;  5I5J A;  4LG8 A;  1PEV A;  2O9K A;  4A2L A;  2Z2P A;  2AH1 A;  3JPX A;  4AEZ A;  4D0K A;  2P9P C;  4CY1 A;  1VYH C;  4XYI A;  5KDO B;  2MTA H;  2UZX B;  1S4U X;  3V5W B;  3I7K A;  3I7O A;  4CY3 A;  3PXT D;  3I8C A;  1JMZ B;  2J55 H;  3MMY A;  5SXM A;  3SBP A;  3EI1 A;  3VA6 A;  4E5Z B;  2GC4 A;  2I0R A;  3CFV A;  4ZOV A;  2YBA A;  3UVO A;  3PVU B;  4OZU A;  4X60 B;  3ODT A;  2HKR A;  2PM9 A;  3RFH A;  1A0R B;  3EU7 A;  4O3T B;  3RLM D;  3DXM C;  5CYK B;  5CXB A;  5AJA A;  5K1C C;  3K27 A;  1P22 A;  4CI2 A;  4YVD A;  1N6F A;  3SFZ A;  1TBG A;  2AGY A;  3EI2 A;  4JXM A;  5AFU 3;  4UI9 R;  3I7L A;  5FKR A;  5AMS A;  4QT8 A;  3GRE A;  2H9L A;  5EMM B;  1N6D A;  3IJ1 A;  4J73 A;  4FA4 D;  1U2V C;  2IWK A;  2BCJ B;  3RFG A;  2OK4 A;  2HKM A;  4GM3 A;  5TEE A;  4Z8L A;  4CY2 A;  4A0B A;  2PM6 B;  1B9Y A;  5EAL A;  2OIZ A;  4O3U B;  2YMU A;  3RN1 D;  3UVM A;  4E54 A;  5GXI A;  1K8K C;  2I3S A;  3PVW B;  2P9N C;  4I79 A;  2P9S C;  1JOF A;  2J57 G;  4G56 B;  1QNI A;  1NR0 A;  3I7H A;  3UVN A;  5IGQ A;  3UR4 A;  2OVR B;  3JRP A;  1JJU B;  4Y5R D;  5H17 A;  1GOT B;  2Z2O A;  3F3P A;  1XKS A;  1MDA H;  3A0F A;  5EM2 A;  4ES0 A;  1XHM A;  3OL2 B;  3V7D B;  2B5L A;  3JB9 L;  2OJY A;  2AH0 A;  5A2Q g;  3BG1 A;  2HES X;  3U4Y A;  2CN2 A;  4GM9 A;  4BH6 A;  4J81 A;  3DXK C;  1JMX B;  3BG0 A;  2H9N A;  3FM0 A;  2XYI A;  4J8B A;  3W15 A;  4A0A A;  4J78 A;  4ERQ A;  4JD2 C;  1Q47 A;  3I7P A;  2H13 A;  3C99 A;  4J82 A;  2H9M A;  4GM8 A;  2IUV A;  3P4F A;  1RI6 A;  2H68 A;  4X63 B;  3FRX A;  3OTT A;  4ZOY A;  4MK0 B;  2CNX A;  3JZN A;  4QRJ A;  5EMK B;  4J8G A;  4BUJ C;  3AL8 B;  1XIP A;  3PE7 A;  3SXT D;  3UVL A;  4JSN C;  4J77 A;  3EMH A;  4H5I A;  4CZX A;  2HYE A;  5GMK n;  4X61 B;  5IT9 g;  3OW8 A;  4PBY A;  4ERY A;  2YNN A;  3C5M A;  5TF2 A;  2IWF A;  4JSX C;  1TYQ C;  4D6V A;  4E5Z A;  4IMM A;  5FKT A;  4PC0 A;  3N0D A;  3GFC A;  3OKY B;  4A2M A;  4PBZ A;  5HYN B;  2B5N A;  4EWR A;  4A08 A;  1GXR A;  3K26 A;  3PSC B;  2H9P A;  4XYH A;  3OKT A;  4ZOX A;  4ZOZ A;  2G99 A;  4U1E I;  4Y7R A;  5HE2 B;  3C75 H;  2Q7Q A;  2IUQ A;  3EI2 B;  5GXH A;  4GGA A;  1B9X A;  5FXY A;  4ZN4 A;  4O1Q D;  2HJ4 A;  4CI1 A;  3PSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...