5C9ZB

Crystal structure of prmt5:mep50 with epz015866 and sinefungin
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
313
structure length
313
Chain Sequence
EWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
publication title Crystal structure of PRMT5/MEP50 complex with sinefungin and 15866
rcsb
source organism Homo sapiens
total genus 81
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5c9zB00
3L4MD 3JZHA 3JROA 5FA5B 1VYHC 2H9NA 3SVWD 4O45A 4GQ1A 2H13A 2J56H 3SXTD 3UVNA 1GOTB 3PXWD 5FXYA 2XL2A 3N0DA 4A2LA 3EI4A 3SBQA 5TEEA 3I8CA 4K3ID 1N6FA 1GP2B 3EMHA 3PSCB 2IWFA 2AGXA 2P9PC 4GMBA 4J8GA 3NVXA 2B5LA 4LG9A 2H47A 2HXCA 2H14A 4E54A 4CY1A 4L1QD 5FKTA 4E5ZA 3AL9A 3SJLD 4GGCA 5K19A 2H3XA 4GM8A 1K8KC 3MKQA 3I7PA 5B4WA 4QQEA 4GM3A 4J87A 5HE3B 2PM9B 3SWSD 4CI8A 2UZYB 3K27A 3RMZD 4O3TB 2CN2A 3OKYA 4GGDA 4ZOZA 5H14A 5GSAA 4FHLA 3UKUC 5FKRA 5GXHA 3KRWB 5I5MA 2PM7B 5TEFA 2YNOA 3PVUB 3FGBA 2W18A 1JOFA 4L9OA 3EU7A 4GGAA 2YNPA 4BUJC 3AFCA 4X3EA 2OK4A 2GC7A 1NEXB 4IA9A 5I5IA 4O1QD 5TDHB 4A11B 5FLXg 2HKMA 2O9KA 3BWSA 5IGOA 4FAND 3RFHA 3DXMC 2HJ4A 4R7AB 5FKQA 3MXXA 4ZOYA 4A09A 4X61B 4PBZA 1MG3A 4FA4D 3VGZA 1XIPA 4YVDA 4J8BA 2AH1A 4L3HD 3MZKA 5TF2A 2YB8B 3BG1A 1MDAH 2OVPB 4A08A 2IUPA 3ZWLB 3JB9L 4A0AB 1QNIA 3OL2B 1NR0A 3GFCA 4L3GD 3EI1B 4FAVD 4QL1A 5EMMB 5EARA 5K1CC 2HJBA 5EMLB 5IJ8E 3I89A 4A11A 3SBRA 1MG2A 5IT9g 3I7NA 1N6EA 1B9YA 3F3GA 4O9DA 5JWZA 2HKRA 3SCYA 3SLED 2AGLA 2H68A 2CE8A 2CE9A 2TRCB 3EI3B 2B5MA 2HESX 3BG0A 2BBKH 3I8EA 3FRXA 4Y7RA 4O3UB 2P9NC 4JSVC 3I7OA 3PXSD 3DSMA 3OL2A 5CXCA 4ERYA 1JMXB 2I0TA 3EI1A 3CFVA 2YNNA 5SXMA 4UI9R 1PEVA 3C5MA 3OTTA 4PSWB 5FKSA 1B9XA 4BH6A 2CO0A 3IKOA 4CZYA 4U7AA 4ESGA 3F3PA 4QRJA 3J80g 1PGUA 4GZ8A 5I5JA 5GXIA 4FA1D 1U4CA 2G9AA 4H5JA 5H1MA 3DXKC 3UR4A 4PXWA 5EALA 4D0KA 3SFZA 3AH8B 4D6VA 4JSNC 4CI2A 3E0CA 3J81g 4Y5RD 4FB1D 2H6KA 2GNQA 4MK0B 3V5WB 2CN3A 1ERJA 3KRXB 5GMKn 4XEIC 4LG8A 4ZOVA 3RN1D 1TBGA 2G99A 2PM6B 3P4FA 1RI6A 3EI2B 2Q7QA 1XKSA 3C75H 4JSXC 4I79A 4JD2C 5THAA 1XHMA 4CZVA 3JRPA 1SHYB 2IWKA 2QC5A 3AL8B 4JT5C 3NVQA 3W15A 2IUVA 3I7HA 5IJ7E 1A0RB 4FA9D 3RRMC 2PM9A 3I7LA 3JZGA 4J0XA 1K32A 4NSXA 5EAPA 3SN6B 2OVRB 3F3FA 3UVLA 4CI3A 3ODTA 2OK6A 3JZNA 2H9LA 2P9KC 4CY3A 5EMKB 2I3SA 4OWRA 4XYHA 5HE2B 2IUQA 3EI2A 2XYIA 4EWRA 1JJUB 3OKWA 2PBIB 2Z2OA 5AFU3 4J81A 5C2VB 4LGNA 1TYQC 3AL8A 3RFGA 1GG2B 3C99A 4CI1A 1GXRA 5EAMA 2Z2PA 3V7DB 2P9IC 1PBYB 4BL0A 1SQJA 4J77A 1S4UX 1JMZB 4CC9A 4AOWA 2OJYA 4J73A 4OZUA 2OIZA 4ES0A 4Z8LA 3RSEC 2OVQB 3SMRA 2IAAA 5IGQA 4J0WA 5AJAA 3DM0A 4XYIA 3PSLA 3RN0D 3VH0A 4E54B 2P9LC 4N14A 3IIYA 4A0BB 4E5ZB 4CY2A 4JT6C 2AQ5A 1N6DA 2J57G 4U1EI 4PSXB 4A0AA 3PXTD 2AGZA 3SHFA 2H6QA 3UVMA 4JSPC 5KDOB 2AGYA 1OMWB 4PBYA 4A7JA 1L0QA 3OKYB 5HE0B 2HYEA 3VA6A 3OKTA 4J82A 4G56B 5HQGA 3MKSB 2BCJB 2QXVA 3L4OD 2AH0A 5AMSA 3EI3A 2J55H 2XL3A 3K26A 3EWEA 3PVWB 4A0BA 3ORVD 3IJ1A 1FWXA 4J86A 5HYNB 2UZXB 1P22A 4FWWA 2H9PA 1YFQA 3JAMg 3NVNA 4A09B 5EM2B 3JPXA 3MMYA 4H5IA 3RLMD 4ZOXA 2EBSA 3DWLC 3IJ0A 3MZLA 4TZ4A 5A2Qg 4QT8A 2B4EA 2YBAA 3V9FA 2H6NA 4GQ2P 4ZN4A 4A08B 3IJCA 4J84A 3EG6A 4J78A 2YMUA 5IC7A 3I7KA 3B7FA 2CNXA 1Q47A 4CZXA 2MTAH 5HE1B 5C9ZB 2Z2NA 2XU7A 5CXBB 5FQDA 1U2VC 5CYKB 3N0EA 3GREA 2P9SC 3ULEC 5H17A 4GQBB 3UVOA 4JXMA 5C2WB 2I3TA 1PI6A 2P9UC 4AEZA 4ERQA 5EM2A 4X63B 4J79A 2I0RA 4GM9A 4ERZA 1OLZA 3UVKA 3EI4B 1R5MA 3I2NA 3UKRC 3SBPA 4PC0A 2I0SA 4K3JB 2IURA 3CIKB 4PNKB 2AGWA 2GC4A 3HFQA 3OW8A 4HDJA 4IMMA 4KFMB 3CFSB 3U4YA 2H9MA 3C9CA 5CXCB 1SQ9A 4FA5D 4X60B 5CXBA 5CYKA 3A0FA 3IIWA 4CY5A 4A2MA 2B5NA 2CO0C 3PE7A 3FM0A 5EMJB
chains in the Genus database with same CATH superfamily
3KCIA 3L4MD 3JZHA 3JROA 5FA5B 1VYHC 2H9NA 3SVWD 4O45A 4GQ1A 2H13A 2J56H 3SXTD 3UVNA 2JKXA 1GOTB 3PXWD 2WQ8A 5FXYA 2XL2A 3N0DA 4A2LA 3EI4A 2VDLA 4NC4A 4UM8A 3SBQA 5TEEA 1VZ2A 3O4HA 1GOGA 3I8CA 4K3ID 3O4JA 5HDBA 1N6FA 1GP2B 1JV2A 3EMHA 3PSCB 4NBMA 2IWFA 2AGXA 2P9PC 4GMBA 3T3PA 4WK4A 4Z7NA 4J8GA 3NVXA 1TYEA 2B5LA 4O02A 4LG9A 2H47A 2HXCA 4UM9A 2H14A 4E54A 2VDKA 4CY1A 1VE6A 4L1QD 5FKTA 4E5ZA 4DNVA 3AL9A 3SJLD 4GGCA 2XDWA 5K19A 2H3XA 4GM8A 1K8KC 3MKQA 1E8MA 3I7PA 5B4WA 4RE6A 3FCSA 4QQEA 4GM3A 5M5RA 4JHNA 4J87A 5HE3B 2PM9B 3SWSD 4CI8A 2UZYB 3K27A 3RMZD 4O3TB 2CN2A 3GC3B 3IURA 3OKYA 4GGDA 4ZOZA 5H14A 5GSAA 4FHLA 3UKUC 5FKRA 5GXHA 3KRWB 4L1MA 5I5MA 2PM7B 5TEFA 3EQ8A 5M5SA 2YNOA 3PVUB 3FGBA 2W18A 4DNUA 1JOFA 3K72A 4L9OA 3O4IA 3EU7A 4GGAA 2YNPA 4BUJC 3AFCA 4X3EA 2OK4A 2GC7A 1NEXB 4IA9A 5I5IA 4O1QD 5TDHB 5FFOA 4A11B 5FLXg 2HKMA 2O9KA 3BWSA 5IGOA 2BKLA 4FAND 3RFHA 4BP8A 5C92A 3DXMC 4JHPC 5C86A 2HJ4A 1H2ZA 4R7AB 5FKQA 3MXXA 4ZOYA 4A09A 4DNWA 2VDPA 4X61B 4PBZA 1MG3A 1QFMA 4FA4D 3VGZA 1XIPA 3VI3A 3EQ7A 4YVDA 4J8BA 2AH1A 3MZKA 4L3HD 3ZDYA 5TF2A 2YB8B 3BG1A 1MDAH 2OVPB 4A08A 2IUPA 3ZDXA 1O6FA 4G1EA 3ZWLB 3QHYB 3JB9L 1U8CA 4A0AB 1QNIA 4G1MA 3OL2B 1NR0A 3GFCA 4L3GD 3EI1B 4FAVD 4QL1A 5EMMB 5EARA 3O4GA 5K1CC 3K6SA 2HJBA 4WJKA 5EMLB 3I89A 1C9LA 4A11A 3SBRA 5IJ8E 4BCCA 1MG2A 5IT9g 3I7NA 1N6EA 1B9YA 3F3GA 4O9DA 5JWZA 4D9SA 2HKRA 3SCYA 3SLED 2AGLA 2H68A 4G55A 2VDRA 2CE8A 2CE9A 2TRCB 3EI3B 2B5MA 2HESX 4AX4A 1K3IA 3BG0A 2BBKH 3I8EA 2XZGA 4AMYA 3FRXA 5M5UA 4Y7RA 4O3UB 2P9NC 1UOOA 4JSVC 3I7OA 3PXSD 1H2XA 3DSMA 3OL2A 5CXCA 4ERYA 1JMXB 2I0TA 3EI1A 3CFVA 2YNNA 5SXMA 4UI9R 1PEVA 3C5MA 3OTTA 4PSWB 5FKSA 3GD1I 3IVMA 1B9XA 2EIEA 4BH6A 2CO0A 3IKOA 2QZPA 4CZYA 4U7AA 4ESGA 3F3PA 4QRJA 3J80g 1PGUA 4GZ8A 5I5JA 3MVDK 5GXIA 2VZ3A 4FA1D 1U4CA 2G9AA 4H5JA 5H1MA 3DXKC 3UR4A 3EQ9A 4PXWA 5EALA 3FCUA 4D0KA 3SFZA 1QFSA 3AH8B 4D6VA 4JSNC 4CI2A 4AN1A 5E6SA 3E0CA 3J81g 4Y5RD 4FB1D 2H6KA 2GNQA 4MK0B 3V5WB 2CN3A 1GOHA 1ERJA 3KRXB 5GMKn 4XEIC 4LG8A 4ZOVA 5M61A 3RN1D 1TBGA 2G99A 2PM6B 4NAAA 3P4FA 2EIBA 1RI6A 3EI2B 2Q7QA 1XKSA 3C75H 1I2MB 4JSXC 4I79A 4JD2C 5THAA 1UOPA 4WK0A 1XHMA 4CZVA 3JRPA 1SHYB 2IWKA 2QC5A 3AL8B 5E6UA 4JT5C 3NVQA 3OF7A 3W15A 2IUVA 3I7HA 5IJ7E 1A0RB 3IJEA 4FA9D 3RRMC 2PM9A 2VDMA 3I7LA 3JZGA 4J0XA 1K32A 4NSXA 5EAPA 3SN6B 2OVRB 1UOQA 3F3FA 3UVLA 4CI3A 3ODTA 2OK6A 3JZNA 2H9LA 2P9KC 4RE5A 5EMKB 2I3SA 4OWRA 4CY3A 4XYHA 5HE2B 2IUQA 3EI2A 2XYIA 4EWRA 1JJUB 3NIGA 3OKWA 2PBIB 2Z2OA 5M5VA 5AFU3 4J81A 5C2VB 4LGNA 1TYQC 3AL8A 3RFGA 1GG2B 3C99A 1H2YA 4CI1A 2XE4A 1GXRA 5EAMA 2Z2PA 3V7DB 2P9IC 2VDOA 1PBYB 4MMXA 4BL0A 1L5GA 1SQJA 4J77A 4QAMA 1S4UX 1JMZB 4CC9A 4AOWA 2OJYA 4J73A 4Z7OA 5M5TA 4OZUA 2OIZA 4ES0A 4Z8LA 3RSEC 2OVQB 1A12A 3SMRA 2IAAA 5FFGA 4J0WA 5IGQA 5AJAA 3DM0A 4XYIA 1T2XA 2HU5A 3PSLA 3RN0D 3T3MA 3VH0A 4E54B 2P9LC 4N14A 3IIYA 4AN0A 4A0BB 3K71A 4E5ZB 2HU8A 4CY2A 4JT6C 3VI4A 1E8NA 2AQ5A 1N6DA 2J57G 3QI0A 4BCDA 4BP9A 4U1EI 4PSXB 4A0AA 3PXTD 2AGZA 3IULA 3SHFA 2H6QA 3UVMA 4JSPC 5KDOB 2AGYA 1OMWB 4PBYA 2EICA 4A7JA 1L0QA 1VZ3A 3OKYB 5HE0B 2HYEA 2VZ1A 3VA6A 3OKTA 4J82A 3IUQA 1JTDB 1VE7A 3MKSB 4G56B 2BCJB 4O2WA 5HQGA 2QXVA 3L4OD 2AH0A 4BCBA 5AMSA 3ZE1A 3DDUA 3EI3A 3V4VA 2J55H 2EIDA 2VDQA 2XL3A 3K26A 3EWEA 3PVWB 4A0BA 3ORVD 3IJ1A 1FWXA 4J86A 3ZDZA 1C9IA 5HYNB 1UTCA 3MUOA 2UZXB 1P22A 2VC2A 3ZE0A 4FWWA 4AMZA 2H9PA 1YFQA 4NENA 2HU7A 3JAMg 3NVNA 4A09B 3MUNA 5EM2B 3JPXA 3MMYA 4H5IA 3RLMD 4ZOXA 2EBSA 3DWLC 3IJ0A 3MZLA 4TZ4A 5A2Qg 4QT8A 2B4EA 2YBAA 3V9FA 3NIFA 2H6NA 4GQ2P 1GOFA 4ZN4A 4A08B 3IJCA 4MMYA 4J84A 3EG6A 4J78A 2YMUA 5IC7A 3I7KA 2QR5A 3B7FA 1Q47A 2CNXA 4CZXA 2MTAH 5HE1B 5C9ZB 2Z2NA 2XU7A 5CXBB 5FQDA 1U2VC 5CYKB 3N0EA 3GREA 2P9SC 3ULEC 5H17A 4GQBB 3UVOA 1M1XA 4JXMA 5C2WB 2I3TA 1H2WA 1PI6A 2P9UC 3IUNA 4AEZA 3IUMA 3NIDA 4ERQA 2VDNA 5EM2A 4WK2A 5E6RA 4MMZA 4X63B 4J79A 2I0RA 4GM9A 4ERZA 1E5TA 1OLZA 3UVKA 3EI4B 1R5MA 4IRZA 3I2NA 3UKRC 3SBPA 4PC0A 2I0SA 4K3JB 2IURA 3CIKB 4PNKB 2AGWA 2GC4A 3HFQA 3IUJA 3OW8A 4Z7QA 4HDJA 4IMMA 4KFMB 3CFSB 3U4YA 1BPOA 2H9MA 3C9CA 5CXCB 3V4PA 1O6GA 1SQ9A 4FA5D 4X60B 5CXBA 5CYKA 3A0FA 3IIWA 4CY5A 4A2MA 2B5NA 2CO0C 3PE7A 3FM0A 1YR2A 5EMJB 3ZE2A
chains in the Genus database with same CATH topology
3L4MD 3JZHA 3JROA 5FA5B 1VYHC 2H9NA 3SVWD 4O45A 4GQ1A 2H13A 2J56H 3SXTD 3UVNA 1GOTB 3PXWD 5FXYA 2XL2A 3N0DA 4A2LA 3EI4A 3SBQA 5TEEA 3I8CA 4K3ID 1N6FA 1GP2B 3EMHA 3PSCB 2IWFA 2AGXA 2P9PC 4GMBA 4J8GA 3NVXA 2B5LA 4LG9A 2H47A 2HXCA 2H14A 4E54A 4CY1A 4L1QD 5FKTA 4E5ZA 3AL9A 3SJLD 4GGCA 5K19A 2H3XA 4GM8A 1K8KC 3MKQA 3I7PA 5B4WA 4QQEA 4GM3A 4J87A 5HE3B 2PM9B 3SWSD 4CI8A 2UZYB 3K27A 3RMZD 4O3TB 2CN2A 3OKYA 4GGDA 4ZOZA 5H14A 5GSAA 4FHLA 3UKUC 5FKRA 5GXHA 3KRWB 5I5MA 2PM7B 5TEFA 2YNOA 3PVUB 3FGBA 2W18A 1JOFA 4L9OA 3EU7A 4GGAA 2YNPA 4BUJC 3AFCA 4X3EA 2OK4A 2GC7A 1NEXB 4IA9A 5I5IA 4O1QD 5TDHB 4A11B 5FLXg 2HKMA 2O9KA 3BWSA 5IGOA 4FAND 3RFHA 3DXMC 2HJ4A 4R7AB 5FKQA 3MXXA 4ZOYA 4A09A 4X61B 4PBZA 1MG3A 4FA4D 3VGZA 1XIPA 4YVDA 4J8BA 2AH1A 4L3HD 3MZKA 5TF2A 2YB8B 3BG1A 1MDAH 2OVPB 4A08A 2IUPA 3ZWLB 3JB9L 4A0AB 1QNIA 3OL2B 1NR0A 3GFCA 4L3GD 3EI1B 4FAVD 4QL1A 5EMMB 5EARA 5K1CC 2HJBA 5EMLB 5IJ8E 3I89A 4A11A 3SBRA 1MG2A 5IT9g 3I7NA 1N6EA 1B9YA 3F3GA 4O9DA 5JWZA 2HKRA 3SCYA 3SLED 2AGLA 2H68A 2CE8A 2CE9A 2TRCB 3EI3B 2B5MA 2HESX 3BG0A 2BBKH 3I8EA 3FRXA 4Y7RA 4O3UB 2P9NC 4JSVC 3I7OA 3PXSD 3DSMA 3OL2A 5CXCA 4ERYA 1JMXB 2I0TA 3EI1A 3CFVA 2YNNA 5SXMA 4UI9R 1PEVA 3C5MA 3OTTA 4PSWB 5FKSA 1B9XA 4BH6A 2CO0A 3IKOA 4CZYA 4U7AA 4ESGA 3F3PA 4QRJA 3J80g 1PGUA 4GZ8A 5I5JA 5GXIA 4FA1D 1U4CA 2G9AA 4H5JA 5H1MA 3DXKC 3UR4A 4PXWA 5EALA 4D0KA 3SFZA 3AH8B 4D6VA 4JSNC 4CI2A 3E0CA 3J81g 4Y5RD 4FB1D 2H6KA 2GNQA 4MK0B 3V5WB 2CN3A 1ERJA 3KRXB 5GMKn 4XEIC 4LG8A 4ZOVA 3RN1D 1TBGA 2G99A 2PM6B 3P4FA 1RI6A 3EI2B 2Q7QA 1XKSA 3C75H 4JSXC 4I79A 4JD2C 5THAA 1XHMA 4CZVA 3JRPA 1SHYB 2IWKA 2QC5A 3AL8B 4JT5C 3NVQA 3W15A 2IUVA 3I7HA 5IJ7E 1A0RB 4FA9D 3RRMC 2PM9A 3I7LA 3JZGA 4J0XA 1K32A 4NSXA 5EAPA 3SN6B 2OVRB 3F3FA 3UVLA 4CI3A 3ODTA 2OK6A 3JZNA 2H9LA 2P9KC 4CY3A 5EMKB 2I3SA 4OWRA 4XYHA 5HE2B 2IUQA 3EI2A 2XYIA 4EWRA 1JJUB 3OKWA 2PBIB 2Z2OA 5AFU3 4J81A 5C2VB 4LGNA 1TYQC 3AL8A 3RFGA 1GG2B 3C99A 4CI1A 1GXRA 5EAMA 2Z2PA 3V7DB 2P9IC 1PBYB 4BL0A 1SQJA 4J77A 1S4UX 1JMZB 4CC9A 4AOWA 2OJYA 4J73A 4OZUA 2OIZA 4ES0A 4Z8LA 3RSEC 2OVQB 3SMRA 2IAAA 5IGQA 4J0WA 5AJAA 3DM0A 4XYIA 3PSLA 3RN0D 3VH0A 4E54B 2P9LC 4N14A 3IIYA 4A0BB 4E5ZB 4CY2A 4JT6C 2AQ5A 1N6DA 2J57G 4U1EI 4PSXB 4A0AA 3PXTD 2AGZA 3SHFA 2H6QA 3UVMA 4JSPC 5KDOB 2AGYA 1OMWB 4PBYA 4A7JA 1L0QA 3OKYB 5HE0B 2HYEA 3VA6A 3OKTA 4J82A 4G56B 5HQGA 3MKSB 2BCJB 2QXVA 3L4OD 2AH0A 5AMSA 3EI3A 2J55H 2XL3A 3K26A 3EWEA 3PVWB 4A0BA 3ORVD 3IJ1A 1FWXA 4J86A 5HYNB 2UZXB 1P22A 4FWWA 2H9PA 1YFQA 3JAMg 3NVNA 4A09B 5EM2B 3JPXA 3MMYA 4H5IA 3RLMD 4ZOXA 2EBSA 3DWLC 3IJ0A 3MZLA 4TZ4A 5A2Qg 4QT8A 2B4EA 2YBAA 3V9FA 2H6NA 4GQ2P 4ZN4A 4A08B 3IJCA 4J84A 3EG6A 4J78A 2YMUA 5IC7A 3I7KA 3B7FA 2CNXA 1Q47A 4CZXA 2MTAH 5HE1B 5C9ZB 2Z2NA 2XU7A 5CXBB 5FQDA 1U2VC 5CYKB 3N0EA 3GREA 2P9SC 3ULEC 5H17A 4GQBB 3UVOA 4JXMA 5C2WB 2I3TA 1PI6A 2P9UC 4AEZA 4ERQA 5EM2A 4X63B 4J79A 2I0RA 4GM9A 4ERZA 1OLZA 3UVKA 3EI4B 1R5MA 3I2NA 3UKRC 3SBPA 4PC0A 2I0SA 4K3JB 2IURA 3CIKB 4PNKB 2AGWA 2GC4A 3HFQA 3OW8A 4HDJA 4IMMA 4KFMB 3CFSB 3U4YA 2H9MA 3C9CA 5CXCB 1SQ9A 4FA5D 4X60B 5CXBA 5CYKA 3A0FA 3IIWA 4CY5A 4A2MA 2B5NA 2CO0C 3PE7A 3FM0A 5EMJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4M D;  3JZH A;  3JRO A;  5FA5 B;  1VYH C;  2H9N A;  3SVW D;  4O45 A;  4GQ1 A;  2H13 A;  2J56 H;  3SXT D;  3UVN A;  1GOT B;  3PXW D;  5FXY A;  2XL2 A;  3N0D A;  4A2L A;  3EI4 A;  3SBQ A;  5TEE A;  3I8C A;  4K3I D;  1N6F A;  1GP2 B;  3EMH A;  3PSC B;  2IWF A;  2AGX A;  2P9P C;  4GMB A;  4J8G A;  3NVX A;  2B5L A;  4LG9 A;  2H47 A;  2HXC A;  2H14 A;  4E54 A;  4CY1 A;  4L1Q D;  5FKT A;  4E5Z A;  3AL9 A;  3SJL D;  4GGC A;  5K19 A;  2H3X A;  4GM8 A;  1K8K C;  3MKQ A;  3I7P A;  5B4W A;  4QQE A;  4GM3 A;  4J87 A;  5HE3 B;  2PM9 B;  3SWS D;  4CI8 A;  2UZY B;  3K27 A;  3RMZ D;  4O3T B;  2CN2 A;  3OKY A;  4GGD A;  4ZOZ A;  5H14 A;  5GSA A;  4FHL A;  3UKU C;  5FKR A;  5GXH A;  3KRW B;  5I5M A;  2PM7 B;  5TEF A;  2YNO A;  3PVU B;  3FGB A;  2W18 A;  1JOF A;  4L9O A;  3EU7 A;  4GGA A;  2YNP A;  4BUJ C;  3AFC A;  4X3E A;  2OK4 A;  2GC7 A;  1NEX B;  4IA9 A;  5I5I A;  4O1Q D;  5TDH B;  4A11 B;  5FLX g;  2HKM A;  2O9K A;  3BWS A;  5IGO A;  4FAN D;  3RFH A;  3DXM C;  2HJ4 A;  4R7A B;  5FKQ A;  3MXX A;  4ZOY A;  4A09 A;  4X61 B;  4PBZ A;  1MG3 A;  4FA4 D;  3VGZ A;  1XIP A;  4YVD A;  4J8B A;  2AH1 A;  4L3H D;  3MZK A;  5TF2 A;  2YB8 B;  3BG1 A;  1MDA H;  2OVP B;  4A08 A;  2IUP A;  3ZWL B;  3JB9 L;  4A0A B;  1QNI A;  3OL2 B;  1NR0 A;  3GFC A;  4L3G D;  3EI1 B;  4FAV D;  4QL1 A;  5EMM B;  5EAR A;  5K1C C;  2HJB A;  5EML B;  5IJ8 E;  3I89 A;  4A11 A;  3SBR A;  1MG2 A;  5IT9 g;  3I7N A;  1N6E A;  1B9Y A;  3F3G A;  4O9D A;  5JWZ A;  2HKR A;  3SCY A;  3SLE D;  2AGL A;  2H68 A;  2CE8 A;  2CE9 A;  2TRC B;  3EI3 B;  2B5M A;  2HES X;  3BG0 A;  2BBK H;  3I8E A;  3FRX A;  4Y7R A;  4O3U B;  2P9N C;  4JSV C;  3I7O A;  3PXS D;  3DSM A;  3OL2 A;  5CXC A;  4ERY A;  1JMX B;  2I0T A;  3EI1 A;  3CFV A;  2YNN A;  5SXM A;  4UI9 R;  1PEV A;  3C5M A;  3OTT A;  4PSW B;  5FKS A;  1B9X A;  4BH6 A;  2CO0 A;  3IKO A;  4CZY A;  4U7A A;  4ESG A;  3F3P A;  4QRJ A;  3J80 g;  1PGU A;  4GZ8 A;  5I5J A;  5GXI A;  4FA1 D;  1U4C A;  2G9A A;  4H5J A;  5H1M A;  3DXK C;  3UR4 A;  4PXW A;  5EAL A;  4D0K A;  3SFZ A;  3AH8 B;  4D6V A;  4JSN C;  4CI2 A;  3E0C A;  3J81 g;  4Y5R D;  4FB1 D;  2H6K A;  2GNQ A;  4MK0 B;  3V5W B;  2CN3 A;  1ERJ A;  3KRX B;  5GMK n;  4XEI C;  4LG8 A;  4ZOV A;  3RN1 D;  1TBG A;  2G99 A;  2PM6 B;  3P4F A;  1RI6 A;  3EI2 B;  2Q7Q A;  1XKS A;  3C75 H;  4JSX C;  4I79 A;  4JD2 C;  5THA A;  1XHM A;  4CZV A;  3JRP A;  1SHY B;  2IWK A;  2QC5 A;  3AL8 B;  4JT5 C;  3NVQ A;  3W15 A;  2IUV A;  3I7H A;  5IJ7 E;  1A0R B;  4FA9 D;  3RRM C;  2PM9 A;  3I7L A;  3JZG A;  4J0X A;  1K32 A;  4NSX A;  5EAP A;  3SN6 B;  2OVR B;  3F3F A;  3UVL A;  4CI3 A;  3ODT A;  2OK6 A;  3JZN A;  2H9L A;  2P9K C;  4CY3 A;  5EMK B;  2I3S A;  4OWR A;  4XYH A;  5HE2 B;  2IUQ A;  3EI2 A;  2XYI A;  4EWR A;  1JJU B;  3OKW A;  2PBI B;  2Z2O A;  5AFU 3;  4J81 A;  5C2V B;  4LGN A;  1TYQ C;  3AL8 A;  3RFG A;  1GG2 B;  3C99 A;  4CI1 A;  1GXR A;  5EAM A;  2Z2P A;  3V7D B;  2P9I C;  1PBY B;  4BL0 A;  1SQJ A;  4J77 A;  1S4U X;  1JMZ B;  4CC9 A;  4AOW A;  2OJY A;  4J73 A;  4OZU A;  2OIZ A;  4ES0 A;  4Z8L A;  3RSE C;  2OVQ B;  3SMR A;  2IAA A;  5IGQ A;  4J0W A;  5AJA A;  3DM0 A;  4XYI A;  3PSL A;  3RN0 D;  3VH0 A;  4E54 B;  2P9L C;  4N14 A;  3IIY A;  4A0B B;  4E5Z B;  4CY2 A;  4JT6 C;  2AQ5 A;  1N6D A;  2J57 G;  4U1E I;  4PSX B;  4A0A A;  3PXT D;  2AGZ A;  3SHF A;  2H6Q A;  3UVM A;  4JSP C;  5KDO B;  2AGY A;  1OMW B;  4PBY A;  4A7J A;  1L0Q A;  3OKY B;  5HE0 B;  2HYE A;  3VA6 A;  3OKT A;  4J82 A;  4G56 B;  5HQG A;  3MKS B;  2BCJ B;  2QXV A;  3L4O D;  2AH0 A;  5AMS A;  3EI3 A;  2J55 H;  2XL3 A;  3K26 A;  3EWE A;  3PVW B;  4A0B A;  3ORV D;  3IJ1 A;  1FWX A;  4J86 A;  5HYN B;  2UZX B;  1P22 A;  4FWW A;  2H9P A;  1YFQ A;  3JAM g;  3NVN A;  4A09 B;  5EM2 B;  3JPX A;  3MMY A;  4H5I A;  3RLM D;  4ZOX A;  2EBS A;  3DWL C;  3IJ0 A;  3MZL A;  4TZ4 A;  5A2Q g;  4QT8 A;  2B4E A;  2YBA A;  3V9F A;  2H6N A;  4GQ2 P;  4ZN4 A;  4A08 B;  3IJC A;  4J84 A;  3EG6 A;  4J78 A;  2YMU A;  5IC7 A;  3I7K A;  3B7F A;  2CNX A;  1Q47 A;  4CZX A;  2MTA H;  5HE1 B;  5C9Z B;  2Z2N A;  2XU7 A;  5CXB B;  5FQD A;  1U2V C;  5CYK B;  3N0E A;  3GRE A;  2P9S C;  3ULE C;  5H17 A;  4GQB B;  3UVO A;  4JXM A;  5C2W B;  2I3T A;  1PI6 A;  2P9U C;  4AEZ A;  4ERQ A;  5EM2 A;  4X63 B;  4J79 A;  2I0R A;  4GM9 A;  4ERZ A;  1OLZ A;  3UVK A;  3EI4 B;  1R5M A;  3I2N A;  3UKR C;  3SBP A;  4PC0 A;  2I0S A;  4K3J B;  2IUR A;  3CIK B;  4PNK B;  2AGW A;  2GC4 A;  3HFQ A;  3OW8 A;  4HDJ A;  4IMM A;  4KFM B;  3CFS B;  3U4Y A;  2H9M A;  3C9C A;  5CXC B;  1SQ9 A;  4FA5 D;  4X60 B;  5CXB A;  5CYK A;  3A0F A;  3IIW A;  4CY5 A;  4A2M A;  2B5N A;  2CO0 C;  3PE7 A;  3FM0 A;  5EMJ B; 
#chains in the Genus database with same CATH topology
 3KCI A;  3L4M D;  3JZH A;  3JRO A;  5FA5 B;  1VYH C;  2H9N A;  3SVW D;  4O45 A;  4GQ1 A;  2H13 A;  2J56 H;  3SXT D;  3UVN A;  2JKX A;  1GOT B;  3PXW D;  2WQ8 A;  5FXY A;  2XL2 A;  3N0D A;  4A2L A;  3EI4 A;  2VDL A;  4NC4 A;  4UM8 A;  3SBQ A;  5TEE A;  1VZ2 A;  3O4H A;  1GOG A;  3I8C A;  4K3I D;  3O4J A;  5HDB A;  1N6F A;  1GP2 B;  1JV2 A;  3EMH A;  3PSC B;  4NBM A;  2IWF A;  2AGX A;  2P9P C;  4GMB A;  3T3P A;  4WK4 A;  4Z7N A;  4J8G A;  3NVX A;  1TYE A;  2B5L A;  4O02 A;  4LG9 A;  2H47 A;  2HXC A;  4UM9 A;  2H14 A;  4E54 A;  2VDK A;  4CY1 A;  1VE6 A;  4L1Q D;  5FKT A;  4E5Z A;  4DNV A;  3AL9 A;  3SJL D;  4GGC A;  2XDW A;  5K19 A;  2H3X A;  4GM8 A;  1K8K C;  3MKQ A;  1E8M A;  3I7P A;  5B4W A;  4RE6 A;  3FCS A;  4QQE A;  4GM3 A;  5M5R A;  4JHN A;  4J87 A;  5HE3 B;  2PM9 B;  3SWS D;  4CI8 A;  2UZY B;  3K27 A;  3RMZ D;  4O3T B;  2CN2 A;  3GC3 B;  3IUR A;  3OKY A;  4GGD A;  4ZOZ A;  5H14 A;  5GSA A;  4FHL A;  3UKU C;  5FKR A;  5GXH A;  3KRW B;  4L1M A;  5I5M A;  2PM7 B;  5TEF A;  3EQ8 A;  5M5S A;  2YNO A;  3PVU B;  3FGB A;  2W18 A;  4DNU A;  1JOF A;  3K72 A;  4L9O A;  3O4I A;  3EU7 A;  4GGA A;  2YNP A;  4BUJ C;  3AFC A;  4X3E A;  2OK4 A;  2GC7 A;  1NEX B;  4IA9 A;  5I5I A;  4O1Q D;  5TDH B;  5FFO A;  4A11 B;  5FLX g;  2HKM A;  2O9K A;  3BWS A;  5IGO A;  2BKL A;  4FAN D;  3RFH A;  4BP8 A;  5C92 A;  3DXM C;  4JHP C;  5C86 A;  2HJ4 A;  1H2Z A;  4R7A B;  5FKQ A;  3MXX A;  4ZOY A;  4A09 A;  4DNW A;  2VDP A;  4X61 B;  4PBZ A;  1MG3 A;  1QFM A;  4FA4 D;  3VGZ A;  1XIP A;  3VI3 A;  3EQ7 A;  4YVD A;  4J8B A;  2AH1 A;  3MZK A;  4L3H D;  3ZDY A;  5TF2 A;  2YB8 B;  3BG1 A;  1MDA H;  2OVP B;  4A08 A;  2IUP A;  3ZDX A;  1O6F A;  4G1E A;  3ZWL B;  3QHY B;  3JB9 L;  1U8C A;  4A0A B;  1QNI A;  4G1M A;  3OL2 B;  1NR0 A;  3GFC A;  4L3G D;  3EI1 B;  4FAV D;  4QL1 A;  5EMM B;  5EAR A;  3O4G A;  5K1C C;  3K6S A;  2HJB A;  4WJK A;  5EML B;  3I89 A;  1C9L A;  4A11 A;  3SBR A;  5IJ8 E;  4BCC A;  1MG2 A;  5IT9 g;  3I7N A;  1N6E A;  1B9Y A;  3F3G A;  4O9D A;  5JWZ A;  4D9S A;  2HKR A;  3SCY A;  3SLE D;  2AGL A;  2H68 A;  4G55 A;  2VDR A;  2CE8 A;  2CE9 A;  2TRC B;  3EI3 B;  2B5M A;  2HES X;  4AX4 A;  1K3I A;  3BG0 A;  2BBK H;  3I8E A;  2XZG A;  4AMY A;  3FRX A;  5M5U A;  4Y7R A;  4O3U B;  2P9N C;  1UOO A;  4JSV C;  3I7O A;  3PXS D;  1H2X A;  3DSM A;  3OL2 A;  5CXC A;  4ERY A;  1JMX B;  2I0T A;  3EI1 A;  3CFV A;  2YNN A;  5SXM A;  4UI9 R;  1PEV A;  3C5M A;  3OTT A;  4PSW B;  5FKS A;  3GD1 I;  3IVM A;  1B9X A;  2EIE A;  4BH6 A;  2CO0 A;  3IKO A;  2QZP A;  4CZY A;  4U7A A;  4ESG A;  3F3P A;  4QRJ A;  3J80 g;  1PGU A;  4GZ8 A;  5I5J A;  3MVD K;  5GXI A;  2VZ3 A;  4FA1 D;  1U4C A;  2G9A A;  4H5J A;  5H1M A;  3DXK C;  3UR4 A;  3EQ9 A;  4PXW A;  5EAL A;  3FCU A;  4D0K A;  3SFZ A;  1QFS A;  3AH8 B;  4D6V A;  4JSN C;  4CI2 A;  4AN1 A;  5E6S A;  3E0C A;  3J81 g;  4Y5R D;  4FB1 D;  2H6K A;  2GNQ A;  4MK0 B;  3V5W B;  2CN3 A;  1GOH A;  1ERJ A;  3KRX B;  5GMK n;  4XEI C;  4LG8 A;  4ZOV A;  5M61 A;  3RN1 D;  1TBG A;  2G99 A;  2PM6 B;  4NAA A;  3P4F A;  2EIB A;  1RI6 A;  3EI2 B;  2Q7Q A;  1XKS A;  3C75 H;  1I2M B;  4JSX C;  4I79 A;  4JD2 C;  5THA A;  1UOP A;  4WK0 A;  1XHM A;  4CZV A;  3JRP A;  1SHY B;  2IWK A;  2QC5 A;  3AL8 B;  5E6U A;  4JT5 C;  3NVQ A;  3OF7 A;  3W15 A;  2IUV A;  3I7H A;  5IJ7 E;  1A0R B;  3IJE A;  4FA9 D;  3RRM C;  2PM9 A;  2VDM A;  3I7L A;  3JZG A;  4J0X A;  1K32 A;  4NSX A;  5EAP A;  3SN6 B;  2OVR B;  1UOQ A;  3F3F A;  3UVL A;  4CI3 A;  3ODT A;  2OK6 A;  3JZN A;  2H9L A;  2P9K C;  4RE5 A;  5EMK B;  2I3S A;  4OWR A;  4CY3 A;  4XYH A;  5HE2 B;  2IUQ A;  3EI2 A;  2XYI A;  4EWR A;  1JJU B;  3NIG A;  3OKW A;  2PBI B;  2Z2O A;  5M5V A;  5AFU 3;  4J81 A;  5C2V B;  4LGN A;  1TYQ C;  3AL8 A;  3RFG A;  1GG2 B;  3C99 A;  1H2Y A;  4CI1 A;  2XE4 A;  1GXR A;  5EAM A;  2Z2P A;  3V7D B;  2P9I C;  2VDO A;  1PBY B;  4MMX A;  4BL0 A;  1L5G A;  1SQJ A;  4J77 A;  4QAM A;  1S4U X;  1JMZ B;  4CC9 A;  4AOW A;  2OJY A;  4J73 A;  4Z7O A;  5M5T A;  4OZU A;  2OIZ A;  4ES0 A;  4Z8L A;  3RSE C;  2OVQ B;  1A12 A;  3SMR A;  2IAA A;  5FFG A;  4J0W A;  5IGQ A;  5AJA A;  3DM0 A;  4XYI A;  1T2X A;  2HU5 A;  3PSL A;  3RN0 D;  3T3M A;  3VH0 A;  4E54 B;  2P9L C;  4N14 A;  3IIY A;  4AN0 A;  4A0B B;  3K71 A;  4E5Z B;  2HU8 A;  4CY2 A;  4JT6 C;  3VI4 A;  1E8N A;  2AQ5 A;  1N6D A;  2J57 G;  3QI0 A;  4BCD A;  4BP9 A;  4U1E I;  4PSX B;  4A0A A;  3PXT D;  2AGZ A;  3IUL A;  3SHF A;  2H6Q A;  3UVM A;  4JSP C;  5KDO B;  2AGY A;  1OMW B;  4PBY A;  2EIC A;  4A7J A;  1L0Q A;  1VZ3 A;  3OKY B;  5HE0 B;  2HYE A;  2VZ1 A;  3VA6 A;  3OKT A;  4J82 A;  3IUQ A;  1JTD B;  1VE7 A;  3MKS B;  4G56 B;  2BCJ B;  4O2W A;  5HQG A;  2QXV A;  3L4O D;  2AH0 A;  4BCB A;  5AMS A;  3ZE1 A;  3DDU A;  3EI3 A;  3V4V A;  2J55 H;  2EID A;  2VDQ A;  2XL3 A;  3K26 A;  3EWE A;  3PVW B;  4A0B A;  3ORV D;  3IJ1 A;  1FWX A;  4J86 A;  3ZDZ A;  1C9I A;  5HYN B;  1UTC A;  3MUO A;  2UZX B;  1P22 A;  2VC2 A;  3ZE0 A;  4FWW A;  4AMZ A;  2H9P A;  1YFQ A;  4NEN A;  2HU7 A;  3JAM g;  3NVN A;  4A09 B;  3MUN A;  5EM2 B;  3JPX A;  3MMY A;  4H5I A;  3RLM D;  4ZOX A;  2EBS A;  3DWL C;  3IJ0 A;  3MZL A;  4TZ4 A;  5A2Q g;  4QT8 A;  2B4E A;  2YBA A;  3V9F A;  3NIF A;  2H6N A;  4GQ2 P;  1GOF A;  4ZN4 A;  4A08 B;  3IJC A;  4MMY A;  4J84 A;  3EG6 A;  4J78 A;  2YMU A;  5IC7 A;  3I7K A;  2QR5 A;  3B7F A;  1Q47 A;  2CNX A;  4CZX A;  2MTA H;  5HE1 B;  5C9Z B;  2Z2N A;  2XU7 A;  5CXB B;  5FQD A;  1U2V C;  5CYK B;  3N0E A;  3GRE A;  2P9S C;  3ULE C;  5H17 A;  4GQB B;  3UVO A;  1M1X A;  4JXM A;  5C2W B;  2I3T A;  1H2W A;  1PI6 A;  2P9U C;  3IUN A;  4AEZ A;  3IUM A;  3NID A;  4ERQ A;  2VDN A;  5EM2 A;  4WK2 A;  5E6R A;  4MMZ A;  4X63 B;  4J79 A;  2I0R A;  4GM9 A;  4ERZ A;  1E5T A;  1OLZ A;  3UVK A;  3EI4 B;  1R5M A;  4IRZ A;  3I2N A;  3UKR C;  3SBP A;  4PC0 A;  2I0S A;  4K3J B;  2IUR A;  3CIK B;  4PNK B;  2AGW A;  2GC4 A;  3HFQ A;  3IUJ A;  3OW8 A;  4Z7Q A;  4HDJ A;  4IMM A;  4KFM B;  3CFS B;  3U4Y A;  1BPO A;  2H9M A;  3C9C A;  5CXC B;  3V4P A;  1O6G A;  1SQ9 A;  4FA5 D;  4X60 B;  5CXB A;  5CYK A;  3A0F A;  3IIW A;  4CY5 A;  4A2M A;  2B5N A;  2CO0 C;  3PE7 A;  3FM0 A;  1YR2 A;  5EMJ B;  3ZE2 A; 
#chains in the Genus database with same CATH homology
 3L4M D;  3JZH A;  3JRO A;  5FA5 B;  1VYH C;  2H9N A;  3SVW D;  4O45 A;  4GQ1 A;  2H13 A;  2J56 H;  3SXT D;  3UVN A;  1GOT B;  3PXW D;  5FXY A;  2XL2 A;  3N0D A;  4A2L A;  3EI4 A;  3SBQ A;  5TEE A;  3I8C A;  4K3I D;  1N6F A;  1GP2 B;  3EMH A;  3PSC B;  2IWF A;  2AGX A;  2P9P C;  4GMB A;  4J8G A;  3NVX A;  2B5L A;  4LG9 A;  2H47 A;  2HXC A;  2H14 A;  4E54 A;  4CY1 A;  4L1Q D;  5FKT A;  4E5Z A;  3AL9 A;  3SJL D;  4GGC A;  5K19 A;  2H3X A;  4GM8 A;  1K8K C;  3MKQ A;  3I7P A;  5B4W A;  4QQE A;  4GM3 A;  4J87 A;  5HE3 B;  2PM9 B;  3SWS D;  4CI8 A;  2UZY B;  3K27 A;  3RMZ D;  4O3T B;  2CN2 A;  3OKY A;  4GGD A;  4ZOZ A;  5H14 A;  5GSA A;  4FHL A;  3UKU C;  5FKR A;  5GXH A;  3KRW B;  5I5M A;  2PM7 B;  5TEF A;  2YNO A;  3PVU B;  3FGB A;  2W18 A;  1JOF A;  4L9O A;  3EU7 A;  4GGA A;  2YNP A;  4BUJ C;  3AFC A;  4X3E A;  2OK4 A;  2GC7 A;  1NEX B;  4IA9 A;  5I5I A;  4O1Q D;  5TDH B;  4A11 B;  5FLX g;  2HKM A;  2O9K A;  3BWS A;  5IGO A;  4FAN D;  3RFH A;  3DXM C;  2HJ4 A;  4R7A B;  5FKQ A;  3MXX A;  4ZOY A;  4A09 A;  4X61 B;  4PBZ A;  1MG3 A;  4FA4 D;  3VGZ A;  1XIP A;  4YVD A;  4J8B A;  2AH1 A;  4L3H D;  3MZK A;  5TF2 A;  2YB8 B;  3BG1 A;  1MDA H;  2OVP B;  4A08 A;  2IUP A;  3ZWL B;  3JB9 L;  4A0A B;  1QNI A;  3OL2 B;  1NR0 A;  3GFC A;  4L3G D;  3EI1 B;  4FAV D;  4QL1 A;  5EMM B;  5EAR A;  5K1C C;  2HJB A;  5EML B;  5IJ8 E;  3I89 A;  4A11 A;  3SBR A;  1MG2 A;  5IT9 g;  3I7N A;  1N6E A;  1B9Y A;  3F3G A;  4O9D A;  5JWZ A;  2HKR A;  3SCY A;  3SLE D;  2AGL A;  2H68 A;  2CE8 A;  2CE9 A;  2TRC B;  3EI3 B;  2B5M A;  2HES X;  3BG0 A;  2BBK H;  3I8E A;  3FRX A;  4Y7R A;  4O3U B;  2P9N C;  4JSV C;  3I7O A;  3PXS D;  3DSM A;  3OL2 A;  5CXC A;  4ERY A;  1JMX B;  2I0T A;  3EI1 A;  3CFV A;  2YNN A;  5SXM A;  4UI9 R;  1PEV A;  3C5M A;  3OTT A;  4PSW B;  5FKS A;  1B9X A;  4BH6 A;  2CO0 A;  3IKO A;  4CZY A;  4U7A A;  4ESG A;  3F3P A;  4QRJ A;  3J80 g;  1PGU A;  4GZ8 A;  5I5J A;  5GXI A;  4FA1 D;  1U4C A;  2G9A A;  4H5J A;  5H1M A;  3DXK C;  3UR4 A;  4PXW A;  5EAL A;  4D0K A;  3SFZ A;  3AH8 B;  4D6V A;  4JSN C;  4CI2 A;  3E0C A;  3J81 g;  4Y5R D;  4FB1 D;  2H6K A;  2GNQ A;  4MK0 B;  3V5W B;  2CN3 A;  1ERJ A;  3KRX B;  5GMK n;  4XEI C;  4LG8 A;  4ZOV A;  3RN1 D;  1TBG A;  2G99 A;  2PM6 B;  3P4F A;  1RI6 A;  3EI2 B;  2Q7Q A;  1XKS A;  3C75 H;  4JSX C;  4I79 A;  4JD2 C;  5THA A;  1XHM A;  4CZV A;  3JRP A;  1SHY B;  2IWK A;  2QC5 A;  3AL8 B;  4JT5 C;  3NVQ A;  3W15 A;  2IUV A;  3I7H A;  5IJ7 E;  1A0R B;  4FA9 D;  3RRM C;  2PM9 A;  3I7L A;  3JZG A;  4J0X A;  1K32 A;  4NSX A;  5EAP A;  3SN6 B;  2OVR B;  3F3F A;  3UVL A;  4CI3 A;  3ODT A;  2OK6 A;  3JZN A;  2H9L A;  2P9K C;  4CY3 A;  5EMK B;  2I3S A;  4OWR A;  4XYH A;  5HE2 B;  2IUQ A;  3EI2 A;  2XYI A;  4EWR A;  1JJU B;  3OKW A;  2PBI B;  2Z2O A;  5AFU 3;  4J81 A;  5C2V B;  4LGN A;  1TYQ C;  3AL8 A;  3RFG A;  1GG2 B;  3C99 A;  4CI1 A;  1GXR A;  5EAM A;  2Z2P A;  3V7D B;  2P9I C;  1PBY B;  4BL0 A;  1SQJ A;  4J77 A;  1S4U X;  1JMZ B;  4CC9 A;  4AOW A;  2OJY A;  4J73 A;  4OZU A;  2OIZ A;  4ES0 A;  4Z8L A;  3RSE C;  2OVQ B;  3SMR A;  2IAA A;  5IGQ A;  4J0W A;  5AJA A;  3DM0 A;  4XYI A;  3PSL A;  3RN0 D;  3VH0 A;  4E54 B;  2P9L C;  4N14 A;  3IIY A;  4A0B B;  4E5Z B;  4CY2 A;  4JT6 C;  2AQ5 A;  1N6D A;  2J57 G;  4U1E I;  4PSX B;  4A0A A;  3PXT D;  2AGZ A;  3SHF A;  2H6Q A;  3UVM A;  4JSP C;  5KDO B;  2AGY A;  1OMW B;  4PBY A;  4A7J A;  1L0Q A;  3OKY B;  5HE0 B;  2HYE A;  3VA6 A;  3OKT A;  4J82 A;  4G56 B;  5HQG A;  3MKS B;  2BCJ B;  2QXV A;  3L4O D;  2AH0 A;  5AMS A;  3EI3 A;  2J55 H;  2XL3 A;  3K26 A;  3EWE A;  3PVW B;  4A0B A;  3ORV D;  3IJ1 A;  1FWX A;  4J86 A;  5HYN B;  2UZX B;  1P22 A;  4FWW A;  2H9P A;  1YFQ A;  3JAM g;  3NVN A;  4A09 B;  5EM2 B;  3JPX A;  3MMY A;  4H5I A;  3RLM D;  4ZOX A;  2EBS A;  3DWL C;  3IJ0 A;  3MZL A;  4TZ4 A;  5A2Q g;  4QT8 A;  2B4E A;  2YBA A;  3V9F A;  2H6N A;  4GQ2 P;  4ZN4 A;  4A08 B;  3IJC A;  4J84 A;  3EG6 A;  4J78 A;  2YMU A;  5IC7 A;  3I7K A;  3B7F A;  2CNX A;  1Q47 A;  4CZX A;  2MTA H;  5HE1 B;  5C9Z B;  2Z2N A;  2XU7 A;  5CXB B;  5FQD A;  1U2V C;  5CYK B;  3N0E A;  3GRE A;  2P9S C;  3ULE C;  5H17 A;  4GQB B;  3UVO A;  4JXM A;  5C2W B;  2I3T A;  1PI6 A;  2P9U C;  4AEZ A;  4ERQ A;  5EM2 A;  4X63 B;  4J79 A;  2I0R A;  4GM9 A;  4ERZ A;  1OLZ A;  3UVK A;  3EI4 B;  1R5M A;  3I2N A;  3UKR C;  3SBP A;  4PC0 A;  2I0S A;  4K3J B;  2IUR A;  3CIK B;  4PNK B;  2AGW A;  2GC4 A;  3HFQ A;  3OW8 A;  4HDJ A;  4IMM A;  4KFM B;  3CFS B;  3U4Y A;  2H9M A;  3C9C A;  5CXC B;  1SQ9 A;  4FA5 D;  4X60 B;  5CXB A;  5CYK A;  3A0F A;  3IIW A;  4CY5 A;  4A2M A;  2B5N A;  2CO0 C;  3PE7 A;  3FM0 A;  5EMJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...