3V4PA

Crystal structure of a4b7 headpiece complexed with fab act-1
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
587
structure length
582
Chain Sequence
YNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLVGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHSTEEFPPLQPILQQKKEKDIMKKTINFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-4
publication title Structural specializations of a4b7, an Integrin that Mediates Rolling Adhesion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 131
structure length 582
sequence length 587
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3v4pA02
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3v4pA01
3FCUA 4WK4A 4G1MA 2VDNA 5E6SA 3ZE2A 1M1XA 4Z7NA 4IRZA 5FFGA 5HDBA 3ZDYA 1TYEA 3NIDA 1L5GA 2VDPA 3NIGA 4Z7OA 3ZDZA 3ZE0A 4WJKA 4G1EA 2VDRA 4WK2A 3V4PA 3V4VA 3K71A 5E6UA 4O02A 4MMYA 4WK0A 2VC2A 3K6SA 3NIFA 3FCSA 3ZE1A 4NENA 2VDLA 1JV2A 4MMZA 3IJEA 4MMXA 3ZDXA 3K72A 1U8CA 3VI3A 2VDKA 4UM8A 4Z7QA 3VI4A 5FFOA 3T3PA 5E6RA 2VDMA 2VDOA 3T3MA 4UM9A 2VDQA
chains in the Genus database with same CATH superfamily
1NDMA 1JFQH 3MBEB 2NT1A 2B16A 3MOAL 1EAQA 3QJOA 1U58A 1VLXA 3LDBB 5D70H 4D7BA 4QAMA 4P5KA 2CJ3A 3LZRA 4OQTH 1CIUA 4YVNA 4Q56A 4NGHH 2OS7A 3WXWL 1DVSA 3ZO9A 5CLXA 2P80A 3OW8A 1T04A 2X4NB 4B53A 1SOKA 1U8JA 3KJ4C 4LASH 2ZUQC 5EWIH 5I1HL 3K0WA 4FTVD 1C5BH 32C2B 3JWNE 4LCYA 2AGJL 3ATEA 4JSXC 5IOPB 2Z8WC 3MLYH 1ORQA 2XVKA 1OK0A 1KULA 1QI4A 1I1YB 2HG5B 4HUNB 4G55A 1D7CA 1HI6B 4EN3A 2MHAA 5EBWB 4DO5A 2OXGA 3MRFA 1MCEA 3NZUA 1Y7VA 2F54D 4S1DC 4WNQA 1ORSB 5D1XA 4ZAKA 3ESMA 1VFAA 3T4AC 4HCGA 4X7CC 1EERB 2KMWA 3HE7A 3MMEA 5ECGA 5AW2B 4JFEB 5IB1A 4U6VH 2Y2YA 1KIPA 3LNHA 3C6LD 4FAAB 4FJ6A 1L7TL 1RZQA 3HPJB 4FULA 1OE3A 2ZOKA 1JCKA 5JMOC 1A6ZA 2JH2A 3RN0D 4KC3B 3BESR 2ICWB 2J5LB 3ARBD 1BFSA 4ICXA 3OKTA 4IOSA 5I0XA 1BMZA 2BIPA 1OGTA 1VFUA 4HJTA 4LEOB 4UTBL 3UYRH 3HG2A 1E8MA 5HHOE 1FC2D 3IMTA 1KCVL 4IU3A 2E59A 1IC5L 2XNAB 4AQEA 2FO4A 1RJLA 3UAEA 1QRNA 4HLEA 3FU6A 1QI3A 5HDWA 4NFBA 2BWQA 2XWBA 1QASA 1LLAA 3W2DL 2IPTH 3IN0A 1KC5L 1T4KA 3AACA 5CINL 2HRPH 1YNTF 4UQ2B 3BPCB 2J4WH 2KERA 3LKRA 1TJMA 2W95A 5E2UL 5TTRA 3ZYZA 4CBZA 3FO9A 2CE9A 1MJJB 2QGCA 3VNZA 5B4MC 4HFWB 3VFTB 4HU8A 3ABZA 2ATKA 3NCBB 2ZPKL 2ZT9C 1FNGA 5AKRA 1BM7A 5FHBH 3EO9H 4XCCL 5T1MA 5DURD 1KB5H 5GXIA 2X9YA 3WFCH 1AQKH 2CM5A 2EDXA 4X6DB 4XP5H 2ZX5A 5L6YH 3MCYA 4XBEH 5T33H 1HCVA 3C60D 3PWLA 1NBVH 2XIIA 5F9OL 3D0VB 4NP9A 1DSWA 4ZNEA 3BN9C 5GGSY 1UOVA 3EYQD 3SYOA 3L3OB 4KJYA 3UDWC 5EC1B 3MUGB 2G2NA 4OZ4A 5DUPL 1I3UA 4PWGA 4I2XA 5HVHB 3VRIA 1YEEH 4HULB 4ODVH 3TN0A 1YPZA 1B90A 2CBTA 3SCMD 4E41A 1S7WB 3QA3B 4LCWA 1L6PA 3I6SA 4ALAL 4LESA 2XKNA 1NEXB 1RSYA 1N9PA 4UT7H 3B34A 3D0AA 2VLRB 5I1KH 4PJ7B 3MLUL 2IFFH 4HETA 4DN4L 4XE0A 5FYJH 2DQIH 5EA0H 1WQVT 3NIDE 1NR0A 1T2QH 3W0WE 1E5BA 2R39A 5IR1A 3T0EA 2IWKA 1LNUA 1KYOJ 5IJKC 2X2UA 1T5KA 1TDQA 1RLWA 1MCSA 2X41A 3MV8B 5I1LB 1KPUA 2AQ1A 1DQJA 5IB5A 1MWAA 1UZ6F 2OBGA 3IULA 2W38A 4J3VA 2NX5A 3LYRA 1DQLL 3CFNA 4L1MA 1OPGL 2VZ3A 2K1MA 3APMA 3KBFA 1DJSA 4YGVB 4ONGL 4RMBA 1T7WA 1HEJC 1NQBA 1KF9B 2C9PA 5C0IA 3MUNA 4R5XA 3D4CA 3P2TA 3K6FA 1HZLA 5C08A 1F8TH 3UTPD 1RZPA 5LNGA 4LLVA 1OHQA 3IFNL 4JGUA 1RZJH 2VERN 2WTRB 5MEOB 4RA0C 3O4LA 1S7TB 1MQKH 4FHJA 5GRYA 3PAVA 2X40A 3LVTA 5F7EH 4KROC 2EIZA 3GDCA 3C09B 4PGEB 4XVTH 2VDQL 2EQDA 4G59C 5CAYB 1JN6A 3GSWA 1YO4A 1B0RA 2GFBB 3IDMB 4H8QA 2WQRA 5A2BA 4L8CA 1NKRA 3FONB 5C2UB 3FOLA 1JFHA 2CPUA 5DQ9B 1ONQB 5IKCA 5CIPH 4BKTC 5I6OA 5AUMB 4KJWD 4ODTH 5EZLB 3FQXB 3JRPA 4BP8A 5DFAA 3IBEA 5ICXA 4KWUA 3BP7A 4OB5H 4FFYH 5KN5A 2CLVA 1ZA3B 3RPKA 2VXUH 3GM8A 3SE3A 1H6UA 4Y2LA 3MJ7B 4KTDH 1OCZB 1AG6A 1R3IH 4RFNB 1R6VA 2WNGA 1KPVB 1ZVNA 3CSBA 4HMCA 4M3KB 4XOEA 4JM4L 3SY6A 4NKDB 3BP5A 5FGCB 2ISDA 2CO7A 4Y19B 2FAUA 5CWSB 4B95C 2IPUG 3WFBL 1WFTA 1RK0B 3B9KD 4OAWA 4ADGA 3BKJH 1UOLA 3MV9D 3UG4A 2PMZA 3OLGA 4N9GB 3CHPA 5E6IB 3OLDA 3VQ2C 1R5VB 3BWSA 3K2MC 2OPCA 1CT8B 2DQFB 3MA9L 4GW4A 4YXHH 1YNKL 4LEXL 1FHNA 1JPST 1WZKA 3RDTA 2HCZX 3DV6B 2G3XA 2VR3A 5KVGL 5BW7A 1DFBH 2VISA 1I4FA 5C0BA 3ZHNA 5D7SH 5FCUL 2VSCA 3LS5L 4JL2A 5IEKA 3AXLB 3V7AE 1QFMA 4OZGB 1CBVH 2YBGA 3P30H 4PJAE 4FYQA 3PV7A 3VDCA 4E9XA 3RUGE 3DX4A 4XODA 1J0YA 2HSIA 1F1GA 4RAVA 4WGWB 5C2BL 1F6LL 1QWHA 2EICA 5DHVB 3FU9A 4YQXL 5GZOC 4IMKA 3HC4L 4O2FB 2NSMA 3FRPB 3LKQA 4IGBD 4N1HB 3SCYA 1CR9H 4L5FL 2X4OA 3QIWC 5M5UA 3DROB 3LKOA 1KLUB 4X7TA 2WOYA 1JXKA 2GTZA 2O5XL 1H15B 3IXAB 3VXME 3WD5L 4JANB 2Y25A 3FTVA 3G04B 2CNZA 1AYOA 1OK8A 3GSRB 5E1QA 1JZ4A 1RK7A 5FEBA 4G11A 2DTML 1N5AA 4FD0A 3GTNA 3TV3H 1YEIL 4KK5C 4NFCA 4X0KA 4ZUVB 1ADQH 3TNNA 3AH8B 3BWZA 5D1XC 4QTFA 4ZAKC 1RFDL 2BW4A 1LDPH 1EAPB 5KVDH 1K6QL 1WZMA 1BA9A 2H41A 1S8DA 3CUPA 3G6JB 3LEXA 3VCLB 3ME0A 4QF1A 3DI3B 3Q8CA 4EI6A 2VRKA 3VXPA 5I0ZA 4U3SB 1UWYA 2IV9A 2YPVL 2X4QB 1GKEA 5GGQL 3WNLA 2NNFA 3L4CA 4C47A 2E7LA 1DBML 2O30A 1IC7L 4Z0BL 2OJ1A 4F8TA 1JI2A 4KI5C 5EO9A 1P7QA 4HP5A 4JM2B 1OL0A 4WJG3 4W1TA 3WFZA 2VH5H 4KJPD 3O6LH 3RB5A 4YHLL 1XF3A 1D2OA 1HNGA 2XVGA 1U95A 2FR4B 1IAKB 5AVQB 4O02A 4QRQB 4NQXB 1WP6A 1IM3D 4AV0A 4PP1D 3PF2A 1KBPA 3DVNB 4WEEA 2B4EA 2R1WB 4P2OD 3WIHL 4MYPA 1INDH 4WTZG 3IRZA 2BNQE 3QZMA 4FXGA 4WUUE 1PG7X 4WTXA 3K2IA 4BD4A 3X3FL 2XFGB 2F9BT 1HXMA 3PABB 1M05B 3TGXA 1A4KB 4X4KA 3U36A 4FNSA 1IAIH 1TF4A 4QKTA 2D73A 1D6EA 3TJEH 3QCVH 4BFIA 2KHAA 1XIWB 2YZ1A 4I3RL 5I28A 1GOHA 2QTEA 4WKZA 1TQTA 3FU8A 3U48A 4TMPA 1LWJA 5DDHB 4U6TA 3P02A 1QPKA 4H40A 2IPKA 3VXNA 4WF7A 1PJWA 1YEJH 3EGSA 3H3PL 4JQXC 5EIVA 1UJ3A 4FQCL 3L1GA 3MLTA 4WLCA 1OLZA 3MLRL 2ESVA 4Y2DD 5FXYA 5HDBB 2DH3A 4L4TB 5C0ND 3TN0C 5DD3L 5FO8A 1U8HA 1TKWB 3NBNA 4KKRA 1AH1A 1CL7H 4QNPF 1R5IA 3WG7B 3QRGL 2HVKB 5TE4L 3ZMNA 3ZR6A 4DZ8B 3I6GA 3RZWA 2GEQA 1YY8A 5KEZA 4WDIA 1UGKA 1Y0LA 5ANMB 3VTMA 3CVHL 2ICEB 1D5ZA 3R4RA 3T0EC 4QRFA 1KXTB 4W9ZA 4PWIA 3LKPB 3IBOA 2Q8BH 4X6EA 3QFJB 3QUMB 1IC0A 1MAMH 3KDMB 4TRPH 2ZUXA 4EBQL 5FUZL 4UTBA 3IPFA 1BQSA 1XCQA 2Z64C 5DEFA 4TQ8A 1QSED 5BJTA 1N8ZB 1NGPH 3CFKA 3HRPA 3JZYA 3DWTA 4DJMA 5TEFA 1NJ9A 3LEYH 3NTCL 2EXTA 3ABLB 4UF7C 1E4WL 1LO0H 2ZUWA 4WI0A 3NFSL 3DX8A 4Y2OB 2XICA 1IEAB 4FQIH 2GI0A 5E8NA 2ORBL 4KI5E 1SJVA 4Z7IA 4YBLC 3PWPB 3ZRFC 4JFWA 4N6QA 4ONFH 4WW2A 3GMNA 4ODUA 1Y18B 3P11H 5HD8C 2BIQA 2GTWA 3D51A 1V3JA 3EO1B 1IQDB 1QRNE 2NY1B 4HKXB 4HAGA 5LNDA 3SDDB 3QC5X 4QRSA 1XF4A 4PV9A 5GGVL 4R83A 5CGMA 4X7EC 4XPBH 4O51B 2GSMB 4JO3H 4R3SB 2F1AA 4PS3A 3KPRB 3KXFB 1BDYA 2HVBA 2JJVA 3FQWB 3JZNA 2OW6A 2Z1PA 3H9SA 1YMMD 3GJFK 4HCIA 1JZ7A 5BVPL 3CVDA 2HP4A 2BIIA 4YE4L 2KQMA 2X12A 3KLHC 1TJGL 1BMGA 1HKFA 4JFXB 4K71B 5M61A 1USQA 4L3AA 3DRQA 1H0DB 4GRMB 3TLRA 3QZBA 4Y9GA 1YC8A 2B59B 2X6MA 3WAJA 3H85A 2IDQA 4OGYL 4TNWF 5CJOH 5L2KE 3ISYA 4PP2A 5MI0B 4UI9R 4HWEL 1BQ5A 1JWMB 4K9EL 3DSFL 4AITA 5HPOA 2O61B 4LL1A 4ZNEE 1XCTA 4KVPA 4ZX5A 4N0CC 1WJ3A 3VH0A 2FTAA 5BVJA 1D9KD 3QJXA 4QGTA 2NY6C 4ZUWA 4AEIH 3ZYJA 2AQTA 4I2XE 4W9CC 1LE5B 2HJ4A 1YPZE 2H32H 4LAQH 4E41E 4IHBA 4QRAA 3GIVB 3QCTL 5DF0A 2QZ5A 4PRHA 5LAXB 3ABGA 5KUMA 3RZCD 4JJOA 1KT2A 2PP8A 4NKMB 5FFOA 5D4IA 1WH0A 5C92A 4TVPL 2Z93A 3S3SA 4PNKB 2ICWI 3CBKB 2Y06H 2OMVB 4J3WA 3UP6A 5TK4A 1BF2A 1MLBB 3LIUA 3RDTC 3T0EE 1EXUB 2K8QA 4ABVA 3Q48A 4ENED 5BW7C 5KW9L 3G6AB 3QR0A 3DIFB 3EYVA 1L4IA 5DFWH 4BWWA 2YNOA 4A2DA 1SQMA 3LH2L 1QSFB 1R3LA 5DRNB 5AW9B 5BV7H 5ACMA 2VJ8A 7CGTA 2VNCA 5ID1A 5D8JL 4MAYB 3UG3A 4Y5YA 3MNWB 4FS0A 3DOHA 1I7TA 2EE6A 5SX4H 2HT2C 2NX5E 4EI0A 2R27A 4PJCF 5H37H 1RL1A 5TH2A 4IBVA 5CJ8A 4IMKC 4WW1A 4U1HB 2XSKA 4BQCA 5F70A 3V4PH 2VDQA 2WANA 2W8CA 5D4QA 2V3FA 1QQDA 2VKXA 3V9CA 3W57A 1RIVL 3BN3B 4P5SA 4L23A 5EV7A 3D4ZA 4M93B 5CFHA 3PHSA 1ROWA 3ZDZB 4D3CH 3LN4A 4J4PD 2BCKB 1VEOA 5C08E 1BLNB 2OL3B 5T1DH 2VERA 4IKLA 4EUPG 3SDYH 4H8PA 1P4LB 4HIEA 1O9ZA 2OJEB 4IIQC 1TG8A 3O4LE 1P4IH 3I7KA 1DUZA 2AEPL 3TH2T 3I7OA 1N6UA 3X13B 4M4PA 1N59B 4GG8A 2JK5B 5E08H 3RIFF 3LZOA 3UYPB 5T3ZD 5EF3A 2W07A 3IEAA 3Q6GL 2WZPD 1KIRB 4YXLL 4JRXD 1WLHA 5FYJU 3BLKA 5F7KC 2MQ3A 1MSPA 3ZDYE 2YD5A 1JK8A 1O6TA 1RVFH 2K45A 2QFRA 3MRIB 4KDTA 5F7DB 4EDXB 5KSVA 3S5LG 1CVSC 3N2JA 3RPIA 2IURA 4M7ZB 5C07B 4BZ1L 3BWAB 4P9HL 5B3JE 2F19H 4YHOL 1GXRA 1O6SA 1D6VH 3BZ5A 1MW0A 2Q86B 2VN7A 5A2IH 3AQZA 3NGBC 3IJHA 3CMOL 3NIDF 4WI8A 4Z7OF 3IDNB 5L2JA 2WQSA 2VYRE 5IFJA 3ZO0A 1J9CT 3OKEA 4YHIA 1DJIA 3RWCA 3RRMC 2IANB 3WDIA 2XN9B 3E38A 2EVGA 1BP3B 3O3EB 4P23D 4QHKI 4RAUA 4X5WA 4HS6B 3QUKA 4W6YB 5CZKA 5D7IE 4E9YA 3UTSA 1D5MA 3CGTA 3N91A 1FDLL 3WJMB 3QDMA 3FNKA 5M5SA 4YFLF 4KKAD 2KDYA 1PZ2A 1PG7W 3GSVA 1XGPB 5AB2A 3QYNA 5I2IB 2H26B 2GC7A 1OAZL 3ZHKA 1BVOA 4HUWA 2A38A 1BD2B 5C8JA 5EDXA 5HYIA 2H9GA 2Y1VA 4KKQA 5C0BE 2Q10A 2V7HB 1AR1B 3X1NA 1TJIL 4HQQH 3CFQA 4J8QA 1X7QA 2R2BA 4J6IA 4U6YB 1ZT1B 4NNYB 2CJUL 5IFHL 2DI7A 4HKBA 1UJ3C 3DRTA 3LN9A 1T1ZA 3OKYA 1FNSL 2G2PA 5HHXH 4L29B 3BAIA 4RNRA 1NGWA 2XZCL 3W39B 1QLRA 3ARWA 1MFAH 1Z9PA 3FN9A 3VDBA 5EBMB 3S4SA 2YMXL 3CZFB 3FT2A 5ICYB 3FUFA 1KG0B 2NLJA 7PCYA 4Y0GA 2NT0A 2YN5A 1L7IL 2J88H 2HJFA 1NC2A 1ZLWH 1GGIL 3KPTA 3MHZA 4UM8A 2OW7A 5FDYA 3CSYB 3POCA 1TXKA 2PTVA 3HMWH 2E86A 1PZ3A 2YPVA 4QT5A 3KZ8A 1QNZL 2QV2A 5I66A 4KMQA 1PKQE 2AQRA 1UEMA 4JPIA 3RFZB 2R2EA 4PXWA 2P8LA 4XP6H 3UKUC 1L9MA 3SFZA 2WZ5A 1A7NL 2IFGA 4W9FC 1F3RB 5CM1A 1MI5A 2LU5A 1G6RL 3IDYB 5IB3A 5F44A 1G7QA 3GMQA 4X5LA 1K72A 1RZIA 4WSJA 4PJDA 4X4MA 3MJ9L 3TL5A 1J86A 3WIHA 3SE9L 3EOAB 2UXTA 5AL0A 3H56A 4TF4A 1XAKA 5EB9A 5AW7B 2AJUH 4EO5A 5BV7B 5JDSA 3GF8A 4YSRA 3HB3B 3RL2B 4KUZL 3KWWA 1E7VA 2J2ZB 5I16A 3FQTA 4WW2C 4R0LC 5CP3H 2B5NA 3RWJB 4Q6IA 1ZT4A 4F7PA 4HIXL 3GB7A 4GFXA 5IBUB 4OLWL 3V4PB 2VDOH 4MWFA 1BJ1J 3WSQL 2CN3A 5I1JH 1FZKB 4PJAF 4OZFA 2NY2D 3FFCA 3HC2A 2P9UC 3U1SL 1EUTA 2PP9A 3C5SA 3GLDA 1QABA 3EMHA 1GC1H 3OZLA 1CFNB 1HH6B 3I6KB 3GIZL 3P9MA 4N1CA 5HYSB 4FLQA 2E8ZA 5AENA 2X2HA 4HJGB 2IADA 5ILTH 3MRQB 4TZ4A 3IXTB 3BGFB 2RD0A 4Y4FB 1FLTX 1XGRB 2DD8H 3EOTL 1XCWA 5DYFA 4ALAC 5L4FA 2AK1L 2OK4A 1TEYA 1NCNA 5C0AB 3KGSA 3BRDA 3S3DB 3MKGA 4YHNA 3GUTA 3CVHA 4M7LL 5H14A 2P9NC 2X4SB 1GZQB 3PCYA 5C7XH 4DGYH 3UFIA 2R0KH 1I1FB 4RGNB 5DI8A 1U36A 4MNGB 1QLEL 2ADYA 1G0XA 1N7ML 2H6PA 1WWAX 3S3CB 3NJNA 3VFNB 2A6KB 4OCWH 5CD5D 3PWVA 1P6WA 4PRNB 3OLEA 4XCYA 5FO7A 2P9SC 1I8AA 1PVHA 3M07A 4U7AA 3WLWC 4XZ4A 1DQDH 3WO4B 2ZWZA 2HKRA 2Q1EA 1DVFB 4S10A 1TQSA 3L16A 5EO1A 3LZFH 1OM3L 2CH8A 4N87A 1CCZA 3K71B 2H1PH 3HG4A 4OFIA 1MPAH 5F3HB 1R33A 3L9RB 4KGJA 4XO8A 2F68X 3VMPA 1R24B 5JOFA 4L4VA 1I3GH 5K9JL 2MPVA 2O6FA 1FF5A 3LN5B 1MY7A 1LO3L 1JNNL 1PG7H 1K4CA 1MN4A 4Y5YC 5ELIA 1DBAH 3JWNH 5FWRA 1J0KA 2WB1A 1OSYA 1Q0YH 5JPNB 2BVQB 4AV4A 3FN0L 4PJEA 5E03A 3RX5A 3OKOA 1I8MB 1XGQA 3P0YL 2FGWH 3HE6A 1WFOA 4PC0A 3VXSA 4RESB 5DMIL 3HS0A 5KSUA 3SIKA 3KCPB 4E9LA 1WFUA 4U1MA 1S7XB 4Z3HA 5J4MA 5HHNB 4NKIH 4MHHI 2ADIA 5GHWH 3SY0B 2H3KA 1HHGA 3VGDA 3FB7B 2O26U 5KJ7E 4HZ1A 3QR1A 4WFEE 3BZEB 5J9PB 3BPLC 4U0QB 5G55A 4M1DH 1AXIB 5CKGA 4EIBA 4LCCA 3PXHA 3D4YA 1U3NA 3KWXA 4DUXA 1C12B 5CLTA 1R9FA 4P8QA 4Q2ZA 3H9SE 1TEGA 1P5UB 1M7IA 2UVFA 1IGCL 4KDTC 3D69A 3WNMA 3QQ4B 2FSEB 3T2OA 4H26A 5C0GA 2OLDA 5BRPA 1FFPB 5TE7H 3MYJA 1NCHA 1WFJA 3W11C 2DN7A 4U3CA 4RZKA 4WHCA 4JDEB 4DQAA 1AANA 5B3SB 4HVBA 1KWKA 1Q9OB 4FKEA 4GKNA 5CP7B 5EZJB 3WXVL 5F6IB 3VD1A 3L3IA 4PW4A 1MHHB 3OHXB 4TKWA 2XFXA 4YFEA 4UILH 4ZFOL 2EXSA 4H0IA 1A1OA 4UB0L 4I1RA 3GRWH 4IBQA 2DL9A 2YA0A 4C83B 1G7JA 1SDDA 3MV7A 1HAWA 3DHUA 3KLDA 4N2AA 4PRHE 4KKCC 3BUTA 4UM9D 5HE2B 3TTSA 5GGVY 3TT3H 5T1KB 5DYOA 1HH9A 1LO2L 5SWSA 2CNYA 5BS0A 5CSZA 1YN6B 1WSST 2VCOA 2VDOB 4RIRB 3EOBB 2OK6A 3O3AA 2GJ6D 3TASA 1S9WA 2DYRB 3MLVH 4KI5F 1XR9B 4K4KA 1A9VA 5E4IA 2CM6A 3UYOD 2P24A 3SD5A 1LYQA 5DR5H 3CG8A 5EIIG 3B83A 2FBOJ 2R4SL 5KYNA 2JIXD 1B4RA 4PJFF 4PJ9B 1FAIL 3RTQA 1B4LA 3RGBA 5PAZA 1GS7A 2VMCA 5DJCA 2EH8L 5F72S 3SGKA 3UTTD 4PJBB 3QZNA 2CKNA 3P77A 1X5JA 3DSMA 4HEPA 3VRJB 1U3HD 2QHLA 3MUOA 5A2AA 3C5XA 4PYGA 2X2IA 4FQQB 3D9AL 2BY3A 1FL6B 3ES6A 5D71H 1BXUA 3GHBH 1N6VA 1X6LA 2AAAA 3O3UN 1HIMH 3QJFA 4WHTB 4NC0B 1BFVH 4BZ1A 4XN9A 1LXMA 3TEZA 5I1IL 2AEQH 5A1AA 4JFDD 5M94B 3D07A 4XBPB 1SJHA 2WXLA 5EO0A 5ITFA 3QFDB 4MX7B 4JY5L 5I30H 4FG2A 3TU6A 3NIFF 4RFOL 3HBZA 1O6GA 4DWHA 2APWA 2C9XA 1PD0A 5IIEA 1YPZF 3TO2A 3PFQA 2YK1H 4KK8D 4F27A 2OMBA 3O2DL 3T65A 1L5GB 1MCFA 3OKKB 3EH4B 1SJXA 2YD8A 2PM9A 4KZ0A 2Z3FA 4JB9L 1H8LA 5BOPA 4FMVA 4N2KA 5FECB 2B0SL 2OSYA 4AH2B 4FL4C 1B3JA 4B3EA 3GHPA 4Z7UA 3NUKA 3PL6B 4JDTL 4NZJA 5I0YA 2VUKA 5I18H 4N68A 5F3FA 3W9EA 2H1XA 2NW2A 4Q6IC 5KVGE 4A7JA 2YD2A 1B2YA 3PWNA 4J3OG 1KJ3L 2HT3C 5FA4A 5K1VA 3RA7H 5FKRA 2QPSA 3DO7A 4P2AA 1T0MB 4FQXA 4NRXA 4YE0A 1T83A 1BVNP 3UZEA 2BJML 3UTSE 4HXBL 5INCA 1TYEB 4A09A 4MD4B 4UANA 2HH0L 4LEBA 3L3KA 5KOVC 1EO8H 2XX0A 5I8EB 4EJ1C 3M1BA 5D55A 4L5FE 4K8RD 1NPUA 4RGMB 3WHXB 4A7SA 1A6WL 2VM3A 3OQRA 4XXWC 1Q9LA 4KRMB 4FA6A 3O6FB 4F7MA 1Q94B 1WEJH 4FRWA 4I77H 1YEKH 4WRLA 4XO4A 4OVVA 3ROOA 4B5ZA 1MG3C 2ENSA 1MY5A 4BWUA 4H7VA 2NXYB 1UD6A 3WCYA 1WIOA 3TC9A 3FB8B 4HT1L 3MBXH 1J5OL 4JHNA 3EYFA 4PBZA 2BC4B 2VDLL 1G6RA 1X5IA 2GY7B 5B1KA 4MCNA 4B3VA 3EU7A 3PY9A 5E94B 2D7TL 5DK2A 4YJZL 1OALA 1W0VB 1F4WL 3MJ9A 1KBGH 4D6VA 1JRHL 4Q0XL 1WZ1L 4RMUA 1YDPB 3HFML 1PJ9A 5JXAH 3HUJB 2WMPB 3DETC 1E5AA 4U05A 2CU9A 4ZUTB 2BKLA 4XPTL 2ENJA 4FABL 1FZMB 1NCDH 4HMDA 4HUCA 5AOZA 1USZA 3JWOC 1VEMA 2PCFB 1JGUH 3WY3A 1PD1A 2PO6A 2D03H 4HFUL 4J3BA 3U9WA 1J88A 3HG1E 4APXA 1U4EA 3CZGA 3ISRA 2EYRB 4N2GA 4PJDE 1DJZA 4X4ME 1HXYA 4HH9A 4FADA 1SVZA 3U83A 3TVMB 1UB6B 4EI5B 4K9JA 4NAAA 2QFPA 2VWEC 1SXNA 5INDA 3V6ZA 3QNYB 1KCKA 4JN1L 1J0HA 3HE6C 3OKWA 2WJ5A 3KJ4B 4DGVL 1G1CA 2ZUQB 1UG9A 1TLMA 3HS0C 3PFUA 4P3CL 1Y6KR 1UUNA 1MH5A 2BY2A 4GS7B 1F86A 3UBGA 3U2SA 4ZDHA 2X89A 4ATTA 5IB2B 3KYAA 2FYYA 5F1NA 3ARDA 3GXUB 3QBTB 3SXTD 1TMCB 3FFCE 4Q6YA 4U6HA 3VSUA 5FUOH 3IDIA 4LCCC 4XNYH 3D3VA 3ZKXB 3VD3A 3S9DB 2VAAB 3VQMA 4EAEA 1QW9A 2UY7B 5KZCD 2MIZA 1SM3H 4NO3A 1YYMH 1N3NA 3RWEB 4LIQE 4X8GA 2OYKA 4FMFA 2GW5A 1SNRA 3S4SG 4E54B 5E8PA 4KQ4L 1SHWA 4LARH 2XXMB 2QGBA 2YPLA 3DHJA 1OKEA 3V0HA 4FNRA 3B6SA 5GGRA 4PB9H 3HS9A 1OAXL 3ALWA 5DO2D 2ITFA 4LSTH 2G9HA 1XGUB 1T21B 3GDBA 3UCQA 3SDAD 3UVNA 1NBCA 3OJVC 1MREH 3GZKA 4POYA 4L4TD 1WK0A 1IEHA 1E8WA 3D06A 3GFUA 1RZKH 1U8KA 1W2KT 2H3NA 5JIMA 2PYFA 2YC1A 4RRPG 4CY2A 5B1CA 1GYVA 5JHLA 3IJYB 4HJJH 5K1NA 1I3VA 1MELA 1WA0X 2V5MA 4EDWH 1H2WA 1UOWA 3MXXA 1XZWA 2CRYA 3LKNB 3H0TA 1E6JH 1VIWA 1NCAH 2DI8A 3CFUA 3NCEB 1EJ6A 2Q3ZA 4JY4B 4YFDB 3ARTA 4YX2H 5I24A 3VMNA 4JREC 1ZWIA 4L8BB 4OBSA 3WEBA 4L4VE 4JNXA 3MN8A 3MRPA 1SYVB 5JWZA 1BFOB 3HI1A 2ZKMX 3IF1B 1NCJA 1I9IL 4KPHL 1QG3A 2WINB 3V0FA 5LVEA 3BRGC 4HF5L 3ZTJG 4NBYB 1DE4B 2GEEA 3QC6X 1PFOA 1RJYA 1DDHB 1MRDH 5IF0B 4MGXA 2Q0ZX 4UDUA 2VB5A 3SGKC 1I8KB 3WV0A 2ILLA 2LV4A 2VWEE 4K07A 1BOYA 4PJEE 5ICUA 3VO0A 1W80A 3ASOB 3IS0X 3SJVD 5K39A 3IVMA 3VXSE 4D8PA 1JF1B 4G9FD 4F58L 4U1GC 1IO4C 2A73B 4C4KT 5F6HJ 3KWUA 1TCRA 2GITB 3TO4A 3AABA 4JK0D 4JPWL 4MMZB 3HR6A 5GGRY 1KELH 2EJ1A 3QJQB 4HJUA 4CU8A 4Q9QH 5EHFA 3SKNA 2WXMA 2VLMD 1CFTA 4ETYA 3OX8B 1ZSDA 3VWJA 1EH9A 4PGDA 1NIBA 4U2ZA 5GGTL 3RUGB 3G08B 3RY4A 4Z7WB 2VLLA 3OZ9L 4OCSH 1JGEB 4OGAD 3GMOB 4D0CA 1LEKB 3FFDA 3VXRD 4ZFOA 5I1AB 1TU2A 1H8OA 1IGIL 1E28B 1H3PL 1YECL 1AZUA 4O3UB 2JV6A 1ZDQA 3QEGH 2BWDA 3O8XD 4POZD 2UZYA 4F8OA 1CG9B 2CLRA 2H6NA 1F3JA 3DIDA 4MAUH 1X4XA 4XCNB 4IOIA 3BP4A 1AHWB 3RHWK 3FULA 4TVPE 2YBRA 2ZSWA 5DVKA 3FCUB 4I13B 1KTCA 1KCSL 1NLDH 2BNRD 4JHWH 4G8EB 3EI1B 2AV7A 1I85A 1VPOL 4XPAH 2F7OA 2DLGA 1NUFA 2V17L 3LPWA 4MXWH 3H9HB 4IKKA 1S3KL 3AADB 3MV7E 1T83C 2WWMD 4AYDC 1NAML 5D1ZA 4QMEA 1AD9B 3SB3A 3U30C 4X4ZA 5GS1C 3AU0A 3GQFA 8FABB 5SWSE 1MW3A 4X7FC 5BS0E 1IM9D 4P4KB 2R29L 2ZYSA 1N6EA 3U82B 4YDLC 4G6KH 1HOCA 2CQVA 3ULUL 3VD9A 1MCKA 2X4TA 2XTJC 3EHBC 3BUDA 1J5CA 2E74C 1RMFH 1QEWA 5T1LD 4X5XB 5I82A 2OMXB 1A64A 1PGRB 3BH9B 4JFVA 1DDTA 2V0AA 4RMQA 4WW2F 3SOBH 4IMLA 1C8PA 4F9PC 3S34H 1NIDA 1NFAA 1QO3A 4AXWA 3KNBB 1E2VA 2ITEA 3BD5A 4GM3A 2G75B 5JA8B 2WUBL 3Q3GB 4JY6B 2DW5A 3X3GH 2WZAA 2BP0B 2DLTA 4GI6A 1KCUH 2YKLL 4MA8H 2G60H 3QCUL 4WUUB 1J8HD 3TBYB 3C5JA 2LAGB 2BINA 4ZO9A 4R97B 4LG9A 5KTEH 5IGXH 1WBXA 1MFCL 3OXRB 4J79A 4FQ1L 3BVXA 4EEEA 1SXCA 1JGLL 3MNDA 2CDEA 2KLSA 2APVA 4TSAL 2BFVL 1MWAH 5EN2B 5MEQA 1ACCA 3V0WL 3O2DA 4OW6A 1T0NB 2PTUA 4OUUB 1JHTB 4GG6E 2YXMA 2B2XH 4S0SD 5D4HA 5BZWA 1TPXB 9CGTA 4EQ2A 4DP9X 4AYFA 2A3TA 4LLUA 3SQRA 2EXWD 1JZHA 2PO6C 4PJGE 3GBMH 4TS6A 1P7KA 3I02A 1NDMB 4Z76A 1D5BA 4NAJA 4MQXC 5IW6B 2BP8A 3QIWB 5C07D 2F54A 2VN5A 2AGLA 1XCXA 4GW5B 1UM6H 4XB7A 5DRWA 5E5MB 3X2QB 4ELMA 4Z3IA 3L54A 4KMTH 4Z7UE 2NUTA 3ZXAC 1BZDA 4A0AA 3FO1A 2VRQA 1I8IB 2QVFB 1AE6L 1FUNA 4Z77B 3D2UB 4PRIA 3QB7C 5JOPD 4UCFA 3GSXB 2J20A 3QAQA 3C2AH 5GGSB 4HZAA 4JZJA 2VDML 5DS2A 4UTAL 2W9DL 3ARDC 1IQWL 3D34A 1A0QH 5BRZB 1UQSB 2WLKA 1HCYA 1C16A 3MMEB 4EMZA 4KITB 4I0PC 2AQ3A 2P5EB 2CGRH 5DC0A 1HHKB 3F5WB 4HGKC 1Q0EA 4M61A 4Y5RD 4MS6A 4DUWA 3ZE0B 4FNPA 2H9MA 1XF1A 2ZOKB 1BD2D 3MJ8B 3EI4B 2XTJE 4JFHE 4QO1A 3RIAK 5B39G 2A9DA 5HGBA 4I18A 2P5PA 3HVDA 2D3NA 4GBXA 4NQQA 2VDLA 2Z7WA 4JFOB 3ZTEA 3FQNA 2FWOB 5A2FA 2PCPA 4QRRA 2A6DA 1PLGL 2AANA 4I3GA 4ZXBD 2YWZA 1FVEB 3QDJA 5D2LA 3VI4A 1HN1A 5JHMA 5C0CB 3ULAB 2AJZA 5GS0D 4MQ7A 3MRKA 4ZBJA 4AQEB 1DN2A 1XR8B 3K74B 5ETUB 5IHUL 1KLGB 1H6FA 4A2LA 3F7VA 5KSAA 5DVNA 3T77B 1ZCRA 3LH8A 4N3UA 3O2WL 5KBPA 3MRHA 1HYRC 1E90A 3EFOB 4TN9A 3LIZL 1LK3L 4D9SA 4Y4KD 2H6OA 4AC2A 1KFAL 3FT0A 1U21A 4LVOC 4XR8C 3DJ9A 4MRCA 3NMEA 4NUGH 4L05A 5IVZB 4EUPB 3SSGA 4H5IA 1WTLA 5DHMC 3L08A 5T1MB 5TEEA 3N0DA 5JPMB 2BMKA 3CDZA 2CBQA 4QAWA 5L2KB 3MJ6A 2WWKO 2AFNA 5EU5A 3KRWB 4GAJH 5E2VH 4LLWA 5SWQA 4XXCA 5DJZA 1EFXA 2AI0L 3ORJA 4KJYB 4RWHA 2ITDB 3OAUH 4OZ4B 5HGGS 4DN3H 4PG9A 2ICES 4XNQB 2P43B 4J86A 3VRIB 4XMKH 2G2RA 2BM3A 5AAPA 3PGDA 2X9ZA 3HZVB 3S5LB 1XHMA 2N3JA 3L3JA 4E41B 1AFVL 3A6OA 3FXIC 3L2NA 2QSCH 4OTXH 3DXAE 5T5NG 2X53A 5F1SA 1TUPA 4ZQKA 3RI5F 1JXJA 3V4VH 1FO0B 1D5IL 3C9NA 1A6UL 2F1EA 1KOAA 4GJTB 3G5VB 1PSKH 3PP4H 5GISH 2NUPA 4B7IA 4Y9FA 1WBYA 1J11A 1X5HA 4TTGA 1QBLH 2PTTB 4TOYL 5HJBA 3WE6A 4YLBA 5FW8A 1JE6A 3GMLA 4JPVH 2MTPA 3QJTB 4ZTPL 3Q06A 3VWJC 3P3TA 1KPUB 3D3VE 3MRBA 4R4NC 3QUYA 2AXFA 4ELDA 1TT6A 3NK4A 2HTKC 5AOMA 4FG4A 4O02H 1VACB 4H44C 4NSXA 3STZB 2FJHB 2Z65C 5CJBA 3G6DL 2YPLE 4YBLB 1KN2H 4POUB 1SQ9A 4BH6A 3KPOB 3NZHL 3P9LB 4ZW5A 2Y22A 2BP5M 4P2QA 1JK9A 5MP6H 3UEZA 1MNUH 4DUVA 1ADWA 2WXPA 2GABA 1GA2A 4BH8B 5DU7A 1I85C 4BHUA 4WFFE 2NNAB 4Z5RA 3SHSA 1MCBA 4FQHA 3WXWH 3SDXA 1YEDB 3L13A 1GTFA 2YQGA 3DX6B 5IMKA 1MCRA 3HC0A 1B0RB 4FQ2L 5D1ZC 5I1HH 3IKOA 2KS0A 5GPRA 4WO4A 2AGJH 1LEIB 1NBZA 5IKCB 3ZDYB 4HPHA 2DBLL 2FE0A 4XVSL 5SWZD 2VDRA 1H19A 1AS8A 1OO2A 4M8QA 2D0HA 3B9KA 3KLLA 3NSCA 1IFHL 3MV9A 5C0EB 4XMUA 2DJSA 4WU7B 3WNNA 2FX9L 4R5TA 2OTWA 1SXAA 3VFPB 2RAMA 5LBSH 4M02A 5TE6L 3X11A 1WDAA 4A0BB 5HVGB 3F64A 4X4XB 3IAGC 2V2TA 3IVKA 1KB3A 2IOOA 4LP5A 1NCGA 1JD9A 2YAEA 3CC5A 1ICTA 4BK5A 2VT0A 1W8OA 5H4ZA 2G9AA 3BFOA 3F01A 5GGTA 5D7IB 3E6FB 1W0YT 4UTBH 3MOQA 1YR2A 3MKQA 3IJSB 3B9VA 4GP4B 1IC5H 3NFPB 5KYYA 1EEUA 2LFEA 4FG0A 1A6AB 1DCLA 3QIBA 5DD6A 1RP8A 4E9VA 4IEFA 1HFUA 2VDKL 4MBOA 1P0SE 3ALPA 4I9WE 1I4FB 5AFAA 5CINH 2Z8SA 4HBCL 4E9RA 5IEKB 2O93L 3KVPA 3ECBB 4FFVD 5E2UH 1MHPL 2HFFB 2IAMA 3VXUD 5AW8B 4Z7NB 3ILEA 4GEIA 4WO0A 5E0QA 2ZPKH 3TV8A 4N25A 3LMJL 3MRRA 4FZEL 2QLYA 4NJ9H 1K3IA 5KS9B 4PS4L 3ZT6A 1TJHH 3LKQB 3NZSA 4H8HA 4HHAA 5D7LE 1JYXA 1NAMA 3MRNB 2Q2LA 1MFDL 4RWYL 2XWJB 1CDYA 1I7RB 4M3HA 3F3FA 1U8NB 5F9OH 5AAMA 4X7TB 3UC0H 3ZHFA 3AZUA 1MVYA 2R29A 4ODHL 5F7HA 1OTTD 4CVXA 1HINL 5H4YA 5DUPH 3BAWA 4IIQB 3OXSB 3ZDXF 4F7MB 2GBUA 1TVBB 3FHEA 3D39A 1IEBA 1PKQB 1J9QA 3PIQA 3BEVA 4GQ2P 3H6JA 5HQGA 5JHDB 4JRFA 4JZJC 4ALAH 1ZVHA 2DQTL 1P2CB 5G2NA 1SLWA 5TFSL 5I76A 4G6JL 5BXFA 5HJ3B 3V4VB 3UO1L 3MLUH 1U8OA 4DN4H 3RY6C 2N01B 5LGYA 4K7PH 4FAND 1U3JA 3K6IA 2PETA 2X5PA 1EJ8A 3T6ZA 3P4MA 2WB7A 4HJ1A 4RZCB 4AK1A 4YDZA 4PJEF 1EMTL 5I0WA 2MKWA 1S9VA 4P2OA 2GUOB 1SPDA 4G6FD 3WY4A 4BKSC 4I18C 3LKSA 2ADJB 5LNEA 4OGXL 3WFHA 1T1XB 1UXLA 2VW6A 5IV2B 4RETB 5F7BA 5L0QC 4PJ9D 2C1OA 4NC4A 2PABA 5TF1L 1NTDA 3GGWA 1DQLH 2OTUB 5E95B 2EECA 4XNZC 1FV1B 1OPGH 4PRAB 3N85H 3S98A 5JIDA 5KSAC 5HE1B 2OQJB 4LOUD 4ONGH 4QRPA 3S96A 5AD0A 3TCTA 4MCZB 3IN2A 2VITA 1MFBL 4G8AC 4R7LA 4GM9A 2ZWKA 1XWVA 1TENA 3US0A 3IFNH 3U36B 4RMWA 2F6AA 1AHMA 1RJZA 2C7FA 4G7QB 3ARFA 1INQA 3BOVA 4UDTA 3VJ6B 4KVNL 3O6MH 2Q8AL 3SCMC 1GP2B 4E36A 2VDQH 4P5TA 4R26L 2CKBL 2YA1A 4IK6A 2IPKB 1A2YA 2BERA 4FTVE 4BXVA 4JW3A 2BSBA 4XXCC 1Y1DA 2X3AA 4J3TA 1JGDB 2VDMA 1CBJA 4UTAA 3F8UB 4LSSL 3UGEA 2ZG1A 5AOKA 2F54E 2GT9A 4F1ZA 2A4CA 4O58L 4DEUA 1M7DB 3FT4A 3SBPA 5A3ID 4G6AC 1KIQB 5DUML 5I5RA 4ELME 3LHAA 1YY8B 5ID0A 2DWEA 5C71A 1IAIM 5E24E 2IG2H 1HKLL 3IK2A 3CPUA 4NKOA 5HHME 2PUQT 4FJYA 4JM4H 4IRSB 4PRIE 5FUCC 5CEXA 5D7JD 4OFYD 4XVUC 2FECI 3AXIA 3DMMB 3WFBH 2WBXA 1JOIA 1XD0A 4NNXB 4XPFL 3QQ3A 1UWXK 3B3IB 4CI3A 3MLZL 1T1YA 2XVBA 3QUYC 4GLRI 1Z3GH 4MBRA 3MA9H 2FJFA 5AKTA 4DKFH 4LEXH 1BVKA 1IE5A 3NVQA 2IDCA 4AGLA 4J8RA 2PN5A 2DQUL 5F1OB 1NCUA 3WBDA 5BO0D 5KVGH 3P69A 2K9UA 3DX8B 5D2NC 5FCUH 2N7SA 5E8EB 3U4AA 2P5WB 3K6SA 5AFU3 2PXYB 2D7MA 3LIZA 3LNFA 2F74A 1BAGA 3E2HC 3AQDA 1AJ7L 3GSQA 2RTTA 1E27A 2J21A 4YDKL 1O5PA 3GMNB 4R0LB 5EIIB 3TFKD 5D2LE 1VFBB 1YMMA 3BT0A 5C2BH 2XWDA 2DWDB 4DOHB 1H5BA 2NXYD 1E65A 4KJWC 2W80C 4EOWH 4LVHB 4PN6A 1G0DA 4L5FH 4WHYH 1NH6A 3V0AC 4P46A 2ICCA 2D7OA 1OT4A 1YJDL 1XF2B 1IGTA 1RPKA 5CHNA 1BGXL 1R3KB 1SZNA 2O5XH 5A16B 3WD5H 1MLCA 2QADD 2XXGA 3ESNA 1D9KA 2P47B 3ASWA 5F88A 2F5BL 4YL9A 4OJCA 2B77A 1JV2A 3E80A 4LPCA 3ARGA 4P57A 2BZCA 3VH8A 4F24A 1DBJH 3NJFA 4TNVF 1YEIH 2Y23A 1J5HA 3KPMA 3EXLA 2MCG1 2EKSA 3B9KC 2FT7A 1RFDH 2QR0A 4DZBB 4Z7UF 4MJIB 9PCYA 1SN2A 3N1MC 2Q6WB 2ZX7A 1Z9NA 1H9DA 2XDHA 4IQHA 3DJTA 1RPUA 1I1AA 1I9JL 2Z34A 1K2DA 3F7KA 5IQNA 3L1FA 2I85A 5EU6B 2KPWA 1RP9A 3LZQA 3WUWA 2YPVH 1A5FH 2EE0A 4JSVC 3PAZA 4KTEL 1DBMH 2MEJB 1IC7H 3OG6B 4E5XG 4Z0BH 2UZXB 4JGJA 4PRHB 4MDIA 2XX1A 1AO7D 1I82A 2WLZA 2OMZA 4CVZB 5E6RA 1U93B 5DD5L 5JW4R 3C75A 4GUCA 3CZUB 5FUCE 4B6ZA 4BDVB 1OCWL 3QIBC 2NY4B 5C97A 3OG4B 3IPEA 3WIHH 2ZQKA 4JFZL 5M7QA 4E9QA 1QFPA 3J07A 2VLKB 4KRPB 4NBXB 3X3FH 2VL4A 3D25B 1RURL 4L3ED 2XPYA 4XNMB 3UADA 1BF5A 4LHUD 1AMYA 1WHOA 1BECA 5ID1B 1CIDA 4J4PA 3DVGA 5E9DA 2IAMC 3FH8A 2H47A 2BOBB 5F9AC 1HESA 1NEZA 4U1SA 4OFDA 4NT6A 1AXTL 2NSQA 3E8VA 5EG6C 4WW1B 1RK1A 5D2NE 4KKZA 4L8DA 2FATL 1FNFA 3WTYA 1J05B 2G5BA 3FHAA 3HTLX 5E1AA 3N42F 4F80A 3BUIA 4OZFH 1D5XB 1LO5A 1MUJB 1QQDB 5EU4A 1QSZA 1Q9WA 4Y4HA 2IC2A 1HQ4B 2J1YA 5AAMC 4F9LA 5K9OB 3ESPA 4L3CA 4P2QE 3H3PH 4CU6A 1KLFA 3VDAA 4F15B 4JRXA 4X6BA 3ULUC 4U7MA 2I3TA 4OQTL 3KYNB 3CXFA 4LIQH 4JMXA 4NRYA 1VKXB 1C08A 2QJDA 3SDXE 3HZYB 4J2XA 2OV0A 3QRGH 5TE4H 5EWIL 3L3DA 4JO1L 3BAEH 4OF8A 2X0WA 4GSRA 4KJPC 4AW7A 3FB5B 1QFWH 3MLYL 3CVHH 2RJMA 4BRJA 3L8QA 5KUKA 1FRGH 3EXJA 3NEOA 5KSVB 1T0PB 4NUPA 3LRSB 5K33A 2J43A 4NCC1 3MPCA 4P2OC 1HOEA 3RPIB 3IJ8A 5L4JA 3O9WA 4ZMWA 3NVXA 1EHNA 3ROLB 2W94A 5FUZH 3MV9E 1O6SB 4NO2B 1HK6A 2X38A 4WSKA 4CDHA 4D9QD 4J77A 3BG0A 1UWGL 1MCWW 3II3A 2AXGB 2P8PA 2VDKA 1KCRL 3MKKA 1E4WH 3RWCB 3UVLA 1F58L 2VZOA 3NFSH 4G8GD 3T04D 1E9PA 3NJGA 2LOEA 4KOBA 1TQBB 5EDSA 3CLFL 4UAHA 2ORBH 1G9HA 4NBZB 3CE1A 2JNZA 4WCYL 3QH3A 2Y7SA 1BZ8A 3JWOH 2Y1AA 1PYWB 5AW6B 1B9ZA 1B0WA 5CCGE 4FNQA 3IU4L 3TNMB 1DR9A 3SPVA 3HNTL 4JX0A 2YXFA 3OL2A 1AIFA 3BP6A 4UV7L 3BUYB 1JZGA 4MYWB 5DJAA 3RAJL 5GGVH 4K8RL 1XH3A 2LU4A 2EDRA 3TWCH 4P5TC 3TJHD 3T3MA 4CI8A 2VRAA 3PV6B 4BELD 2ZUYA 1U8IA 4UNTA 5BVPH 4YE4H 4M8UA 4HKBB 2Y6SD 5BQ7A 1TJGH 2WY3B 3OKYB 2B5IC 2MTAA 4RNRB 3MVDK 2OMTB 4GB9A 1E5YA 1E67A 3S4SB 4OGYH 3KH4A 4MJ5B 3HI6L 2ZP8A 3DSFH 3X1GA 5MENB 4YLQT 4G7SB 5FA3A 2GSGB 1BZOA 3QHZL 2NY5L 3ZKMD 3ULUE 3L95A 4PSXB 2ZX9A 4C4KO 1X5LA 5ESVB 3UPCA 3FUEA 4GKSB 3D39E 1A8JH 1OWWA 2FIKB 4JPIB 3QCTH 2AJXL 2YRLA 2OMUA 4FTDA 1PX8A 4O1QD 1H3GA 1OF2B 1V54B 3A6CL 2VR5A 4WK2A 3ILQD 4Q74A 5FYJL 5JLZB 1B4JL 4J27A 3SO3C 4GRLB 2AXJA 4TVPH 3V0JA 1G7QB 1T5WA 3HG1B 4NJAL 4FEIA 1JNHB 4PJDB 4ONHB 4DP8X 5J7CC 3AG3B 3ZGHA 5DJXB 4TTDC 2R1YB 4JKPL 5KW9H 1QUNA 5TDNB 3MREA 4BINA 3ZT5A 4LRNL 2GVYA 3LH2H 4DEPC 2E0PA 2EDJA 4FQLL 5D8JH 3HHSA 4KVCH 2KI6A 1LILA 2R1XA 4NQUA 5C9ZB 4QTIL 4UQ9A 5I8CA 3MNMA 3VFMB 4XWGH 2J7LA 1COBA 1Z5YD 1JIBA 4LSRL 4Z7VA 3K8LA 1H5BC 4AT6B 3H9ZA 4JVPA 1KTRL 2GKIA 2CKBA 3M7FB 3PNWA 4P46C 1T80A 1U9KA 5FOJA 3L5JA 3GMPA 4LKXB 3ZKSD 2IOIA 2V5TA 5J1AB 1G94A 4P2RD 3IJ0A 1RZJL 3MBEA 3RX9A 4RBPK 1D9KC 4JHAL 3N44F 1JSYA 2WZ6A 1BIIB 2D3JA 2VSDA 3BAXA 4M8VA 3ARGC 1NANI 5JYMA 3EJRA 3GBNH 5E99L 2AEPH 4KH9A 1IT9L 3EH1A 4XVTL 5D7HA 1JXDA 1XGYL 2X4NA 1NGYB 1M53A 2Z91B 32C2A 1KMGA 3FUIA 5IOPA 2IMNA 4WI5A 2W81C 4OF6A 5AQ0A 1I1AC 4YXLH 4ZMPA 1GG2B 4ODTL 1GJIA 3QISA 2HG5A 1GOTB 1AQDB 2JJWA 1HI6A 4OZIB 5EBWA 4NOFA 1OAKL 3CBJB 3BPNC 1ORSA 2H6PB 4ENEC 5K59E 1KYFA 5FO7B 4IK7A 4YHOH 1BSIA 1OM9A 1PIFA 2WP3T 4JFEA 1E7UA 7TAAA 3ZTCC 4KTDL 4Q58C 3RGVB 4J3UA 4ZTEA 3CMOH 4FNLH 3MROB 2QMJA 3HPJA 5DTFB 3DV4B 3NEXA 5DUBB 3US9A 4YHML 2I07B 1QVOB 4R5VA 4EN3D 5IJ8E 5FC9A 5LXGL 1PY0A 1AGBB 2ICWA 1IU1A 1IILE 4A68A 5JOFB 1P7HL 1GIGL 4QRBA 4TNGA 3MACL 5BRZD 1CF8L 3QUML 4LEOA 1IGYB 3BXNB 4A37A 1R19A 3BKMH 3ATAA 3NSDA 4MKTA 4V1DB 2KT6A 4PTUB 2L7JA 1FDLH 3T3PB 3WIAA 3WO3B 1ZK9A 4YXHL 4J4PC 5HVWA 1Z0MA 1UYWL 2PM7B 4UOW1 2H47C 3NFNB 4G5ZL 1OAZH 5I1CL 2BFGA 1DFBL 4NQVB 2CHDA 1DSYA 1K8IB 4XH2B 2QQLH 1WAAE 3EGXB 2AMGA 3RRQA 4CW1B 4ECNA 4UQ2A 1WVZA 5KYXB 3BPCA 1FG2B 1DVQA 4XWOC 1TJIH 1GH7A 3SE6A 3ZE2F 4LSQH 4S1QL 1MJJA 2K6ZA 3NYKA 4NN7C 4ENZA 5KSUB 2E7CA 4XEIC 2QPFA 5C0CD 5E2JA 4F9LC 1YMME 2COVD 4HFWA 3VFTA 5IFHH 3F3GA 1BEXA 1FNSH 4KFZC 2VUYA 4BFGA 3FMGL 3FBKA 3U4EA 1HZHL 4JDZB 3EWEA 1ZXKA 3GO1L 4X6DA 2H1LM 2YMXH 4PJ5B 2Z92B 4R7NB 4DEWA 2A77L 2Q76B 3D0VA 3II2A 3H42L 3MYZA 3Q5TA 1L7IH 3L3OA 4NZRL 3HI5L 3MUGA 1GGIH 5EC1A 3T0VA 3UCRA 1NDGA 3EBGA 2EIDA 3HPLB 4XMLL 3Q44A 2WXKA 4RX4D 3GC3B 4JKNA 1S7WA 3QA3A 4ANUA 5HVFB 4LBEB 2OVPB 5DK0B 1FNEB 4ELMF 2WSKA 2EDWA 4PJ7A 4QLWA 4UM9A 1A7NH 4JAMB 5G4OA 1G6RH 4OLEA 5AL8A 4B5EA 3AT9A 1QTSA 3X1BA 3OB0H 2HLFC 3L4TA 3ZOAA 5DEGA 2FQFA 4PMFA 3SE9H 4FMKA 3EKCA 4ORGA 4WWOA 4L3HD 4WI6A 4CJ1A 3MV8A 5I1LA 2LE9A 4KUZH 1EBPA 4LDCA 2WSDA 2CDGB 4OZHA 1MCLA 1V5JA 2JIXA 5SWSB 2W92A 5MERB 5CSZB 2Q87A 1ZK5A 2RMNA 5EOQL 4GRWF 4HIXH 3WSQH 2P3YA 4OD1L 4YGVA 3JT0A 1U4CA 3GFCA 4N0YL 4XMTA 1IVLA 5KVFE 3PSLA 3UROR 1WBZB 4KHXL 5E1IA 3VI4F 1WE5A 5E9DE 3GIZH 1GXEA 1GMIA 2BSSB 3SWSD 3P4NA 2WTRA 4DNLA 5MEOA 4OQTA 3QCVL 4EIGB 43CAB 1S7TA 4JEGB 4B0MB 5BNXD 3OF6A 3PP3H 2IO5A 5B39B 3Q1SL 2GFBA 3IDMA 4U1GB 3FONA 5DQ9A 3CU1A 4M7LH 1AGCB 1ONQA 4EZKA 1U2HA 3CPLA 5AUMA 2OL3L 4HISA 5EZLA 4JRXE 5A2CA 5ACZB 3VH8G 3ATDA 4B9ZA 5DZJA 1ZA3A 4ZZFA 1N7MH 4NO0B 2AQSA 1JYVA 2Y69B 4GG6B 2R9HD 3A3YB 2RALA 3CU7A 5F0LB 1TNNA 3RSEC 3MJ7A 1MNNA 5ITFB 3VAEA 3BJLA 3CVIL 1KPVA 4B7LA 5E0FA 4Z7AA 4AN1A 1OM3H 4PJGB 2V37A 1NSNL 4NKDA 1NOFA 4LU5L 4Y19A 5CWSA 2X3BA 3NSJA 1RK0A 2KZWA 1UGNA 4Q97A 4R4FL 1MAML 4XCEB 1Z5LB 4YUEL 5EIQA 5K9JH 5E6IA 4GOSA 1R5VA 2DJMA 5T3XD 3BE1H 1CT8A 1LO3H 3EDJA 2CJSA 2DQFA 5BZZA 3DKHA 3MTRA 4LSUL 3RFGA 5JHLH 15C8L 1CU4L 3LEYL 4CN1A 1DQTA 3DV6A 4UQDA 2C3HA 4QT8A 2JCCA 4ZMNA 3ODTA 2NYKA 3PWNB 3FN0H 3OJMB 3ERXA 4FQIL 5ITBL 3AXLA 5B21A 5J12C 2UXGA 5DMIH 5FR3A 4AYEC 2CA3A 1RZFH 5GS1B 4KU1A 1PU0A 1Y07A 1LDSA 3FRUB 5DHVA 1X9LA 4XTRD 3VG9C 4YDLB 1P6FA 4J39A 3FRPA 1M4KA 2Q20A 4RDQF 5DMYA 4NO5B 1WGOA 1VEPA 4MFHA 1RI6A 5CS7A 5H94B 4UQCA 2ZWNA 5F6HI 2KQNA 1JTTA 2V4LA 4WNJA 4XPBL 2WTOA 3DYMA 1KLUA 3T3ME 4AUJA 2N1TE 2ATPB 3IXAA 1H15A 4FGMA 4JANA 3G04A 4ETQB 4KXCA 1P22A 3R1GL 4JD2C 2JKWA 3FSWA 3GSRA 3ZUNC 1IGCH 4ZOCA 3W3BA 3GLZA 2X6UA 4M5ZL 5GRUL 4ZUVA 4JZNB 5BCAA 2F8OA 4LVNC 2WXIA 2AS5M 3MLXL 4M5SA 3T4YB 3QJSB 4ZOEA 1PL3A 4XBGB 5GZND 1EAPA 2EIKB 1EVTC 1CLOH 3D85D 1E9OB 2C9VA 1G6RB 3G6JA 1E5ZA 5KBDA 3VCLA 2IALB 3WXVH 2JKNA 3KE0A 5ADPH 4MJ4A 4AEIL 4N2EA 4DK3A 4U3SA 5TGBB 4Q7DA 4PBXA 5KYWB 3QHFL 2X4QA 2WC7A 4W9KC 5AYQA 4UB0H 2OCJA 2NR6D 5JHDD 4ZYKA 1BLIA 1WO2A 2J5LC 3I9PA 4OJEH 4JM2A 2XG5B 5K1CC 2WYZA 3N3EA 3CLEL 3UP1A 4C59B 3LB6D 5SX5K 2HFGL 4GXUN 5CMAB 3NDZE 3IMUA 3IRCA 2FR4A 1IAKA 4YOKA 4QRQA 3Q8EA 4NQXA 1PEVA 2P42B 2Y06L 2XKSA 1UT1A 3DVNA 3A24A 2LVEA 3ILPB 3Q2LA 1J87A 4PPTA 2YS4A 4TLUA 3I2NA 1A21A 2B15A 1YJDC 3DXAB 1WZAA 2CR3A 2EC8A 5BV7L 5KAQF 1M05A 3V6BR 1A4KA 1UADC 5L4IA 5IQLA 1KDJA 1RHHB 2CUIA 1XGZA 2R4SH 4UINL 3T2NL 3JB9L 1MH5B 1FAIH 1QWUA 2GJPA 4LLDB 2Z0UA 3IFOB 4ZDHB 1REIA 3FOMB 2EH8H 2DAVA 4Z7VE 1LP9B 3V4PL 3A4DA 2OCFD 1FORL 3U2JA 3VYPA 5F1NB 2DM7A 4JRWA 5DDHA 5DS1A 2OR7A 5JTWA 1XSIA 4ANXA 4E42B 2BHUA 4U6HB 1SXSA 2Z31B 3IIWA 4QWWD 2D9CA 1NCTA 1V3KA 2HYEA 4I0PB 4D3CL 3D9AH 3L3OC 4PLJD 1XGTB 1EDHA 2RGSA 1YY9C 3TF7C 5HVHC 1DQIA 4OH2A 2F15A 5HDBA 4G9DA 4L4TA 1P4IL 1TKWA 1KGCE 5CJXA 4P59H 3RMZD 5ICZB 2WXQA 2ZNWA 2HVKA 1XF5B 2A2QT 1OGAB 4DZ8A 1YVLA 2O6PA 4JY5H 2MWCA 5ANMA 4CI2A 3ULUF 4F5CA 5EUKB 1MG2A 1BQRA 2ICEA 4OD2B 1MXDA 2AGYA 3D7PA 1BAWA 1KXTA 3BD4A 4ISVB 2N4IA 1SLUA 1NBYB 4O2CB 3H3BC 4X9FA 4X9GA 4UNUA 1G7IB 3EO0B 3O2DH 3QFJA 3QUMA 3KDMA 3V4LA 4LSPL 2F19L 4JHPC 3S5YA 3D05A 1GW0A 3CZJA 2WLYA 3DYPA 4JFEE 2B0SH 2DQJL 1DVXA 4J81A 1N8ZA 3BD3A 5EAMA 1M57B 3PG2A 4JDTH 5DS8B 4WI4A 4LVOB 3SPJA 3U7WL 3O4GA 4AEZA 1D7FA 2WQVA 2A1WL 3BFWA 2DKUA 4Y2OA 2LLGA 1IEAA 3DMMD 2X87A 1KJ3H 3VNYA 3I8CA 4M6AA 4I79A 1LM8V 3BEWA 4K7FB 3TIEA 4BFJA 2BSEA 3PWPA 1KXVA 2BJMH 3K2UH 1S7RB 4CKQA 2I9LA 4HXBH 3NJHA 4NWUL 3CFVA 2XQYK 3EO1A 5FO2A 2CUMA 4KJQD 4LOVA 2HH0H 2XHNA 4BA8A 4CSSA 1MW2A 4HKXA 2H0EA 3B2UD 3SDDA 1KN4L 1DZ0A 2ARJQ 2IXQB 5FLVA 2BBKH 3PJLA 1NMAL 4HIIB 3C09C 4UOQA 1A6WH 4XCFL 2BSDA 2PPCA 3JROA 4R3SA 4OLYL 4N8UA 3AREB 4RH4A 3FQWA 4D8PB 5GS2H 1PGUA 4I87A 1KJVB 2E6PA 3O0RL 5IY5B 4HOWA 4N0FB 2M8XA 2P1YA 4YS4A 5IHBA 5DJDB 3PDGA 3B8YA 2EUWA 1L3NA 3TIDB 3OKDA 1H0DA 4U1NA 3WAKA 2B59A 1CFTB 4HT1H 1MJ8L 1J5OH 4X6DE 3BWUC 5IESH 1KJ2H 3OB8A 2Q7YB 1E8XA 4QOKB 2FSDA 2BIHA 2D7TH 3GJEB 1Y6MR 4RFNC 4B9KC 5TJWK 3QQNA 5IK3B 3U4YA 5IUCA 4MXVE 4Q0XH 5AVVB 1LE5A 3HFMH 4CGUB 5D7LB 5ACLA 3GIVA 3T6XA 3GEFA 3VGHA 1MIEL 3B7SA 5LAXA 4K5NA 4FABH 2Y6TE 1SMDA 4PJ7E 1F3JB 2GJJA 4NKMA 5E6IC 3QORD 3UBFA 4ZT1A 2DLFL 3BP4B 2H2SD 5IVOA 4HFUH 2FX7L 2OMVA 3T8MA 4X5PA 4BGDA 1MLBA 3EADA 1CFSB 3OMIB 4NZTH 4AQ8A 2E9IA 2FUQA 1EXUA 2ZYIA 2Y1ZA 1ZOXA 5I74C 2GJ6E 2BZDA 1XO8A 3G6AA 3DX3A 3GXPA 4K8RC 1EANA 1ODAA 1OP4A 3DIFA 3LQMA 4HPYL 2KBGA 4MS8D 1PQZB 4NQEB 5DVMA 1QSFA 1K85A 5DRNA 1DBKL 3O11A 3WS3B 5GGUB 2C8NA 1JTOA 4MAYA 5D1ZB 1DVZA 3SBRA 2QVMA 4P3CH 3TZVB 3MNWA 4DGVH 4M7LT 2HRLA 4OZHE 5HI5D 1A22B 2CHWA 3LV3B 2VDOL 4U1HA 2YFNA 1CC3A 3A23A 5LB1A 3VD7A 1OEZW 2VLKD 1J8HA 4LGRB 4CN6A 1NGZB 1QRKA 4HW6A 1ZDSA 1V55B 2DLHA 1C1EL 1AGEB 1BLNA 1CI3M 1HU8A 2OL3A 3UMNA 2NY5C 1V05A 5F7UA 3ULVL 1RU9L 2OJEA 2DY2A 1UATA 2Z2NA 5IVXB 3AY2A 3UTQB 4MCYB 3IKKA 3BSHA 1VCBC 4IM8A 4JSPC 4KQ4H 1DL7L 4N1EA 3X13A 1N59A 3FSAA 2JK5A 2GBVA 3G5ZB 3VI3B 3ZT7A 3U7AA 5I17B 3UYPA 2HG0A 4IDJL 3QUXB 2IGLA 1NCWH 3E9TA 1DVUA 1KIRA 2ZOWA 3ZK0A 3VWKB 4NQCD 3MRIA 4EDXA 1IVTA 5KANG 3V0EA 5MEQB 1GGYA 3WTSA 3M8OL 3UMTA 1OQXA 2XYIA 5IBTL 3QHTC 5EPMB 3BWAA 5C07A 1CLZL 2Q86A 5AKSA 2E4FA 5E1GA 4LGSB 4JM2C 2ZXQA 3LHPL 3BGMB 1Z0NA 3ZIMA 3IDNA 3CMGA 5F96H 1DEEB 4FTVB 1MJ7L 4GAAA 3FUJA 3SYCA 4PJXA 5D7KD 2IANA 4OVUA 4Z76B 4HEMA 3O3EA 4Y19E 1ASPA 1QEXA 3SYQA 1FG9C 2JKXA 4IU2B 2BP8B 2PW2A 5IMLA 5G4NA 3I75B 1RUKL 4BKLA 1I9IH 4IBTA 4KPHH 2CCLA 3T08A 2A9AA 3RLSA 3CHRA 2CIKB 1XGPA 3C6LB 5I2IA 2H26A 4HJIA 1UENA 3P54A 1BD2A 3R0MA 2FLBT 4N24A 2JCCE 4KK9C 4PY8J 1B9KA 2C7UB 4NZDA 2JXMB 5EN3A 4L1QD 3UTOA 5IGQA 2IIJA 4G80B 2VDRH 3WOVA 1R3HB 4PLNC 4YPGB 3ARBB 4YSTA 4PCSA 4QJ3B 3OZKA 4E5XB 4EIUA 4U6YA 1MRFH 1ZT1A 4NNYA 3SQBB 2WIIB 4F58H 1BOGB 1BZEA 3D5OF 3QWQB 4NKIL 4Y7OC 5DO2C 1L6ZA 2H0PA 5GHWL 4JPWH 2WPGA 4L29A 4LL4A 2JKIS 2JJSA 4KGLA 3O4JA 2X4UB 3SO5A 1O7SA 3SPIA 3W39A 2IUQA 2QBWA 1KJ2B 4WWKD 3CZFA 4UZSA 1ET8A 3L3HA 5HGBB 1KG0A 1KBVA 5CJXC 3UG5A 5ICYA 4J12A 3FQNB 2ZF9A 1S78D 2PCPB 4Y4KA 5EMYA 3IS1X 3OZ9H 5D2LB 3CSYA 1OSEA 3VD0A 1HHJB 2AJZB 4LQ1A 4K5OA 1MG2C 2MQ0A 4MQ7B 1W15A 5AW0B 4D0DB 1IGIH 1FFOB 4JUTA 2ICEC 1YEFL 3L4WA 1H3PH 4XMVA 4B27A 1YECH 1C9LA 3RFZA 2WXNA 4ERZA 5TE7L 5DURB 4DFIA 3HJ0A 3GKWL 4AUUA 4CGTA 4GXVL 4L1SA 5J56B 2JQMA 2Y5TB 3C60B 3SN6N 3G6JE 2QGDA 3F12B 1AKJD 3DHPA 1MKFA 2HJLB 1A4JA 1KCSH 3EOAA 1AKPA 3CXDL 1VPOH 3RWIB 2DWXA 2HB0A 2CLZB 3RWFB 1P4BL 2C34A 3SCMB 1S3KH 1DP0A 2HT4D 4ACPA 2CN2A 5TDHB 1OF0A 3OR6B 4ATWA 2NDGA 1KXVC 3NA9H 2GK2A 4PR5A 1AGDB 4Y16B 3ULSB 4H5JA 2DLEA 2FZ3B 2R29H 1KCLA 5SXMA 3FDWA 35C8L 1FNLA 5DQDH 2ZOLA 1VB9A 2Z35B 3V4PA 4LGNA 4QTHB 2NY1C 1KBKA 3ULUH 2G5UA 3SDDC 2AQ2A 3LPOA 2XJLA 3O4HA 1WS7A 2EC9U 3EBAA 4ZQKB 2I24N 3HNVH 1BXVA 1S9XB 1IKOP 1CFNA 1HH6A 3I6KA 4AM0Q 2RCSL 4DHLA 4HPOL 4JFTA 4WFGE 3JYCA 4HJGA 4NKQB 3C5ZD 4OGAC 2CZNA 2WUBH 3BVTA 3MRQA 3IXTA 4K71C 4Y4FA 4N85A 1XGRA 3LXBA 2IMMA 1YNLL 3QCUH 1QBBA 2CHNA 3T3MF 3P40A 3O8XC 5JA9A 3ZZQA 2CDFB 5MI0C 2ZP0T 3KEHA 1MFCH 2WXHA 2OSLB 4FQ1H 5DQJB 2AKRB 3GHBL 1JGLH 1I7ZB 2X4SA 4LLYB 4N2BA 4YSUA 1GZQA 1J5DA 2HAZA 4TSAH 4HD5A 2BFVH 1NZRA 1XVSA 1I1FA 4I85A 1N2RB 2YMOA 4MNGA 5F1KC 3V0WH 1HHHB 4B9FA 4EN2A 2WWNA 5HYJD 3VFNA 3KYOB 4L4TE 1II4E 2A6KA 2Y7LA 4PRNA 5D2NB 1G1OA 2AEQL 5BOZG 4P48A 5FYKU 5CJQL 3T2PA 3K1DA 1L9RA 1DVFA 1UURA 2WO2B 3DA0A 1I3RB 5ANME 5HXMA 1T03L 3K71A 3QDGD 2JTDA 2YPKA 3UVKA 3OAZH 5LXVA 3DJSA 4N2DA 5F3HA 4KO5A 2AF2A 3L9RA 4AQ8C 4BUQA 1R24A 4NCDA 2FEEI 1CB4A 3QFJE 1WG3A 4JQVC 5GIRB 2QQNL 4XP9L 3EG6A 3SDXB 3LN5A 1H8NA 3AG4B 2H5UA 3QUZD 2R8SH 1THCA 4NQDD 4D7PA 3OWEA 4MAYC 5I18L 4PGCB 1NBZB 2XXFA 1A7BA 1AE6H 5JPNA 1UXSB 3RY5A 1NOAA 2BVQA 1ODUA 4R2GD 2VDRB 4QQEA 1I8MA 2VXTH 2H13A 2VDMH 4UTAH 1BAFL 4WSGA 4M8QB 2W9DH 3B9KB 5DHYB 1IQWH 3ZQWA 4TUOB 4BCYA 3KCPA 3PWPE 1UOKA 2YJQA 1OCCB 4M93C 1S7XA 5F7LB 5HHNA 3PVWB 3ULEC 4JHUA 3SY0A 3IGAB 3D12B 3FB7A 4JFPB 3TH4T 1R17A 4UQEA 1E5TA 3BZEA 3BT2L 1CXKA 3E1F1 3APDA 4FNTA 4GT7A 5B8CB 2JFCA 1C12A 4D9RD 2PYED 1QPXA 1YEKL 5EULV 5DT1L 3VXUA 4QLRA 4YFLI 3ZLQC 1P5UA 2B8OT 5D96B 3TXAA 2WBJD 2BIOA 3VXRE 3EQ7A 4MCMA 3QQ4A 2FSEA 4P3DB 1BQKA 3SYAA 1RUAL 2A9CA 1FFPA 4IGBB 4M7ZC 4DQOH 5JORB 4ZJ9A 5KVMC 3O2WH 4JDEA 1OGPA 1JYNA 5D4JA 4KO7A 1E9QB 1Q9OA 4QR7A 5CP7A 5EZJA 1KXQA 1LK3H 4E9SA 1KFAH 3FTGB 2D2CC 1MHHA 3OHXA 3ZL2A 1WA1X 3NIGB 3MRRB 3PHOB 4X9BA 3RWDA 1EVUA 1B6UA 4C83A 4GQPH 2IWEA 5I23A 3FCSB 2PBIB 4OIBA 3KBHE 3CFJB 5CP3A 5T1KA 4AJYV 4JVUA 5D1QD 1KGJA 2L7UA 5H35B 2D03L 1W9XA 1YN6A 2AI0H 2YEVB 2VDOA 4RIRA 3EOBA 1PDKA 4R9HA 3MUJA 1XDTT 2RA1A 3GJFB 4ZFGL 1KY6A 1XR9A 2NYZA 2JF1A 3K80A 1WWCA 1AFVH 1DYZA 5CD3B 3DUUB 4PRBB 1QSFE 4KAQL 4ZXBC 1ZTXL 4PJ9A 1D5IH 1FC1A 1A6UH 1WF5A 4A08B 4AGMA 1SQJA 1IM3B 1R1CA 3CH8A 1RZ7L 3FQRB 4PJBA 2JJSC 1SDYA 1NC4B 4JT6C 1I1RA 1PEZA 1RUML 2A6JB 3VRJA 1J8HE 3ZL1A 4YSEA 3QG7L 4UYQA 4ZTPH 5FUOL 4FQQA 1FL6A 3OR7B 1GYAA 4Y4KC 2FECL 3KWVA 5DZLA 1FBIL 3IMWA 4WHTA 2CR6A 5LHDA 2DS4A 3C75H 4X6DF 1P84K 4MNQD 5CBAB 1C9IA 1FP5A 3NP3A 3G6DH 3U7YH 4XBPA 3ZBMA 5C09D 3QFDA 4MX7A 5CR1A 5KVFH 1THAA 3B3BA 3UGXA 4BE5A 2IDTA 1QR4A 4P0DA 1G9MC 1ND0B 4UAOC 5IROD 4ZPTB 2ZUSA 4NPKA 1UVQA 4Z95L 4BQBA 3PE9A 3B56A 5ERWB 2BXZA 4Y2DB 4AYID 1IIKA 1BZ7B 3RNQB 1L5GA 3OKKA 4JQIL 4UDTB 1RZKL 5C07E 1BZ9B 1I7UB 4PJ7F 3X1EA 5FECA 1GRWA 4AH2A 3PSCB 2PR4H 4JN2B 3HB3C 3PL6A 4FQ2H 1DO5A 3RURA 4UOZA 4NN5B 3JXAA 3KHOA 4J2QA 5EOTB 4PJXE 2B5IB 2E6JA 1RERA 2IANE 2DBLH 2XCMC 2MCAA 4XVSH 1SHYB 3KWTA 4HEME 2AV1B 2CO6B 5JOPE 3QIUB 4XP4H 1T0MA 3FBQA 3ECQA 3PREA 1IFHH 2GT9B 4HK3J 2VZ1A 2CMRL 1TYEA 2EUZA 3DYOA 1QSEB 2ZX8A 4MD4A 1JZEA 3ASNB 4MXQD 4XNXL 4YVUA 4G70B 3P2BA 2WYTA 5EALA 4N0UE 1MRDL 3QWRA 4HX1B 4NM4L 3UOAB 5I8EA 3QDHA 4MMYB 4NKOB 4AJ0A 1BD2E 4ZOBA 2VIRB 5EZIL 1MAJA 1XH2A 4Y4FC 3VFGH 3WHXA 2FO8A 3VRLE 2OA9A 5HYQB 1PKOA 2BVTA 2CA4A 1U8CB 3O6FA 4WENB 1T66D 3BAJA 1Q94A 4I8DA 2VW4A 5F0PB 1CD1B 3JUYA 1TFHA 1ITBB 3SO3B 2C3XA 4OIFA 1ETJA 3O4IA 1KELL 2PCXA 1BPLB 3B2XA 3U46B 4J8RB 1NPJA 2VDKH 3FB8A 4RMVA 3R7QA 1WZLA 2BC4A 3MCLL 4HBCH 1MQ8A 1BZQK 3NRFA 3QULA 1CE6B 3WKYA 3IPBA 4DEPB 5E94A 1TTFA 1MHPH 1W0VA 2C26A 1NAKL 4MMXB 2QKIB 3I74A 1YMMB 5HHOD 3TF4A 1YDPA 2FBRA 2NY0D 3MDJA 1A7RL 1G1KA 4ZPVB 3LMJH 2BRRL 3HUJA 4BA0A 3BWUF 5JNYA 2WMPA 3LNEA 4ZUTA 4BL0A 4MSWA 1ZHKB 4TV3A 1MFDH 4XP1L 4KNSA 3CN1A 1CXLA 2C9QA 2PCFA 3EYSH 1IGTB 2YD1A 1A3LL 2WLHA 4RMSA 3GK8L 3CDYA 4F93B 4JFQB 1HINH 2EYRA 1FZOA 3ZE1B 4N6RB 3AS0A 3HLAB 4XPAL 4MXWL 5JPNC 3VH8B 3TVMA 1UB6A 4EI5A 2JB6B 2V3EA 1L9PA 5FM5O 4AC4A 2MTAH 4DAGL 2K70A 4PRPB 2W91A 2DQTH 3QNYA 4U49A 2H8PB 5TFSH 4G6JH 2HPTA 2YD0A 3A6BL 3WL9B 3RZCB 3UO1H 4FHBD 4NN6B 4KFMB 1QWNA 2BP3A 5B1AB 1G7HB 1TO4A 3HFQA 1HWGB 2D31A 4XN7A 3LS4L 4IMMA 3OWRA 2G3ZA 4FFWC 2K6YA 1FH5L 4LQFL 1BEYL 1OSZA 3D4GA 4OZGF 2Y3NA 4M3JA 5FWQA 3N6YA 4QXGL 4UT6L 4CJ0A 1JMZB 3GSUB 4OGXH 3JTSB 2JKJA 2XRAL 4FFVC 4H8UA 5AW3B 4HSAC 2WVTA 1JDAA 2GY5A 1OB1B 2VAAA 1EHLL 1FO0L 2UY7A 3F04A 5TF1H 1QTYT 2OK0L 2CBOA 3RWEA 3BLPX 4E54A 1JWSB 3W0WD 1M1XB 3S97C 3B7FA 3L5WB 4Y9BA 3OPZL 5A7BA 1N68A 3DXKC 4M29A 1S7SB 1MFBH 2EO1A 1FVCA 3V9EA 1ZIAA 4MDJB 2VABB 3P2DA 1FFTB 4LXFA 2YGOA 3P4OB 1RZ8B 3MZGB 1XGUA 2YARA 1OTTC 1F6AA 1ZEAH 3OHXC 1Z5HA 3U25A 5E8DL 5KBMA 5E5LA 2WKLA 3EJPA 3M1CA 4J1UA 4NT6B 4MNGE 3B7UX 3GD1I 4ZW7A 3FK3A 3QXVA 3UIZA 3VFWA 4J84A 4FQPA 1GGBL 2J55A 2Q8AH 2H2PD 5CEZL 3N06B 3GLAA 5A2LH 3V0VB 4U1JB 1KTKE 3G6JF 1OGAD 4R26H 3LQAL 4TNWK 2NW3B 4KO9A 1IB5A 3IJYA 4CSTA 1A9BB 2ZXDA 3PGCB 4L3CB 3SDCB 3LKNA 4JRXB 3DO3A 3AFCA 4JY4A 3L5XL 1IL1A 3CX5J 5SWZE 5D6CB 4LSSH 2O5ZH 4L8BA 3FRXA 5I6PA 2YKKA 3UGUA 4JM2F 2R0ZL 1SYVA 4YPJA 1BFOA 3IF1A 2OX5A 4LFHD 1UM6L 3D18A 4XOCA 2L7EA 2YLHA 4ERQA 5DUMH 1AI1L 1U4FA 2VQUA 3ZWLB 1DE4A 5JW4Q 3ULVC 1DDHA 3DJZA 2EYTB 3EUUA 4PJ9C 5IF0A 5FYLD 1T7YA 5B4MD 4PD4K 1I8KA 1WA2X 3FM0A 3WDHA 3S5ZA 4P23B 1N6DA 1AACA 1UXWB 1GCFA 4LOUC 4IW4C 5DEJA 2HRHA 2AGWA 1JF1A 1GPOL 2A73A 1WFNA 1BF8A 2GITA 3MLZH 4CMMB 4N5ED 3MV11 5T3XL 2YR3A 4MMZA 3ZU8A 2FWSA 3LXAA 1ZE3C 2NZ1A 2P8PB 1RQ5A 2DQUH 3QO0B 1AZRA 3A0FA 3MGTB 1PZ5B 1N6QL 5IWLA 3OX8A 4D0BA 4WTZA 3DC0A 1TZIB 2HX7A 1OE2A 4WNSA 2EDQA 4JRYD 4Z7WA 3G08A 2AJVL 3MLPA 4YDKH 3B5HA 2PPDA 1JGEA 3VXUE 1QA9B 1LEKA 5AG8A 5I1AA 5HDBF 1QFWM 2VQ1B 1E28A 3MVSA 4FQJL 2H9NA 4GO8A 3JVGC 3KMDA 4UQ3B 2QPUA 3GREA 6FABL 3WFDL 4PV1C 25C8L 1CG9A 4NPYB 5J5EA 1XH3B 2WQUA 1TSRA 3GT6A 4XCNA 5F7MC 1YJDH 1TQWA 1T2XA 2YAQA 1AHWA 3RIFK 4BK8A 3CHOA 3PL6C 2UUDK 4HDIB 3FCUA 4GGCA 5HTSA 3I7LA 5IT2H 4ODXB 3EI1A 1F0LA 2F5BH 1WAPA 1EK3A 1AC0A 2OXHB 3AGWA 3H9HA 4JFFD 1UB5B 5FYKD 4R7DB 2WBKA 4YHPB 3BSZH 1PX4A 4YXKL 1AD9A 4ZX4A 1ACYL 2J8HA 1VE7A 2R2CA 8FABA 4HJEA 1MRCL 4ZRGA 5JOEA 4UYPA 4P4KA 1I9JH 2DEWX 3OAUL 4P07A 2GHZA 1VF5C 3EI2A 2JKTM 3VXMD 2EH7H 4OY9A 2ZUTA 1XXFC 4XMKL 1DFXA 3AVEA 3HZKA 5DJ6B 3E8UH 4KTEH 4RGMC 3DECA 5AVRB 4X5XA 2QSCL 2OMXA 4KROD 3BH9A 3UZVB 2BY1A 3ZTNL 2I60L 5FB8B 4YC2B 1OW0A 2IDFA 2VZVA 3H54A 3O6FC 3TZVD 3V4VL 1ET5A 3KNBA 3ULVE 2ZXEB 2XBZA 4LK4A 2G75A 5E1HB 4K2UL 5DD5H 3Q3GA 1TO5A 4KNQA 4WGVB 4WUKL 3A4EA 2BP0A 1OCWH 4PJBE 3ARRA 1A6PA 2NXYC 1OLLA 1YN7B 3G9AB 3TBYA 4WUUA 2NPLX 2NY2B 1NWPA 2GK0B 5EBLB 3OXRA 4L1BA 4W68A 2N59A 3SOTA 4HIPA 5EN2A 2APSA 5E8OA 1AXTH 3H6AA 1T0NA 4OUUA 4WEUD 1JHTA 4JQIA 3AL8A 5FKQA 4PBDA 4ZTOL 1PZAA 2FATH 1GYWA 2WJ7A 1J1OH 1L9NA 4YN3A 2DMCA 3QUXD 3EJZD 5THAA 3MUY1 4Q9CA 2VUOA 5MP6L 3BUPA 4PJIB 3VG9B 1MNUL 1PEWA 3OKNB 3VWKD 3OLIA 1MZYA 3ZZLA 5IW6A 1I8LC 4V2CB 3QIWA 5TDOB 4WFHD 3TVMC 4IOFD 4EI5C 4ABUA 3IE4A 1QNIA 2B1AH 4GW5A 2VDPB 3PJSB 5E5MA 4IBLT 3PXWD 3VFRB 4JO1H 2A9NL 1I8IA 4GS7C 5F9DC 5LG6A 4Z77A 2V9UA 3D2UA 3QGVA 4ZFFA 1HS6A 3GSXA 4KZDL 5GGSA 4LVNB 4KMLB 3SPHA 4ZFZB 2DQ6A 5BRZA 1UQSA 2E9JA 2F8VA 2Y0SA 4X7DC 1F11B 2P5EA 3ZKXC 1HHKA 3F5WA 4FN0A 2P80D 1VA9A 3KLQA 3P4LA 3QAZB 4ZMYA 1UWGH 5LBSL 4BEIA 4WIQA 5D93B 3ZE0A 1CS6A 2YUZA 2XBTA 3MJ8A 3EI4A 1KCRH 3VXTB 1O7VA 5C0JA 1OTSD 1FL3B 3U6RB 1F58H 3K5SA 3EI3A 3BZ4B 3U1PA 1SFDA 5JO5B 3F6JA 4JFOA 4KK5D 2BCMA 2FWOA 3CLFH 3NSYA 4NQSA 4W6XB 4B0MM 3ZDZF 5KBNC 3IT8D 5D1XD 4H2AA 4ZAKD 1FVEA 3FTYA 2Y9RT 4WCYH 3L3GA 1XEUA 5C0CA 3HE7D 4Y89A 3X14B 3IU4H 1XR8A 3PUCA 5ETUA 4Z78B 3EYOB 1KLGA 3HNTH 3T77A 4UV7H 2MJWA 5GRVK 2Q2EB 3O41B 4R4BB 3RAJH 3DOSB 4S0TD 4K8RH 3EFOA 5FW7A 4F2MA 2DL2A 1YQVL 2ENYA 2HWZH 5J13B 3V55A 4KI5D 2PWEA 1KSRA 4IOSD 3OGCA 3APNA 1HSBB 1MCWM 3GSNH 2UXVA 3TBBA 5IVZA 5DSCB 4EUPA 2D7PA 5DHVH 4NJ9L 2OVQB 3LRKA 4RX4A 1OP5K 3IU3B 1TJHL 2UYLB 1EEZB 3HUJE 5IT2L 1QRND 2XA8L 4Z18A 3U4EB 1SEBB 3R8BB 5JPMA 2R56H 2XOTA 2Y1YA 5L2KA 4OI9A 2X9WA 5F97E 3RJDA 3HI6H 3UC0L 5HYNB 4G42B 4JQXA 2XTSA 3J2PA 2ITDA 1DANT 1U8QB 3QHZH 1NDGB 2NY5H 4XNQA 2PWFA 2VC2B 2EKJA 3HZVA 4UT6A 3FU3A 3S5LA 1FCCA 3K72A 4MB3A 3W81A 5ESAA 4OCRL 2AJXH 1FJ1B 1WT5A 1Z7JA 3BVWA 3LPFA 1OT2A 1LMIA 4X8CA 3A6CH 1FO0A 4Y16D 3EGDB 4UM9B 4MLIA 3ZYIA 5E6ZA 4K7PL 3FL7A 1B4JH 3SE8H 1TTBA 3FQUB 3G5VA 2YB8B 4NJAH 4MMZC