5C9ZB

Crystal structure of prmt5:mep50 with epz015866 and sinefungin
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
313
structure length
313
Chain Sequence
b'EWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 5
publication title Crystal structure of PRMT5/MEP50 complex with sinefungin and 15866
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5c9zB00
5IGQA 5GXHA 1GOTB 3OW8A 5IJ8E 2IUQA 3HFQA 3NVQA 3IKOA 1SHYB 4L9OA 3I7LA 2GNQA 3FRXA 3L4OD 5EMJB 3C5MA 3IJ1A 4PSWB 5FA5B 1K8KC 3GREA 1N6FA 2HJBA 4FHLA 2B5MA 5C9ZB 2IUPA 4JSNC 4CZVA 4A0AA 5HE3B 3EI4B 5CXCA 1S4UX 4EWRA 2IURA 3DM0A 5FKTA 3RLMD 3SWSD 4ZOXA 1NEXB 4CY5A 4LG8A 3ORVD 3KRWB 4GMBA 4HDJA 3RN1D 4CI1A 3AL9A 3I7OA 4H5JA 2OVRB 4IMMA 3BG0A 3EI1A 2OIZA 1JOFA 4J87A 5IGOA 5K1CC 4MK0B 4PBYA 3I7KA 3J80g 3SXTD 5GSAA 2EBSA 1B9XA 4FA9D 2J55H 2GC4A 2QC5A 2BCJB 3ZWLB 4D0KA 2OK4A 2H9LA 4CC9A 5TDHB 2HESX 4N14A 4X60B 1JMXB 4A09A 5EM2B 4FAVD 2CO0C 3SJLD 3GFCA 4Y7RA 2CE9A 5HQGA 2AGYA 5IJ7E 3AL8A 4A2LA 5HE2B 3BWSA 3AFCA 1PI6A 4J8BA 3OKTA 3OKWA 4J8GA 4J81A 3I8CA 5FKSA 3JZNA 2H6NA 4PC0A 4ERQA 2P9LC 3VA6A 2H68A 1K32A 3F3GA 2PM7B 3PSLA 5TEEA 4PXWA 4FB1D 4A11A 3SBQA 3IIYA 2H6KA 3SLED 5FKRA 3RSEC 4O1QD 2H3XA 2CNXA 1JMZB 4CI3A 4FWWA 2H47A 5FXYA 3JZGA 3V7DB 4JSXC 3PE7A 4H5IA 3JB9L 4QL1A 3K27A 3V9FA 4JXMA 4JD2C 3A0FA 3MKQA 2G9AA 1TYQC 2OJYA 2B4EA 4J0WA 2HYEA 3MKSB 4A0BA 1GG2B 3IJ0A 3NVNA 3SCYA 3DXKC 2YNNA 3EI2A 3UVMA 5GXIA 3NVXA 4A08A 2P9UC 1SQJA 3BG1A 4J78A 5JWZA 2XU7A 4G56B 5CXBA 4K3JB 3I7PA 3CFSB 2PBIB 2B5LA 5AMSA 5EAPA 4GQ1A 2QXVA 2PM9A 5TEFA 3FM0A 4ES0A 5KDOB 2Z2NA 3UKUC 2P9PC 2PM6B 1GP2B 3F3PA 5IT9g 3N0EA 5H14A 3MMYA 3J81g 2H6QA 2YNPA 1Q47A 5I5IA 1N6DA 4R7AB 1U2VC 4YVDA 4FAND 2CE8A 3I2NA 3RMZD 2HKMA 4ESGA 4JSPC 5EMKB 4QT8A 4TZ4A 4XYIA 4CZXA 2TRCB 4OWRA 4Z8LA 4A0AB 2UZXB 1OLZA 3FGBA 2P9IC 5GMKn 3EMHA 2Z2PA 5CXCB 5C2VB 2UZYB 4A2MA 1L0QA 3L4MD 4GGDA 4U7AA 1GXRA 4IA9A 3C99A 3DSMA 4GQBB 3OL2A 5EMMB 2B5NA 2I3SA 1PEVA 2XL3A 3V5WB 3DXMC 5EAMA 3EI1B 4J79A 5I5MA 3UKRC 2I3TA 4O3UB 2H9NA 4I79A 4JT6C 2CO0A 3JZHA 3PVUB 2H9MA 2Q7QA 1QNIA 1U4CA 5AFU3 3N0DA 2J57G 4CZYA 3EI3A 2P9SC 4BH6A 2H9PA 2J56H 3MXXA 3I8EA 3UVKA 1MDAH 4J73A 2AQ5A 2OK6A 3OKYA 4FA4D 4A09B 2I0TA 5FLXg 4CY1A 4J0XA 5FKQA 2YMUA 3SN6B 5HE1B 3U4YA 3OTTA 4E5ZA 3PXTD 4JT5C 3VGZA 2G99A 3AL8B 2MTAH 4E54A 4J84A 3AH8B 4PNKB 4GGAA 1A0RB 2IAAA 5B4WA 4U1EI 2CN3A 2AH0A 4GQ2P 4XYHA 2XYIA 3CIKB 1NR0A 4CY3A 5AJAA 4A11B 2XL2A 3F3FA 3PVWB 5EARA 3C75H 2AGZA 3JAMg 2HKRA 3KRXB 3VH0A 3E0CA 5IC7A 3UVLA 4QQEA 1SQ9A 5A2Qg 4X61B 5C2WB 3EU7A 3MZLA 1FWXA 4CI8A 3EI4A 4J77A 2HJ4A 1P22A 4L3HD 2IWKA 1RI6A 1OMWB 5EALA 2P9KC 4CY2A 4AOWA 3B7FA 3JRPA 1VYHC 1XKSA 4A0BB 2CN2A 5THAA 1XIPA 3UR4A 2IUVA 3MZKA 3EI2B 4BUJC 2W18A 1JJUB 1XHMA 1YFQA 3RFHA 3RRMC 3SVWD 4A08B 4O45A 5H1MA 4GM3A 3CFVA 5EMLB 5CXBB 2AGLA 4X63B 4FA1D 2PM9B 3SBRA 5TF2A 1PGUA 4O3TB 2OVQB 3EWEA 3ODTA 1PBYB 2BBKH 3SMRA 5EM2A 4L3GD 3PXSD 4X3EA 3JROA 3P4FA 4AEZA 1R5MA 4K3ID 4GGCA 3PXWD 4J86A 4JSVC 4ERZA 4L1QD 2I0SA 3W15A 1N6EA 1ERJA 1B9YA 4KFMB 5SXMA 5CYKA 2H13A 4OZUA 5HYNB 5K19A 4PBZA 3C9CA 2AGXA 5H17A 4J82A 4LGNA 2IWFA 2OVPB 3IJCA 3SBPA 3K26A 3SFZA 3RFGA 5I5JA 4LG9A 4XEIC 3RN0D 4GZ8A 4NSXA 4GM8A 5FQDA 4ZOYA 2YNOA 4A7JA 2I0RA 3OL2B 1MG2A 3ULEC 4ERYA 3SHFA 3I7NA 2YBAA 4Y5RD 3I89A 5CYKB 4O9DA 3IIWA 3EG6A 4ZOZA 3DWLC 2O9KA 2AH1A 1TBGA 4GM9A 2H14A 1MG3A 3EI3B 4ZN4A 2HXCA 2GC7A 4UI9R 3PSCB 4FA5D 4QRJA 2YB8B 2Z2OA 3OKYB 4PSXB 4D6VA 2AGWA 3JPXA 4E5ZB 2P9NC 4CI2A 4BL0A 3UVOA 4ZOVA 3I7HA 5HE0B 3UVNA 4E54B
chains in the Genus database with same CATH superfamily
5IGQA 5GXHA 1GOTB 3OW8A 2VC2A 5IJ8E 2IUQA 3HFQA 3NVQA 3IKOA 1SHYB 4L9OA 1VE6A 3I7LA 1T2XA 2GNQA 3FRXA 5M5VA 3L4OD 5EMJB 3C5MA 3IJ1A 4PSWB 1C9LA 5FA5B 1VZ3A 1K8KC 3GREA 1N6FA 2HJBA 4FHLA 2EIBA 4DNWA 2B5MA 5C9ZB 2IUPA 3IULA 4JSNC 4CZVA 4A0AA 2VDPA 4NENA 3K6SA 4JHPC 5HE3B 3EI4B 2JKXA 5CXCA 1S4UX 4EWRA 2IURA 3DM0A 3O4GA 5FKTA 3RLMD 3SWSD 3IUMA 4ZOXA 2HU5A 3IURA 1VE7A 1NEXB 4AX4A 4CY5A 1JTDB 4LG8A 3ORVD 3KRWB 3GD1I 4GMBA 4HDJA 3RN1D 4CI1A 3AL9A 3I7OA 4H5JA 2OVRB 3ZDXA 4MMZA 4IMMA 3BG0A 4AN1A 3EI1A 2OIZA 1QFMA 5C92A 1JOFA 4J87A 5IGOA 5K1CC 4UM8A 3NIGA 4MK0B 4PBYA 3I7KA 3J80g 3SXTD 5GSAA 2EBSA 3DDUA 1O6GA 1B9XA 4FA9D 2J55H 2GC4A 2QC5A 2BCJB 3ZWLB 4D0KA 2OK4A 2H9LA 2QZPA 4CC9A 5TDHB 2HESX 4N14A 4X60B 1JMXB 1H2YA 1QFSA 4DNVA 4A09A 1JV2A 2XDWA 5EM2B 4FAVD 2CO0C 3SJLD 3GFCA 3K72A 4Y7RA 2CE9A 5HQGA 2AGYA 5IJ7E 5E6SA 3AL8A 4A2LA 5HE2B 1M1XA 3BWSA 4WK0A 3AFCA 1PI6A 4J8BA 3OKTA 2HU7A 3OKWA 4J8GA 4J81A 4BCBA 3I8CA 5FKSA 3JZNA 3T3MA 2H6NA 4PC0A 3V4PA 4ERQA 2VDRA 2VDNA 3ZE2A 2P9LC 3VA6A 1GOFA 2H68A 1K32A 3MUOA 3F3GA 2PM7B 3PSLA 5C86A 5TEEA 4PXWA 4FB1D 4A11A 3SBQA 3IIYA 2H6KA 3SLED 5FKRA 3RSEC 4BCCA 4O1QD 5E6RA 2H3XA 2CNXA 1UOOA 1JMZB 3ZDYA 4CI3A 4FWWA 2H47A 5FXYA 1UOPA 3JZGA 3V7DB 4JSXC 3PE7A 4H5IA 3QHYB 4NC4A 3JB9L 4QL1A 3K27A 3V9FA 4JXMA 4JD2C 3A0FA 4Z7NA 3MKQA 2G9AA 1TYQC 2OJYA 2B4EA 4J0WA 3V4VA 2HYEA 3O4JA 3MKSB 4A0BA 1GG2B 3IJ0A 3NVNA 3SCYA 3DXKC 2YNNA 3EI2A 3ZE1A 3UVMA 5HDBA 5GXIA 3NVXA 3ZDZA 4A08A 2P9UC 1SQJA 3BG1A 4J78A 3MUNA 5JWZA 4JHNA 2XU7A 4G56B 5CXBA 4K3JB 3I7PA 2XE4A 2PBIB 3CFSB 2B5LA 2VDKA 5AMSA 5EAPA 4GQ1A 2QXVA 2PM9A 5TEFA 3FM0A 4O2WA 4ES0A 5KDOB 2Z2NA 3UKUC 2P9PC 2PM6B 1GP2B 3F3PA 5IT9g 3N0EA 5H14A 3MMYA 3J81g 2H6QA 2YNPA 1Q47A 5I5IA 1N6DA 4R7AB 1U2VC 4YVDA 5M5UA 1H2WA 4AN0A 4FAND 3EQ7A 2CE8A 3MVDK 1YR2A 3I2NA 3RMZD 2HKMA 4ESGA 5FFGA 4JSPC 5EMKB 4QT8A 2XZGA 5E6UA 4TZ4A 4XYIA 4CZXA 2TRCB 4OWRA 1E5TA 4Z8LA 4A0AB 2QR5A 2UZXB 1OLZA 2VDLA 3FGBA 2VDMA 4Z7QA 1TYEA 2P9IC 5GMKn 3EMHA 2Z2PA 4BP8A 1VZ2A 5CXCB 5C2VB 3FCUA 2UZYB 4A2MA 1L0QA 3L4MD 4GGDA 3VI4A 4U7AA 1GXRA 3O4IA 4IA9A 2WQ8A 5M61A 3C99A 3DSMA 4GQBB 4WK4A 3OL2A 5EMMB 2B5NA 2I3SA 1PEVA 2XL3A 3V5WB 3DXMC 2EIEA 5EAMA 3EI1B 4J79A 3OF7A 5I5MA 3IUNA 3UKRC 2I3TA 4O3UB 4O02A 2H9NA 4I79A 4JT6C 2CO0A 3JZHA 3PVUB 2H9MA 2Q7QA 4MMXA 1QNIA 1U4CA 4UM9A 3N0DA 2J57G 4CZYA 5AFU3 3EI3A 2P9SC 2BKLA 4BH6A 2H9PA 2J56H 3MXXA 3I8EA 3UVKA 1MDAH 4J73A 2AQ5A 4DNUA 5M5RA 3T3PA 2OK6A 3OKYA 4FA4D 4A09B 2I0TA 5FLXg 4CY1A 1BPOA 4J0XA 5FKQA 2YMUA 3SN6B 5HE1B 4Z7OA 3U4YA 3OTTA 4E5ZA 3PXTD 4JT5C 3VGZA 2G99A 3AL8B 5M5SA 2MTAH 1A12A 4E54A 4J84A 3AH8B 4PNKB 4GGAA 1A0RB 2IAAA 2VZ1A 3O4HA 4U1EI 5B4WA 2CN3A 2AH0A 4GQ2P 4XYHA 2XYIA 3CIKB 1NR0A 4CY3A 1GOGA 1E8NA 5AJAA 1L5GA 1O6FA 4A11B 1K3IA 2XL2A 3F3FA 3PVWB 4NAAA 5EARA 3C75H 2AGZA 3JAMg 2HKRA 3KRXB 3VH0A 3E0CA 4L1MA 5IC7A 3UVLA 4QQEA 1SQ9A 5A2Qg 4X61B 5C2WB 3EU7A 3MZLA 1FWXA 4CI8A 3NIFA 3EI4A 4J77A 2HJ4A 1P22A 4L3HD 2IWKA 1RI6A 1OMWB 5EALA 2P9KC 2EIDA 4CY2A 4AOWA 4BP9A 3B7FA 4WJKA 3JRPA 1VYHC 1XKSA 4A0BB 3IUJA 1H2ZA 2CN2A 5THAA 1XIPA 3UR4A 1H2XA 3IUQA 2IUVA 3MZKA 3EI2B 4BUJC 2W18A 1JJUB 1XHMA 1YFQA 3RFHA 3RRMC 3SVWD 4A08B 4AMZA 4O45A 5H1MA 2VDQA 4GM3A 3CFVA 4RE5A 5CXBB 2AGLA 4G55A 4X63B 5EMLB 4FA1D 2PM9B 3SBRA 5TF2A 1PGUA 4RE6A 4O3TB 2OVQB 3EWEA 3ODTA 1PBYB 2VDOA 5M5TA 2BBKH 4BCDA 3EQ8A 3SMRA 5EM2A 4L3GD 3PXSD 4X3EA 3JROA 3P4FA 4AEZA 1R5MA 4IRZA 4K3ID 4GGCA 3PXWD 4J86A 3ZE0A 4JSVC 3EQ9A 4ERZA 4L1QD 2I0SA 3W15A 1N6EA 4QAMA 1ERJA 1B9YA 5FFOA 4KFMB 5SXMA 3K71A 5CYKA 3KCIA 2H13A 1E8MA 2VZ3A 4OZUA 5HYNB 5K19A 4PBZA 3C9CA 2AGXA 5H17A 4J82A 4LGNA 2IWFA 3IJEA 2OVPB 3IJCA 3SBPA 3K26A 3SFZA 3RFGA 5I5JA 3QI0A 4LG9A 3NIDA 1UOQA 4XEIC 3RN0D 4GZ8A 2HU8A 4NSXA 4GM8A 5FQDA 4ZOYA 2YNOA 4A7JA 2I0RA 3OL2B 1MG2A 2EICA 1U8CA 3ULEC 4ERYA 3SHFA 3I7NA 2YBAA 4Y5RD 3I89A 5CYKB 4O9DA 3GC3B 3IIWA 3EG6A 1C9IA 4ZOZA 3DWLC 2O9KA 2AH1A 1TBGA 4G1EA 4GM9A 2H14A 1MG3A 3EI3B 3VI3A 4ZN4A 2HXCA 2GC7A 4UI9R 4WK2A 3PSCB 4FA5D 4MMYA 4QRJA 2YB8B 1I2MB 2Z2OA 4AMYA 1GOHA 3OKYB 4PSXB 3FCSA 4D6VA 2AGWA 3IVMA 3JPXA 4E5ZB 2P9NC 4CI2A 4BL0A 1UTCA 3UVOA 4NBMA 4ZOVA 3I7HA 5HE0B 3UVNA 4G1MA 4D9SA 4E54B
chains in the Genus database with same CATH topology
5IGQA 5GXHA 1GOTB 3OW8A 5IJ8E 2IUQA 3HFQA 3NVQA 3IKOA 1SHYB 4L9OA 3I7LA 2GNQA 3FRXA 3L4OD 5EMJB 3C5MA 3IJ1A 4PSWB 5FA5B 1K8KC 3GREA 1N6FA 2HJBA 4FHLA 2B5MA 5C9ZB 2IUPA 4JSNC 4CZVA 4A0AA 5HE3B 3EI4B 5CXCA 1S4UX 4EWRA 2IURA 3DM0A 5FKTA 3RLMD 3SWSD 4ZOXA 1NEXB 4CY5A 4LG8A 3ORVD 3KRWB 4GMBA 4HDJA 3RN1D 4CI1A 3AL9A 3I7OA 4H5JA 2OVRB 4IMMA 3BG0A 3EI1A 2OIZA 1JOFA 4J87A 5IGOA 5K1CC 4MK0B 4PBYA 3I7KA 3J80g 3SXTD 5GSAA 2EBSA 1B9XA 4FA9D 2J55H 2GC4A 2QC5A 2BCJB 3ZWLB 4D0KA 2OK4A 2H9LA 4CC9A 5TDHB 2HESX 4N14A 4X60B 1JMXB 4A09A 5EM2B 4FAVD 2CO0C 3SJLD 3GFCA 4Y7RA 2CE9A 5HQGA 2AGYA 5IJ7E 3AL8A 4A2LA 5HE2B 3BWSA 3AFCA 1PI6A 4J8BA 3OKTA 3OKWA 4J8GA 4J81A 3I8CA 5FKSA 3JZNA 2H6NA 4PC0A 4ERQA 2P9LC 3VA6A 2H68A 1K32A 3F3GA 2PM7B 3PSLA 5TEEA 4PXWA 4FB1D 4A11A 3SBQA 3IIYA 2H6KA 3SLED 5FKRA 3RSEC 4O1QD 2H3XA 2CNXA 1JMZB 4CI3A 4FWWA 2H47A 5FXYA 3JZGA 3V7DB 4JSXC 3PE7A 4H5IA 3JB9L 4QL1A 3K27A 3V9FA 4JXMA 4JD2C 3A0FA 3MKQA 2G9AA 1TYQC 2OJYA 2B4EA 4J0WA 2HYEA 3MKSB 4A0BA 1GG2B 3IJ0A 3NVNA 3SCYA 3DXKC 2YNNA 3EI2A 3UVMA 5GXIA 3NVXA 4A08A 2P9UC 1SQJA 3BG1A 4J78A 5JWZA 2XU7A 4G56B 5CXBA 4K3JB 3I7PA 3CFSB 2PBIB 2B5LA 5AMSA 5EAPA 4GQ1A 2QXVA 2PM9A 5TEFA 3FM0A 4ES0A 5KDOB 2Z2NA 3UKUC 2P9PC 2PM6B 1GP2B 3F3PA 5IT9g 3N0EA 5H14A 3MMYA 3J81g 2H6QA 2YNPA 1Q47A 5I5IA 1N6DA 4R7AB 1U2VC 4YVDA 4FAND 2CE8A 3I2NA 3RMZD 2HKMA 4ESGA 4JSPC 5EMKB 4QT8A 4TZ4A 4XYIA 4CZXA 2TRCB 4OWRA 4Z8LA 4A0AB 2UZXB 1OLZA 3FGBA 2P9IC 5GMKn 3EMHA 2Z2PA 5CXCB 5C2VB 2UZYB 4A2MA 1L0QA 3L4MD 4GGDA 4U7AA 1GXRA 4IA9A 3C99A 3DSMA 4GQBB 3OL2A 5EMMB 2B5NA 2I3SA 1PEVA 2XL3A 3V5WB 3DXMC 5EAMA 3EI1B 4J79A 5I5MA 3UKRC 2I3TA 4O3UB 2H9NA 4I79A 4JT6C 2CO0A 3JZHA 3PVUB 2H9MA 2Q7QA 1QNIA 1U4CA 5AFU3 3N0DA 2J57G 4CZYA 3EI3A 2P9SC 4BH6A 2H9PA 2J56H 3MXXA 3I8EA 3UVKA 1MDAH 4J73A 2AQ5A 2OK6A 3OKYA 4FA4D 4A09B 2I0TA 5FLXg 4CY1A 4J0XA 5FKQA 2YMUA 3SN6B 5HE1B 3U4YA 3OTTA 4E5ZA 3PXTD 4JT5C 3VGZA 2G99A 3AL8B 2MTAH 4E54A 4J84A 3AH8B 4PNKB 4GGAA 1A0RB 2IAAA 5B4WA 4U1EI 2CN3A 2AH0A 4GQ2P 4XYHA 2XYIA 3CIKB 1NR0A 4CY3A 5AJAA 4A11B 2XL2A 3F3FA 3PVWB 5EARA 3C75H 2AGZA 3JAMg 2HKRA 3KRXB 3VH0A 3E0CA 5IC7A 3UVLA 4QQEA 1SQ9A 5A2Qg 4X61B 5C2WB 3EU7A 3MZLA 1FWXA 4CI8A 3EI4A 4J77A 2HJ4A 1P22A 4L3HD 2IWKA 1RI6A 1OMWB 5EALA 2P9KC 4CY2A 4AOWA 3B7FA 3JRPA 1VYHC 1XKSA 4A0BB 2CN2A 5THAA 1XIPA 3UR4A 2IUVA 3MZKA 3EI2B 4BUJC 2W18A 1JJUB 1XHMA 1YFQA 3RFHA 3RRMC 3SVWD 4A08B 4O45A 5H1MA 4GM3A 3CFVA 5EMLB 5CXBB 2AGLA 4X63B 4FA1D 2PM9B 3SBRA 5TF2A 1PGUA 4O3TB 2OVQB 3EWEA 3ODTA 1PBYB 2BBKH 3SMRA 5EM2A 4L3GD 3PXSD 4X3EA 3JROA 3P4FA 4AEZA 1R5MA 4K3ID 4GGCA 3PXWD 4J86A 4JSVC 4ERZA 4L1QD 2I0SA 3W15A 1N6EA 1ERJA 1B9YA 4KFMB 5SXMA 5CYKA 2H13A 4OZUA 5HYNB 5K19A 4PBZA 3C9CA 2AGXA 5H17A 4J82A 4LGNA 2IWFA 2OVPB 3IJCA 3SBPA 3K26A 3SFZA 3RFGA 5I5JA 4LG9A 4XEIC 3RN0D 4GZ8A 4NSXA 4GM8A 5FQDA 4ZOYA 2YNOA 4A7JA 2I0RA 3OL2B 1MG2A 3ULEC 4ERYA 3SHFA 3I7NA 2YBAA 4Y5RD 3I89A 5CYKB 4O9DA 3IIWA 3EG6A 4ZOZA 3DWLC 2O9KA 2AH1A 1TBGA 4GM9A 2H14A 1MG3A 3EI3B 4ZN4A 2HXCA 2GC7A 4UI9R 3PSCB 4FA5D 4QRJA 2YB8B 2Z2OA 3OKYB 4PSXB 4D6VA 2AGWA 3JPXA 4E5ZB 2P9NC 4CI2A 4BL0A 3UVOA 4ZOVA 3I7HA 5HE0B 3UVNA 4E54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGQ A;  5GXH A;  1GOT B;  3OW8 A;  5IJ8 E;  2IUQ A;  3HFQ A;  3NVQ A;  3IKO A;  1SHY B;  4L9O A;  3I7L A;  2GNQ A;  3FRX A;  3L4O D;  5EMJ B;  3C5M A;  3IJ1 A;  4PSW B;  5FA5 B;  1K8K C;  3GRE A;  1N6F A;  2HJB A;  4FHL A;  2B5M A;  5C9Z B;  2IUP A;  4JSN C;  4CZV A;  4A0A A;  5HE3 B;  3EI4 B;  5CXC A;  1S4U X;  4EWR A;  2IUR A;  3DM0 A;  5FKT A;  3RLM D;  3SWS D;  4ZOX A;  1NEX B;  4CY5 A;  4LG8 A;  3ORV D;  3KRW B;  4GMB A;  4HDJ A;  3RN1 D;  4CI1 A;  3AL9 A;  3I7O A;  4H5J A;  2OVR B;  4IMM A;  3BG0 A;  3EI1 A;  2OIZ A;  1JOF A;  4J87 A;  5IGO A;  5K1C C;  4MK0 B;  4PBY A;  3I7K A;  3J80 g;  3SXT D;  5GSA A;  2EBS A;  1B9X A;  4FA9 D;  2J55 H;  2GC4 A;  2QC5 A;  2BCJ B;  3ZWL B;  4D0K A;  2OK4 A;  2H9L A;  4CC9 A;  5TDH B;  2HES X;  4N14 A;  4X60 B;  1JMX B;  4A09 A;  5EM2 B;  4FAV D;  2CO0 C;  3SJL D;  3GFC A;  4Y7R A;  2CE9 A;  5HQG A;  2AGY A;  5IJ7 E;  3AL8 A;  4A2L A;  5HE2 B;  3BWS A;  3AFC A;  1PI6 A;  4J8B A;  3OKT A;  3OKW A;  4J8G A;  4J81 A;  3I8C A;  5FKS A;  3JZN A;  2H6N A;  4PC0 A;  4ERQ A;  2P9L C;  3VA6 A;  2H68 A;  1K32 A;  3F3G A;  2PM7 B;  3PSL A;  5TEE A;  4PXW A;  4FB1 D;  4A11 A;  3SBQ A;  3IIY A;  2H6K A;  3SLE D;  5FKR A;  3RSE C;  4O1Q D;  2H3X A;  2CNX A;  1JMZ B;  4CI3 A;  4FWW A;  2H47 A;  5FXY A;  3JZG A;  3V7D B;  4JSX C;  3PE7 A;  4H5I A;  3JB9 L;  4QL1 A;  3K27 A;  3V9F A;  4JXM A;  4JD2 C;  3A0F A;  3MKQ A;  2G9A A;  1TYQ C;  2OJY A;  2B4E A;  4J0W A;  2HYE A;  3MKS B;  4A0B A;  1GG2 B;  3IJ0 A;  3NVN A;  3SCY A;  3DXK C;  2YNN A;  3EI2 A;  3UVM A;  5GXI A;  3NVX A;  4A08 A;  2P9U C;  1SQJ A;  3BG1 A;  4J78 A;  5JWZ A;  2XU7 A;  4G56 B;  5CXB A;  4K3J B;  3I7P A;  3CFS B;  2PBI B;  2B5L A;  5AMS A;  5EAP A;  4GQ1 A;  2QXV A;  2PM9 A;  5TEF A;  3FM0 A;  4ES0 A;  5KDO B;  2Z2N A;  3UKU C;  2P9P C;  2PM6 B;  1GP2 B;  3F3P A;  5IT9 g;  3N0E A;  5H14 A;  3MMY A;  3J81 g;  2H6Q A;  2YNP A;  1Q47 A;  5I5I A;  1N6D A;  4R7A B;  1U2V C;  4YVD A;  4FAN D;  2CE8 A;  3I2N A;  3RMZ D;  2HKM A;  4ESG A;  4JSP C;  5EMK B;  4QT8 A;  4TZ4 A;  4XYI A;  4CZX A;  2TRC B;  4OWR A;  4Z8L A;  4A0A B;  2UZX B;  1OLZ A;  3FGB A;  2P9I C;  5GMK n;  3EMH A;  2Z2P A;  5CXC B;  5C2V B;  2UZY B;  4A2M A;  1L0Q A;  3L4M D;  4GGD A;  4U7A A;  1GXR A;  4IA9 A;  3C99 A;  3DSM A;  4GQB B;  3OL2 A;  5EMM B;  2B5N A;  2I3S A;  1PEV A;  2XL3 A;  3V5W B;  3DXM C;  5EAM A;  3EI1 B;  4J79 A;  5I5M A;  3UKR C;  2I3T A;  4O3U B;  2H9N A;  4I79 A;  4JT6 C;  2CO0 A;  3JZH A;  3PVU B;  2H9M A;  2Q7Q A;  1QNI A;  1U4C A;  5AFU 3;  3N0D A;  2J57 G;  4CZY A;  3EI3 A;  2P9S C;  4BH6 A;  2H9P A;  2J56 H;  3MXX A;  3I8E A;  3UVK A;  1MDA H;  4J73 A;  2AQ5 A;  2OK6 A;  3OKY A;  4FA4 D;  4A09 B;  2I0T A;  5FLX g;  4CY1 A;  4J0X A;  5FKQ A;  2YMU A;  3SN6 B;  5HE1 B;  3U4Y A;  3OTT A;  4E5Z A;  3PXT D;  4JT5 C;  3VGZ A;  2G99 A;  3AL8 B;  2MTA H;  4E54 A;  4J84 A;  3AH8 B;  4PNK B;  4GGA A;  1A0R B;  2IAA A;  5B4W A;  4U1E I;  2CN3 A;  2AH0 A;  4GQ2 P;  4XYH A;  2XYI A;  3CIK B;  1NR0 A;  4CY3 A;  5AJA A;  4A11 B;  2XL2 A;  3F3F A;  3PVW B;  5EAR A;  3C75 H;  2AGZ A;  3JAM g;  2HKR A;  3KRX B;  3VH0 A;  3E0C A;  5IC7 A;  3UVL A;  4QQE A;  1SQ9 A;  5A2Q g;  4X61 B;  5C2W B;  3EU7 A;  3MZL A;  1FWX A;  4CI8 A;  3EI4 A;  4J77 A;  2HJ4 A;  1P22 A;  4L3H D;  2IWK A;  1RI6 A;  1OMW B;  5EAL A;  2P9K C;  4CY2 A;  4AOW A;  3B7F A;  3JRP A;  1VYH C;  1XKS A;  4A0B B;  2CN2 A;  5THA A;  1XIP A;  3UR4 A;  2IUV A;  3MZK A;  3EI2 B;  4BUJ C;  2W18 A;  1JJU B;  1XHM A;  1YFQ A;  3RFH A;  3RRM C;  3SVW D;  4A08 B;  4O45 A;  5H1M A;  4GM3 A;  3CFV A;  5EML B;  5CXB B;  2AGL A;  4X63 B;  4FA1 D;  2PM9 B;  3SBR A;  5TF2 A;  1PGU A;  4O3T B;  2OVQ B;  3EWE A;  3ODT A;  1PBY B;  2BBK H;  3SMR A;  5EM2 A;  4L3G D;  3PXS D;  4X3E A;  3JRO A;  3P4F A;  4AEZ A;  1R5M A;  4K3I D;  4GGC A;  3PXW D;  4J86 A;  4JSV C;  4ERZ A;  4L1Q D;  2I0S A;  3W15 A;  1N6E A;  1ERJ A;  1B9Y A;  4KFM B;  5SXM A;  5CYK A;  2H13 A;  4OZU A;  5HYN B;  5K19 A;  4PBZ A;  3C9C A;  2AGX A;  5H17 A;  4J82 A;  4LGN A;  2IWF A;  2OVP B;  3IJC A;  3SBP A;  3K26 A;  3SFZ A;  3RFG A;  5I5J A;  4LG9 A;  4XEI C;  3RN0 D;  4GZ8 A;  4NSX A;  4GM8 A;  5FQD A;  4ZOY A;  2YNO A;  4A7J A;  2I0R A;  3OL2 B;  1MG2 A;  3ULE C;  4ERY A;  3SHF A;  3I7N A;  2YBA A;  4Y5R D;  3I89 A;  5CYK B;  4O9D A;  3IIW A;  3EG6 A;  4ZOZ A;  3DWL C;  2O9K A;  2AH1 A;  1TBG A;  4GM9 A;  2H14 A;  1MG3 A;  3EI3 B;  4ZN4 A;  2HXC A;  2GC7 A;  4UI9 R;  3PSC B;  4FA5 D;  4QRJ A;  2YB8 B;  2Z2O A;  3OKY B;  4PSX B;  4D6V A;  2AGW A;  3JPX A;  4E5Z B;  2P9N C;  4CI2 A;  4BL0 A;  3UVO A;  4ZOV A;  3I7H A;  5HE0 B;  3UVN A;  4E54 B; 
#chains in the Genus database with same CATH topology
 5IGQ A;  5GXH A;  1GOT B;  3OW8 A;  2VC2 A;  5IJ8 E;  2IUQ A;  3HFQ A;  3NVQ A;  3IKO A;  1SHY B;  4L9O A;  1VE6 A;  3I7L A;  1T2X A;  2GNQ A;  3FRX A;  5M5V A;  3L4O D;  5EMJ B;  3C5M A;  3IJ1 A;  4PSW B;  1C9L A;  5FA5 B;  1VZ3 A;  1K8K C;  3GRE A;  1N6F A;  2HJB A;  4FHL A;  2EIB A;  4DNW A;  2B5M A;  5C9Z B;  2IUP A;  3IUL A;  4JSN C;  4CZV A;  4A0A A;  2VDP A;  4NEN A;  3K6S A;  4JHP C;  5HE3 B;  3EI4 B;  2JKX A;  5CXC A;  1S4U X;  4EWR A;  2IUR A;  3DM0 A;  3O4G A;  5FKT A;  3RLM D;  3SWS D;  3IUM A;  4ZOX A;  2HU5 A;  3IUR A;  1VE7 A;  1NEX B;  4AX4 A;  4CY5 A;  1JTD B;  4LG8 A;  3ORV D;  3KRW B;  3GD1 I;  4GMB A;  4HDJ A;  3RN1 D;  4CI1 A;  3AL9 A;  3I7O A;  4H5J A;  2OVR B;  3ZDX A;  4MMZ A;  4IMM A;  3BG0 A;  4AN1 A;  3EI1 A;  2OIZ A;  1QFM A;  5C92 A;  1JOF A;  4J87 A;  5IGO A;  5K1C C;  4UM8 A;  3NIG A;  4MK0 B;  4PBY A;  3I7K A;  3J80 g;  3SXT D;  5GSA A;  2EBS A;  3DDU A;  1O6G A;  1B9X A;  4FA9 D;  2J55 H;  2GC4 A;  2QC5 A;  2BCJ B;  3ZWL B;  4D0K A;  2OK4 A;  2H9L A;  2QZP A;  4CC9 A;  5TDH B;  2HES X;  4N14 A;  4X60 B;  1JMX B;  1H2Y A;  1QFS A;  4DNV A;  4A09 A;  1JV2 A;  2XDW A;  5EM2 B;  4FAV D;  2CO0 C;  3SJL D;  3GFC A;  3K72 A;  4Y7R A;  2CE9 A;  5HQG A;  2AGY A;  5IJ7 E;  5E6S A;  3AL8 A;  4A2L A;  5HE2 B;  1M1X A;  3BWS A;  4WK0 A;  3AFC A;  1PI6 A;  4J8B A;  3OKT A;  2HU7 A;  3OKW A;  4J8G A;  4J81 A;  4BCB A;  3I8C A;  5FKS A;  3JZN A;  3T3M A;  2H6N A;  4PC0 A;  3V4P A;  4ERQ A;  2VDR A;  2VDN A;  3ZE2 A;  2P9L C;  3VA6 A;  1GOF A;  2H68 A;  1K32 A;  3MUO A;  3F3G A;  2PM7 B;  3PSL A;  5C86 A;  5TEE A;  4PXW A;  4FB1 D;  4A11 A;  3SBQ A;  3IIY A;  2H6K A;  3SLE D;  5FKR A;  3RSE C;  4BCC A;  4O1Q D;  5E6R A;  2H3X A;  2CNX A;  1UOO A;  1JMZ B;  3ZDY A;  4CI3 A;  4FWW A;  2H47 A;  5FXY A;  1UOP A;  3JZG A;  3V7D B;  4JSX C;  3PE7 A;  4H5I A;  3QHY B;  4NC4 A;  3JB9 L;  4QL1 A;  3K27 A;  3V9F A;  4JXM A;  4JD2 C;  3A0F A;  4Z7N A;  3MKQ A;  2G9A A;  1TYQ C;  2OJY A;  2B4E A;  4J0W A;  3V4V A;  2HYE A;  3O4J A;  3MKS B;  4A0B A;  1GG2 B;  3IJ0 A;  3NVN A;  3SCY A;  3DXK C;  2YNN A;  3EI2 A;  3ZE1 A;  3UVM A;  5HDB A;  5GXI A;  3NVX A;  3ZDZ A;  4A08 A;  2P9U C;  1SQJ A;  3BG1 A;  4J78 A;  3MUN A;  5JWZ A;  4JHN A;  2XU7 A;  4G56 B;  5CXB A;  4K3J B;  3I7P A;  2XE4 A;  2PBI B;  3CFS B;  2B5L A;  2VDK A;  5AMS A;  5EAP A;  4GQ1 A;  2QXV A;  2PM9 A;  5TEF A;  3FM0 A;  4O2W A;  4ES0 A;  5KDO B;  2Z2N A;  3UKU C;  2P9P C;  2PM6 B;  1GP2 B;  3F3P A;  5IT9 g;  3N0E A;  5H14 A;  3MMY A;  3J81 g;  2H6Q A;  2YNP A;  1Q47 A;  5I5I A;  1N6D A;  4R7A B;  1U2V C;  4YVD A;  5M5U A;  1H2W A;  4AN0 A;  4FAN D;  3EQ7 A;  2CE8 A;  3MVD K;  1YR2 A;  3I2N A;  3RMZ D;  2HKM A;  4ESG A;  5FFG A;  4JSP C;  5EMK B;  4QT8 A;  2XZG A;  5E6U A;  4TZ4 A;  4XYI A;  4CZX A;  2TRC B;  4OWR A;  1E5T A;  4Z8L A;  4A0A B;  2QR5 A;  2UZX B;  1OLZ A;  2VDL A;  3FGB A;  2VDM A;  4Z7Q A;  1TYE A;  2P9I C;  5GMK n;  3EMH A;  2Z2P A;  4BP8 A;  1VZ2 A;  5CXC B;  5C2V B;  3FCU A;  2UZY B;  4A2M A;  1L0Q A;  3L4M D;  4GGD A;  3VI4 A;  4U7A A;  1GXR A;  3O4I A;  4IA9 A;  2WQ8 A;  5M61 A;  3C99 A;  3DSM A;  4GQB B;  4WK4 A;  3OL2 A;  5EMM B;  2B5N A;  2I3S A;  1PEV A;  2XL3 A;  3V5W B;  3DXM C;  2EIE A;  5EAM A;  3EI1 B;  4J79 A;  3OF7 A;  5I5M A;  3IUN A;  3UKR C;  2I3T A;  4O3U B;  4O02 A;  2H9N A;  4I79 A;  4JT6 C;  2CO0 A;  3JZH A;  3PVU B;  2H9M A;  2Q7Q A;  4MMX A;  1QNI A;  1U4C A;  4UM9 A;  3N0D A;  2J57 G;  4CZY A;  5AFU 3;  3EI3 A;  2P9S C;  2BKL A;  4BH6 A;  2H9P A;  2J56 H;  3MXX A;  3I8E A;  3UVK A;  1MDA H;  4J73 A;  2AQ5 A;  4DNU A;  5M5R A;  3T3P A;  2OK6 A;  3OKY A;  4FA4 D;  4A09 B;  2I0T A;  5FLX g;  4CY1 A;  1BPO A;  4J0X A;  5FKQ A;  2YMU A;  3SN6 B;  5HE1 B;  4Z7O A;  3U4Y A;  3OTT A;  4E5Z A;  3PXT D;  4JT5 C;  3VGZ A;  2G99 A;  3AL8 B;  5M5S A;  2MTA H;  1A12 A;  4E54 A;  4J84 A;  3AH8 B;  4PNK B;  4GGA A;  1A0R B;  2IAA A;  2VZ1 A;  3O4H A;  4U1E I;  5B4W A;  2CN3 A;  2AH0 A;  4GQ2 P;  4XYH A;  2XYI A;  3CIK B;  1NR0 A;  4CY3 A;  1GOG A;  1E8N A;  5AJA A;  1L5G A;  1O6F A;  4A11 B;  1K3I A;  2XL2 A;  3F3F A;  3PVW B;  4NAA A;  5EAR A;  3C75 H;  2AGZ A;  3JAM g;  2HKR A;  3KRX B;  3VH0 A;  3E0C A;  4L1M A;  5IC7 A;  3UVL A;  4QQE A;  1SQ9 A;  5A2Q g;  4X61 B;  5C2W B;  3EU7 A;  3MZL A;  1FWX A;  4CI8 A;  3NIF A;  3EI4 A;  4J77 A;  2HJ4 A;  1P22 A;  4L3H D;  2IWK A;  1RI6 A;  1OMW B;  5EAL A;  2P9K C;  2EID A;  4CY2 A;  4AOW A;  4BP9 A;  3B7F A;  4WJK A;  3JRP A;  1VYH C;  1XKS A;  4A0B B;  3IUJ A;  1H2Z A;  2CN2 A;  5THA A;  1XIP A;  3UR4 A;  1H2X A;  3IUQ A;  2IUV A;  3MZK A;  3EI2 B;  4BUJ C;  2W18 A;  1JJU B;  1XHM A;  1YFQ A;  3RFH A;  3RRM C;  3SVW D;  4A08 B;  4AMZ A;  4O45 A;  5H1M A;  2VDQ A;  4GM3 A;  3CFV A;  4RE5 A;  5CXB B;  2AGL A;  4G55 A;  4X63 B;  5EML B;  4FA1 D;  2PM9 B;  3SBR A;  5TF2 A;  1PGU A;  4RE6 A;  4O3T B;  2OVQ B;  3EWE A;  3ODT A;  1PBY B;  2VDO A;  5M5T A;  2BBK H;  4BCD A;  3EQ8 A;  3SMR A;  5EM2 A;  4L3G D;  3PXS D;  4X3E A;  3JRO A;  3P4F A;  4AEZ A;  1R5M A;  4IRZ A;  4K3I D;  4GGC A;  3PXW D;  4J86 A;  3ZE0 A;  4JSV C;  3EQ9 A;  4ERZ A;  4L1Q D;  2I0S A;  3W15 A;  1N6E A;  4QAM A;  1ERJ A;  1B9Y A;  5FFO A;  4KFM B;  5SXM A;  3K71 A;  5CYK A;  3KCI A;  2H13 A;  1E8M A;  2VZ3 A;  4OZU A;  5HYN B;  5K19 A;  4PBZ A;  3C9C A;  2AGX A;  5H17 A;  4J82 A;  4LGN A;  2IWF A;  3IJE A;  2OVP B;  3IJC A;  3SBP A;  3K26 A;  3SFZ A;  3RFG A;  5I5J A;  3QI0 A;  4LG9 A;  3NID A;  1UOQ A;  4XEI C;  3RN0 D;  4GZ8 A;  2HU8 A;  4NSX A;  4GM8 A;  5FQD A;  4ZOY A;  2YNO A;  4A7J A;  2I0R A;  3OL2 B;  1MG2 A;  2EIC A;  1U8C A;  3ULE C;  4ERY A;  3SHF A;  3I7N A;  2YBA A;  4Y5R D;  3I89 A;  5CYK B;  4O9D A;  3GC3 B;  3IIW A;  3EG6 A;  1C9I A;  4ZOZ A;  3DWL C;  2O9K A;  2AH1 A;  1TBG A;  4G1E A;  4GM9 A;  2H14 A;  1MG3 A;  3EI3 B;  3VI3 A;  4ZN4 A;  2HXC A;  2GC7 A;  4UI9 R;  4WK2 A;  3PSC B;  4FA5 D;  4MMY A;  4QRJ A;  2YB8 B;  1I2M B;  2Z2O A;  4AMY A;  1GOH A;  3OKY B;  4PSX B;  3FCS A;  4D6V A;  2AGW A;  3IVM A;  3JPX A;  4E5Z B;  2P9N C;  4CI2 A;  4BL0 A;  1UTC A;  3UVO A;  4NBM A;  4ZOV A;  3I7H A;  5HE0 B;  3UVN A;  4G1M A;  4D9S A;  4E54 B; 
#chains in the Genus database with same CATH homology
 5IGQ A;  5GXH A;  1GOT B;  3OW8 A;  5IJ8 E;  2IUQ A;  3HFQ A;  3NVQ A;  3IKO A;  1SHY B;  4L9O A;  3I7L A;  2GNQ A;  3FRX A;  3L4O D;  5EMJ B;  3C5M A;  3IJ1 A;  4PSW B;  5FA5 B;  1K8K C;  3GRE A;  1N6F A;  2HJB A;  4FHL A;  2B5M A;  5C9Z B;  2IUP A;  4JSN C;  4CZV A;  4A0A A;  5HE3 B;  3EI4 B;  5CXC A;  1S4U X;  4EWR A;  2IUR A;  3DM0 A;  5FKT A;  3RLM D;  3SWS D;  4ZOX A;  1NEX B;  4CY5 A;  4LG8 A;  3ORV D;  3KRW B;  4GMB A;  4HDJ A;  3RN1 D;  4CI1 A;  3AL9 A;  3I7O A;  4H5J A;  2OVR B;  4IMM A;  3BG0 A;  3EI1 A;  2OIZ A;  1JOF A;  4J87 A;  5IGO A;  5K1C C;  4MK0 B;  4PBY A;  3I7K A;  3J80 g;  3SXT D;  5GSA A;  2EBS A;  1B9X A;  4FA9 D;  2J55 H;  2GC4 A;  2QC5 A;  2BCJ B;  3ZWL B;  4D0K A;  2OK4 A;  2H9L A;  4CC9 A;  5TDH B;  2HES X;  4N14 A;  4X60 B;  1JMX B;  4A09 A;  5EM2 B;  4FAV D;  2CO0 C;  3SJL D;  3GFC A;  4Y7R A;  2CE9 A;  5HQG A;  2AGY A;  5IJ7 E;  3AL8 A;  4A2L A;  5HE2 B;  3BWS A;  3AFC A;  1PI6 A;  4J8B A;  3OKT A;  3OKW A;  4J8G A;  4J81 A;  3I8C A;  5FKS A;  3JZN A;  2H6N A;  4PC0 A;  4ERQ A;  2P9L C;  3VA6 A;  2H68 A;  1K32 A;  3F3G A;  2PM7 B;  3PSL A;  5TEE A;  4PXW A;  4FB1 D;  4A11 A;  3SBQ A;  3IIY A;  2H6K A;  3SLE D;  5FKR A;  3RSE C;  4O1Q D;  2H3X A;  2CNX A;  1JMZ B;  4CI3 A;  4FWW A;  2H47 A;  5FXY A;  3JZG A;  3V7D B;  4JSX C;  3PE7 A;  4H5I A;  3JB9 L;  4QL1 A;  3K27 A;  3V9F A;  4JXM A;  4JD2 C;  3A0F A;  3MKQ A;  2G9A A;  1TYQ C;  2OJY A;  2B4E A;  4J0W A;  2HYE A;  3MKS B;  4A0B A;  1GG2 B;  3IJ0 A;  3NVN A;  3SCY A;  3DXK C;  2YNN A;  3EI2 A;  3UVM A;  5GXI A;  3NVX A;  4A08 A;  2P9U C;  1SQJ A;  3BG1 A;  4J78 A;  5JWZ A;  2XU7 A;  4G56 B;  5CXB A;  4K3J B;  3I7P A;  3CFS B;  2PBI B;  2B5L A;  5AMS A;  5EAP A;  4GQ1 A;  2QXV A;  2PM9 A;  5TEF A;  3FM0 A;  4ES0 A;  5KDO B;  2Z2N A;  3UKU C;  2P9P C;  2PM6 B;  1GP2 B;  3F3P A;  5IT9 g;  3N0E A;  5H14 A;  3MMY A;  3J81 g;  2H6Q A;  2YNP A;  1Q47 A;  5I5I A;  1N6D A;  4R7A B;  1U2V C;  4YVD A;  4FAN D;  2CE8 A;  3I2N A;  3RMZ D;  2HKM A;  4ESG A;  4JSP C;  5EMK B;  4QT8 A;  4TZ4 A;  4XYI A;  4CZX A;  2TRC B;  4OWR A;  4Z8L A;  4A0A B;  2UZX B;  1OLZ A;  3FGB A;  2P9I C;  5GMK n;  3EMH A;  2Z2P A;  5CXC B;  5C2V B;  2UZY B;  4A2M A;  1L0Q A;  3L4M D;  4GGD A;  4U7A A;  1GXR A;  4IA9 A;  3C99 A;  3DSM A;  4GQB B;  3OL2 A;  5EMM B;  2B5N A;  2I3S A;  1PEV A;  2XL3 A;  3V5W B;  3DXM C;  5EAM A;  3EI1 B;  4J79 A;  5I5M A;  3UKR C;  2I3T A;  4O3U B;  2H9N A;  4I79 A;  4JT6 C;  2CO0 A;  3JZH A;  3PVU B;  2H9M A;  2Q7Q A;  1QNI A;  1U4C A;  5AFU 3;  3N0D A;  2J57 G;  4CZY A;  3EI3 A;  2P9S C;  4BH6 A;  2H9P A;  2J56 H;  3MXX A;  3I8E A;  3UVK A;  1MDA H;  4J73 A;  2AQ5 A;  2OK6 A;  3OKY A;  4FA4 D;  4A09 B;  2I0T A;  5FLX g;  4CY1 A;  4J0X A;  5FKQ A;  2YMU A;  3SN6 B;  5HE1 B;  3U4Y A;  3OTT A;  4E5Z A;  3PXT D;  4JT5 C;  3VGZ A;  2G99 A;  3AL8 B;  2MTA H;  4E54 A;  4J84 A;  3AH8 B;  4PNK B;  4GGA A;  1A0R B;  2IAA A;  5B4W A;  4U1E I;  2CN3 A;  2AH0 A;  4GQ2 P;  4XYH A;  2XYI A;  3CIK B;  1NR0 A;  4CY3 A;  5AJA A;  4A11 B;  2XL2 A;  3F3F A;  3PVW B;  5EAR A;  3C75 H;  2AGZ A;  3JAM g;  2HKR A;  3KRX B;  3VH0 A;  3E0C A;  5IC7 A;  3UVL A;  4QQE A;  1SQ9 A;  5A2Q g;  4X61 B;  5C2W B;  3EU7 A;  3MZL A;  1FWX A;  4CI8 A;  3EI4 A;  4J77 A;  2HJ4 A;  1P22 A;  4L3H D;  2IWK A;  1RI6 A;  1OMW B;  5EAL A;  2P9K C;  4CY2 A;  4AOW A;  3B7F A;  3JRP A;  1VYH C;  1XKS A;  4A0B B;  2CN2 A;  5THA A;  1XIP A;  3UR4 A;  2IUV A;  3MZK A;  3EI2 B;  4BUJ C;  2W18 A;  1JJU B;  1XHM A;  1YFQ A;  3RFH A;  3RRM C;  3SVW D;  4A08 B;  4O45 A;  5H1M A;  4GM3 A;  3CFV A;  5EML B;  5CXB B;  2AGL A;  4X63 B;  4FA1 D;  2PM9 B;  3SBR A;  5TF2 A;  1PGU A;  4O3T B;  2OVQ B;  3EWE A;  3ODT A;  1PBY B;  2BBK H;  3SMR A;  5EM2 A;  4L3G D;  3PXS D;  4X3E A;  3JRO A;  3P4F A;  4AEZ A;  1R5M A;  4K3I D;  4GGC A;  3PXW D;  4J86 A;  4JSV C;  4ERZ A;  4L1Q D;  2I0S A;  3W15 A;  1N6E A;  1ERJ A;  1B9Y A;  4KFM B;  5SXM A;  5CYK A;  2H13 A;  4OZU A;  5HYN B;  5K19 A;  4PBZ A;  3C9C A;  2AGX A;  5H17 A;  4J82 A;  4LGN A;  2IWF A;  2OVP B;  3IJC A;  3SBP A;  3K26 A;  3SFZ A;  3RFG A;  5I5J A;  4LG9 A;  4XEI C;  3RN0 D;  4GZ8 A;  4NSX A;  4GM8 A;  5FQD A;  4ZOY A;  2YNO A;  4A7J A;  2I0R A;  3OL2 B;  1MG2 A;  3ULE C;  4ERY A;  3SHF A;  3I7N A;  2YBA A;  4Y5R D;  3I89 A;  5CYK B;  4O9D A;  3IIW A;  3EG6 A;  4ZOZ A;  3DWL C;  2O9K A;  2AH1 A;  1TBG A;  4GM9 A;  2H14 A;  1MG3 A;  3EI3 B;  4ZN4 A;  2HXC A;  2GC7 A;  4UI9 R;  3PSC B;  4FA5 D;  4QRJ A;  2YB8 B;  2Z2O A;  3OKY B;  4PSX B;  4D6V A;  2AGW A;  3JPX A;  4E5Z B;  2P9N C;  4CI2 A;  4BL0 A;  3UVO A;  4ZOV A;  3I7H A;  5HE0 B;  3UVN A;  4E54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...