3V4PA

Crystal structure of a4b7 headpiece complexed with fab act-1
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
587
structure length
582
Chain Sequence
YNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLVGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHSTEEFPPLQPILQQKKEKDIMKKTINFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-4
publication title Structural specializations of a4b7, an Integrin that Mediates Rolling Adhesion
pubmed doi rcsb
source organism Homo sapiens
total genus 131
structure length 582
sequence length 587
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3v4pA02
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3v4pA01
2VC2A 4Z7NA 4Z7QA 1JV2A 3IJEA 3NIGA 4IRZA 3K6SA 2VDNA 2VDMA 3K71A 1L5GA 2VDOA 3VI3A 4G1EA 4Z7OA 5E6SA 5FFOA 1TYEA 4MMYA 3ZDZA 3T3PA 1M1XA 4MMXA 2VDKA 3NIDA 4G1MA 4MMZA 4UM9A 3NIFA 5E6UA 3FCSA 2VDRA 2VDLA 3ZDYA 5FFGA 4UM8A 3FCUA 3ZE1A 3V4PA 3T3MA 4O02A 4WK0A 3ZDXA 4NENA 5HDBA 5E6RA 3K72A 2VDQA 4WK2A 3ZE2A 3V4VA 4WJKA 1U8CA 2VDPA 3VI4A 4WK4A 3ZE0A
chains in the Genus database with same CATH superfamily
2LU3A 4F2FA 2X7LB 3IRZA 5KYWB 1U2YA 1JMXB 3L8QA 4C54A 2DJMA 4PJBB 3K5SA 4P5SA 4W9FC 1VEPA 3MXWH 3RUGF 2N59A 4X6DB 1P6AB 5EUKB 1A1MB 3NIDA 1J9SA 3JWNG 1F45A 1NH6A 1NCGA 3FQTB 2DJUA 2EC8A 4BQ9A 1T1YA 4KO9A 2WNKA 4F7EB 5JPNB 2VXTH 3E2HC 4IBZA 3DHMA 5C6TL 1S7WB 1E3XA 2G30A 2XIIA 3N5AA 4OJFL 3MRJB 3BT2H 4A2DA 2I60H 1M6OB 2YGPA 3ZSSA 3MBEC 4L37B 5CO1A 3RNKA 3OB8A 4PI0A 2Y36L 5BOPA 2A74B 2OMXA 2XIDA 3MLUH 4I1NB 3S34H 4A7SA 2OVRB 4HZLB 4R4FH 3MBWA 5T5FL 1OGAE 3NH7L 1WCQA 3GO1H 1BD2B 1J8HD 1JGUH 3N41B 4N2KA 4LLDA 4AIOA 4WK2A 1R1CA 2YAOA 4HH9B 2A83A 4Q9QH 2YNOA 1BFTA 3EG6A 3AADB 4OSUL 4W70A 2VLME 5D1XE 2CD0A 1I8AA 4QRUA 3EH4B 1RZKL 5AVTB 1D5BA 1CU4L 1BM3H 1C5DA 2JCCB 3UFIA 5KS9E 4NN5C 1QKZL 4UU9B 4PYGA 1G84A 1MEXL 2Q76B 3SYAA 4ETQB 4N26A 1RJLA 1E9PB 4HPOH 2CDEB 1RULH 1P9MC 4N9GB 4Q89A 4QI3A 1L0YA 4Z78B 3DM0A 4LHUG 5F7AA 4DTGL 1HDMA 1A3LH 4OLZH 4ZTPH 1DVFD 1NFAA 2ZCKL 3E7JA 4OCYL 5EIQA 4GRWF 1CLYL 2C3VB 3DV6B 2FJHB 5EU6D 5AW8B 5KBNC 5T3ZH 1J9RA 2OJEA 4PS3A 1K8DB 4NUJA 3KPRE 1U8HB 4J6IA 1R0AH 4OZUA 1YQ2A 4HX1A 4W6YB 2FJFB 4AVKA 4H13C 4HFWB 3AS2A 2W81C 4P46C 3ZKNC 4DP1X 2DQHH 1KGXA 2OFQA 4J0WA 4L3CA 1E27B 1EJFA 2OSLA 2PNDA 5CJQL 5ERWB 1NGQH 2A9NH 2CPUA 1DQMH 1Q9OB 4I0KA 3WTYA 1OV8A 2DWDA 2C7UB 4IDJL 2BO0A 5I74C 2CO6B 5LBSA 4A11A 2MWCA 5JUEH 3OMNB 1CFNA 2D7NA 3R0NA 3F04A 2EEDA 3KNBB 4PD4J 1IFHH 3MREB 4PWFA 5DEJA 1M56B 3P54A 5DQ9A 3SCMB 5BW7C 5DC2A 4E0RA 3ZL2A 2H14A 4XNXL 1YEFH 1WVZA 2Y2WA 4P2QE 3GKWH 1B4JH 3CZLA 1RJZB 1XIWA 4M93B 1MOEA 4LQFH 4XI5C 5CKAA 5DFVD 4DUWA 4GRLD 3RSEC 4XMUA 4AQ1A 4RZCA 1HK6A 4DGIH 1EFXD 3ARYA 3O2VL 4PGEB 3T4AA 2HTKC 2J6EH 3QUMH 4N2MA 1DVZA 5I71C 4J39A 1MF2H 1UJ3C 4XVOA 3WFBH 3PU7A 3VSUA 5DJ2A 4RVBA 4FNPA 4K3DH 3MSPA 3W0WE 5IG7A 4GMTH 3WIHH 5MENB 2X4PB 4AYFB 2OAAA 1AIFB 2K6WA 5KJ4A 1XL4A 4FAAB 1KTKE 5LGJA 2VDPL 1ITBB 2NXYD 5D7JD 3WUWA 2FDBP 3FPYA 3Q6FA 2DBJA 3GS4A 4WI0B 5IOKA 2TSBA 2GJJA 4F8QA 1UATA 3RDTA 2WTOA 5FYKU 3C5SA 1BVNT 3CHXA 4YSDA 5CR1A 5IHLB 2GY5A 2N56A 4YEFA 4DEPB 4HS6A 3CPLA 4ENED 3D30A 2G5UA 2EDNA 4KI1A 1JYNA 3NCCB 4LOUD 4U1SB 4IU3A 3D85D 1I9IH 1WFTA 2DTML 3HUJF 1T4KB 2GKIA 3UZQA 4XMZA 1YPZA 3SE8H 3SGDH 3EU7A 3IMWA 3LHPH 2VABA 4PGDB 5HGDA 4QRPB 4YPGB 3ZBMA 1CF1A 4JFFB 4JRXE 1IEBB 2ZX5A 3ILQD 4E2OA 4XVTL 4GLRI 1OCOB 2XTJE 4LAJH 4R5TA 4WUKL 4UQ2A 3QDGA 2XWZA 3Q3GB 4Q9BA 3VM5A 5I0ZA 3RFGA 3AXLB 4PB9H 4NXSA 4AV5A 4HU8A 2JE8A 3TA3A 3MLXL 3IJEB 4EEEA 5K69A 2VZ1A 4PEEA 1EVTC 5KYUA 2PF6A 4XBMA 3RU8H 3QZWB 4BCDA 4TQEH 2EYSB 2IH1B 1JHLL 1TYRA 4JHUA 3FQRA 1E5CA 1E28B 1LL1A 3EH1A 4I7ZC 3WIIH 2H3XA 3QORA 2EBSA 1KENH 5LWYH 1MCEA 5IMMA 2OL3L 2HRPL 3UADA 5IW6A 4YX2H 1IGYB 1R5WA 1KOAA 1AACA 3CSTA 1D7FA 3GHEH 5AZUA 5L2JA 5GJTH 1FNFA 3BZDA 1ERJA 2V3EA 4PFEA 5KJ7E 2FWOA 5A40E 1DVYA 1A4BA 2X10A 4UILH 5KN5A 4LDCA 2CCLA 5EH1A 4AGMA 4NSKB 1X4ZA 1U8MB 2X4TA 3GNMH 2FL5A 2HU7A 1OCCB 3R8QA 4CC4A 1FVEB 4DPAX 1J5OH 7CGTA 4PJ9A 3L4YA 2QJDA 4NC4A 3N40F 1T2XA 1E50A 3AL8B 2Y1AA 2APTA 5SWSB 1AKJD 1E0OB 5DURB 2BKLA 4CU7A 4MNQB 3L48A 3BQVA 5G4OA 3BISA 5EC1B 3JWDL 5KJRL 1USQA 2AH0A 3UZEC 2FX7L 1UTCA 1FFOA 4M3JA 4D9QD 4GYBA 4Z7OF 4JSPC 5K5YA 4PSRA 3H8NA 4R2GB 4OGXH 4YHKL 1TCRA 1A6AA 3CZUB 4XMLL 1CQYA 1PZ2A 3MGTB 5DA0B 1F02I 1M71A 5ITFA 2IWGA 1J9QA 3HLKA 4A0BB 4YSRA 5B38B 1DTUA 1UACH 4G8AC 5FC9A 4FXTA 1AYOA 1C16A 2ED7A 5DJ8B 3FQXA 5CLTA 2HLFD 5ICYA 2WVSA 4UM8B 5JDSB 5HHMD 2WVVB 3IVKB 1OIOA 1DEDA 4UTAL 4AQAA 4A04A 1EH9A 4NZJA 1J5HA 2ARJQ 2C5DC 3N1MC 2BSRB 1BX2A 5L8JB 1SJHA 4MXWL 4HULB 3D2UA 2CO0C 3QYCA 3UTOA 1UWFA 3KPRD 1YEIL 5I6XB 4BXSV 1L6XA 2KUTA 2LAGB 4NM4H 3MRHB 1AR1B 2DBLH 5ILTL 2BNRD 3IDMA 2PCFA 4JKKA 1CI5A 3IPFA 4ATWA 4F7TA 3DRQB 1CFVL 1SYVB 3QXTA 4OJAA 4YVDA 5E6ID 2VQTA 4K3HA 3BPLC 1MIEL 2CXKA 2ISDA 2EIMB 4HK3J 1NC2A 2HRLA 3DXAA 4QOKA 4RISL 2M1KA 4Y4FB 4E5XA 3HBZA 4BCXA 2YFOA 2G2PA 5B4MC 3MNZA 5F70A 3X11B 3MLRH 1NCBH 3LQZB 1JNLH 1JXJA 2BLFA 4PVLA 3LEYL 5E6SA 4XBEH 4BE5A 5IC7A 4W9LC 4D0BA 3PPSA 3SWSD 1H5BC 2J71A 4JZJC 2A6JA 4O4YL 1DLHB 4JQIL 3QI9D 3K6OA 4UT9L 1RQ5A 2PTTA 2EH8H 3MRPB 2QMJA 4AEFA 3NN8B 4IK7A 3EF7A 2FSEB 3KVDD 3A24A 4JPSA 2WCGA 4QWWD 1FAKT 2UY7A 5EIIB 3SDDA 4FLOA 4B60A 3E1F1 5FYJL 3F7RA 3UG4A 4NN6B 4XNZB 2D0FA 3TH2T 5E5MB 3TOPA 1ECYA 3FQNA 4OD1H 1GGUA 1OCZB 3DYMA 3CCHB 4G6AD 1WA0X 4ZX6A 3BUQA 4R8WL 5E7BA 3BN3B 3O6FD 4OCSH 3PYCA 1BREA 4PJEB 5HVFB 2NY5L 1M3IA 3VFGL 3ECWA 2JJTC 4UDTA 4Y2OA 4YK4B 5TE7H 1PZUB 1ZA6B 1S46A 2XVKA 1MW0A 2J8UE 2N7AA 1NAMA 2J5LC 1EGJH 1JNJA 4PHXA 4WWOA 1OAZH 1Q72L 5FM4A 2OZ4L 4OI7A 1ORSB 3K2IA 3IKOA 3OLEA 3LIZH 5IBUB 3LDBB 3BAYA 2EDOA 3CFTA 4U1JB 3VD2A 2F1AA 4N3TA 4OUUA 3D39A 4YVNA 3FYIB 3SO3B 1DBJH 4LK4A 2QQNL 3QWQB 4GEIA 3PWJA 4JPQA 5FM5O 1FZKA 1ID2A 5D7IE 1TQSA 1GYWA 2FBJL 2QR0A 3QWOA 2MOGA 4D8PA 2YBAA 1KIQA 4Y4HC 4G82A 2EE9A 3PQYB 4GUPB 2ZUQC 2VLRE 4FFZA 4TTGA 5JIKA 1NUFA 4XN1A 3NJFA 3OVUB 5I8CA 3QEUA 4L1MA 3VGAB 3FHQA 2R0WH 1WHPA 2COQA 4CVZB 1XSKA 1IQDB 1Y18B 4JANA 1MHCA 4HHAA 4MD0B 3O4OC 4JD2C 1MJJA 2R7EB 4F3FB 3V0WL 4H1LG 5HVHB 2EUXA 1WK0A 3H9SE 2AERT 2A4EA 3JV6A 3RA7H 4GKZA 3BEWA 4PVBA 4FI8A 3P02A 1GMIA 2QPSA 4FLSA 2EXTA 3PGCA 3N0DA 3KYNA 5BV7C 1E4WL 2B15A 5JA8B 5LCVL 3DIVA 5HHOE 3WY2A 3IGKA 2LAAA 4MD5B 3V10A 5I16A 5KVFE 1A3ZA 3OKNB 1KN4H 4FFYA 1SDDB 5M94B 4RCAA 4XHJC 2WLJA 1T21B 5CP3H 3FRPB 2G0LA 3LIZA 5C1MB 5AOJA 1KLGA 4Q58C 5CZRA 3RL1B 2FGWL 2NX5D 2HX9A 5EG6C 1IB5A 5KUKA 4MDJB 5F8QC 3BAEL 2WVUA 3QQDA 3UAJC 5E94A 3OKLB 4MDRA 5H37A 5H4ZA 1YEJL 4HWBH 4KMQA 1X9QA 2PN5A 1BEYH 5F3BA 3FS9A 1ULVA 2WQSA 4O9HL 2YQGA 5DRXA 4A7TA 5KVGL 4GIOA 4ZFGH 4MQ7B 3MV8A 4Y4KA 2ZJSL 4LGRB 4JMNA 1RZJC 4G11A 4ZPTB 3RGVA 1VFUA 3C9NB 4FXKC 1MREL 3KM2A 1EUUA 2ADGA 1FE8H 2DQUH 4X83A 2PCPB 3GSOA 4EZLA 3QUYA 4X5RA 3ESUF 1JPFA 2PW1A 3ZQWA 4Z0XB 4KNQA 3BWZA 2I26N 3FN9A 1L3WA 4OWRA 2ZAHA 3CH1A 3NSXA 3HR5B 2F19L 1AQMA 2IAAC 2VR7A 1MRDH 3MRFB 4HMDA 2FWSA 3I50L 5CGBA 3R7RA 4NERA 2H5UA 4ZAKC 3WY3A 1JHKH 4M7KH 3ABLB 2F5AH 1FV1A 1MVFA 1JMZA 3BVTA 3PWPD 1WF5A 3C60C 4U1LB 4FTVA 3DSNA 4TVPH 1JNNL 2CCWA 1IGTB 4FS0A 4HJJL 4QRRD 4APXA 3LHAA 3TX4A 5E00A 1F86A 3SD2A 3MNWB 5T1LA 1NOFA 3S5LB 1NSNL 2YMOA 3GXPA 4JGUA 1PY9A 2Z8WC 3LH2L 5KSBB 3P4NA 3BDYH 5C9JB 4BQ8A 3VI4E 2IH9A 2OJZL 1OAKH 2JNZA 4OB5L 3BXNB 2DKMA 2YGOA 2AXJA 2DEWX 3GLDA 3U79A 1KTJA 5D2LB 3SDCD 3V8CA 4PWEA 1JXGA 3RGBA 2Q0ZX 4LPVA 5CN1A 3S3SA 1KLFB 3TIEB 4XEIC 1I7RA 2YPKB 1BZEA 4PJFB 2H26A 4PRDA 4GW5B 3QIUB 4OVUA 5D1ZA 4ZS6C 2X89A 3UYPA 3HN5A 5HYNB 1QEWA 2X7LA 5KYWA 4JE0A 2Y5TB 4BIKA 1JMXA 5AWNH 4OFYA 1DHKA 2AQ2A 1DL7H 3AWGA 3K4DA 3D7PA 4PJBA 2JJUA 3NDZE 2AQQA 1IFGA 4PRHD 4XPHL 3FQ4A 4A68A 5JNYA 1QLEB 3F6LA 4OZHE 5JZ7D 2I24N 3UTTD 1BQLL 3FQTA 3ARRA 2OBGA 1RUQL 5D4HA 4JRYE 1LE5A 4F7EA 3WN5C 4J77A 4PCYA 4BSVB 2GT9A 4MCNA 1KFGA 5IHHA 1S7WA 1QUPA 4FQXA 4X2UA 3PXHA 3H7LA 3B1UA 3DHJA 3GSQB 2VOTA 3ZHDA 1TQWA 4ORGA 4PRIB 4WJKB 4L37A 1QFWL 3OJVC 5B8CA 4NSXA 2QQLL 2XYIA 1NUDA 1LLAA 5I1IL 2NQDA 2OCFD 2B1HH 3N9GH 1IZKA 5F1KC 2VXQL 4HZLA 5GSVB 4NQDE 2MQ3A 4ZUUA 1WP6A 1I7UA 4FQQA 4HSQA 4N1EA 1LO2L 1XHMA 4QXGH 3UO1L 4BA0A 2XL3A 4EF3A 1BD2A 3DUUA 4W9JC 5IK3B 4FKHA 3BLBA 3GHBH 2X1QA 3VWKC 5BZWB 4HH9A 2BNQE 4Y7RA 1KV3A 5I15H 3GM8A 4BFIA 4OW6A 3MQIA 5HGAB 1P7HL 3V4VB 3WGVB 3VTTA 1R3LB 4PHZA 3NCBB 3OXSB 2Q76A 4ETQA 1JGVL 3IJ7A 1TOXA 2UY6B 2RD0A 3BAIA 4U7SA 4H8PA 3T0ED 5D8JH 1ZEAL 2J7LA 1MI5D 1A3QA 5EEWA 3ZE0F 4J87A 3DV6A 4UANA 2YD3A 3SDXF 3HTLX 3QO1B 3TWCH 2D7TL 4GMSL 4G9DB 3TP4A 4FWWA 1IAII 3G9AB 4B9FA 2FEEL 2FJFA 5IJDC 1U8OA 1FYTD 4IMLB 3ULEC 4NIKB 1M7XA 2A1WH 4F91B 1E27A 1FRGH 4P07A 3DVIA 3QYMA 2R9HD 1EEZA 4F15B 1F4WH 4M7JL 4LCIH 1Z9LA 1Q9OA 3HNVH 2C7UA 5AYUH 2PCYA 3VG0L 2CO6A 2JKRM 4E9RA 2OZNA 5IESH 1VDGA 3QWRD 4AMWA 3NIDE 3HIZA 3VFUB 4AH2B 1AGBB 1E3ZA 2FO8A 5EM2B 3L5HA 3S5ZA 3MREA 5HHOD 1XF2A 3M6DA 1TEGA 1U95B 1ASOA 1RPUA 5FWQA 2BVQA 3SCMA 4QRAA 3FT2A 4HJEA 1RURH 1SQMA 1VEMA 2NY2D 1ZJBA 5ANMB 3SD5A 3CZGA 1F2QA 3HZVB 1UM4L 4JN1H 4P4RB 2Q6WB 1NWOA 4OAWB 1QFHA 2D7QA 4HIXH 4PGEA 4IKKA 1BZ9A 1MHPL 1Q94B 5I6PA 5ITBL 3HC4H 4F9PA 3QFJD 3OHXB 4PJ6A 1UXSB 3A21A 3P3RA 4XCFL 3S37H 1NFIB 5J1AA 1AGDB 1IC1A 4PWIA 3I7NA 3QHZL 2QVIA 4ZUTB 1JCVA 1QZ1A 5IVZB 1D6VH 1N6UA 5D1QA 5AMSA 4UIKH 2AEQL 2O72A 1S5IL 1WBZA 1OM3L 4MS8D 3VFMB 4KTDL 2HLAB 3LNHA 5GS0C 2CBOA 1CDCA 5FOJA 2ZPKL 3ZT5A 1F8TH 2CRMA 4YLBA 3W2DL 2OI9C 1A6VL 4XOEA 2OJYA 1P4IL 3DI2B 1MJ7L 3VI3F 4Z0BH 2EH7L 1BG9A 2AEOA 2PWGA 5T5NF 5C8JA 4DK6A 4U1SA 1AZRA 3O3BB 3H2WA 1NPJA 4A7UA 4Z7QB 4O58H 2O9KA 1M7DB 2Z4TA 2HKMA 4HCRH 3IDGA 1MG2C 1YFQA 2Y22A 2EIZB 3P73B 4PGDA 4PLNC 1IVTA 3D3VA 4R4ND 4X5XA 4ONGH 3MXWL 3P0VH 4YO0B 2FT8A 3K81A 4DN3H 1K2DB 4M3HA 1CC3A 4LG8A 2DQTH 3BVVA 1T83A 4ACPA 1MCQA 1JF1A 3LKOB 2MHAB 4G7QB 4IKJA 1TQBC 4XN4A 3ATDA 2BVOB 1N5YL 3ARFA 4JHAH 5F89B 1RK0B 4EKXA 5E1AB 4RMWA 2K6ZA 2C8NA 2CLRA 3QZWA 3SYPA 2WXPA 2EYSA 3PWVB 2WXGA 5IFHH 1G87A 1E28A 3OD3A 2QMKA 3IJ8A 1PW3A 1X5XA 1QWHA 2CKBH 4MSWB 4PYHA 4BK8A 3BUYB 3ML8A 4MBOA 3VTMA 4BXVA 3QDJD 4HS8L 4FKEA 1IGYA 1D5XA 3CK0H 4L8BB 3BN9C 2OS7A 3S34L 5AVRB 4XN7A 2IVFC 3UGUA 4DP8X 4LL4A 1KYOK 2EIEA 1PTZA 1X4XA 2DEYX 4ZTOH 4I77H 1RUAH 5AW1B 4FZ8L 5C97A 1AQDB 1U8MA 2WKOA 3OKEB 3M17A 4GS7C 4HJ1A 5F6HJ 4GI9A 2IANE 4M6MH 1FNSH 5A2BA 1AOZA 3AB0B 1FVEA 3RY6C 4ANXA 3IJ1A 1TQTA 1CGYA 1Y7VA 1BM3L 4N22A 4W9IC 3ZTNH 3AL8A 3H0TA 2E46A 3VSQA 5DDHB 1TVBB 5SWSA 3UBGA 3FOLA 1GOGA 3NZHH 5KS9F 3IU3A 2VSCA 1ZLUK 3TH3T 3QUZC 3G5ZB 3MO1A 2J88L 2CWRA 4NQDD 1UOQA 2NPLX 4NNYB 5J89A 3VXTB 4JNXA 1GXEA 4ZTPL 1Q9KA 5TQ2L 1Q0EA 3MCLH 3WG7B 4YDKL 4KMTL 2HZHA 2OMTB 3TPKA 1MG3A 2GSMB 2AGZA 3C6SB 1OO2A 2YWZA 3K8LA 2X4NA 2WUBH 4Z3HA 2MQ0A 5FHBL 3MGTA 3TEXA 4OZGF 4XPFL 2Y3AA 3WKPA 4A0BA 1S9VA 3WIFA 5CBEA 1A9BB 4LCYB 5B38A 5BS0B 1TFPA 2WXNA 1GKEA 5DJ8A 4PP1D 4OJEH 1BXUA 4CC0A 4BGDA 4UM8A 4QD2E 3JXAA 1V54B 1E4XL 1NGQL 1YPZE 2A9NL 5GGRB 4PRPD 2P9UC 1OW0C 2YEVB 5BQDA 1KF9B 1Q1PA 2BSRA 2X05A 1SXCA 3JT2A 3HE7D 4HKBB 5EULV 5D5MA 5DVMA 4TLUA 3WEAA 4PJ5E 2HYMA 1U2HA 1BGXL 2VDQL 1T0PB 2VH5L 3LMJH 5I5JA 3UMNA 3IDXL 4BZ1A 2P5WE 3MRHA 4YQXH 5I76B 4U05A 4FG2A 5IW1B 2IUPA 3TBCA 1BVNP 3QR2A 3L7FB 5E4OA 4WKXA 5AAMA 3T04D 1I8LA 4WO4C 5EPMB 3PHSA 3KJ4C 1VFBB 2P52A 4KK8D 2J56H 2EDKA 3DX9B 5BUGA 1W15A 3L1OH 3MTXA 1KTLB 3PWLB 1FCGA 4F58L 1T2QL 4F33A 3DHPA 1I85C 3FZUD 4CJ0A 3LPWA 2WO3B 3CC5B 4Z1PA 4JFZH 3L5XH 1UOVA 4ODWA 2CIKB 3GJEA 1ES0B 3N40P 2CALA 4H2AA 3LRHA 2AHIA 4GW4A 1QR4A 1TZGL 3N42F 3CFKB 1NGXB 2J72A 1MCBA 4JFQB 3HI5H 3JZHA 1J12A 1DLHA 2EE3A 4HKJB 1HESA 3Q6GH 4NRYB 3MRPA 3QC6X 3RX8A 1EVUA 2XNAB 2FSEA 1BHGA 3JSSA 2OR7A 3P9MB 5F88B 5FUCE 1YCSA 2EKJA 1U91B 4TNVK 3S8WA 2GFBA 2QDWA 5A2AA 5EA0L 4H8WC 5E5MA 3WNMA 5AZEL 3EI1B 1QTYT 4LNVA 1D5MB 2BFVH 3F6JA 4GRMA 4PB0L 4XPBL 5D70L 4BFGA 3Q06A 3IFPB 2R0ZL 1I3UA 4NQEB 4X4ZA 4U49A 3QDME 4ONOA 3GS7A 4MMXC 5C0CE 3SPGA 1H8LA 3D4YA 1C1EH 1OF0A 3A4FA 4EN3C 5CSZB 5GS1C 4BBWA 1BAWA 2YO3A 2V9QA 3FCTB 1MFAH 2MKLC 3MXVH 2HX7A 3P4LA 3VFOB 3VYNA 3C09C 5K9QI 2AGYA 3LHPL 4XH2A 2IIJA 3WHE1 3D69B 1ORSA 5FYKH 1RZKC 5EZLB 4NP9A 3ARDB 4RSVA 1JZIA 3QC5X 5D7KD 5A2FA 4G8GB 3TM6A 5GMKn 1ZSDA 4Z3FA 1KT2A 3JTSB 5I28A 1GCFA 4N86A 4PB9L 4PREA 2WNWA 3V6ZB 2EXYD 1JXDA 4G1EA 4JXMA 4RGOH 5TPWH 1KTCA 5HYEA 3SDYL 4P9HH 4GAAA 1MCPL 3HE6C 3PQYA 1BMGA 43C9A 3AXIA 4OCRH 4TNWK 1OAUL 3FFCB 4G7YL 2EE0A 3C5ZC 2QDVA 1OZUA 4AYMC 1BF5A 4DO4A 3QUHA 5D2NA 5IQ7L 4CVZA 3DO4A 1P1ZB 3HHSA 1DJXA 3ZTCC 4ZX4A 1S8DA 2R8SL 3AACA 4MD0A 3VFSB 4RWYL 3MRCA 4UUJB 3KBHE 3RIKA 2J44A 3GHEL 4Q6IB 4F3FA 4OLEA 5GJTL 1OAXH 3BYTA 3O4JA 1IM3B 4GUCA 3UJIL 3ZE2E 3TJHD 1AE6L 1J0KA 1XFPA 3C6LC 1EHAA 1A6UH 3GNML 2HWZH 4JM2B 3TBWA 3HCVA 5LNDA 3FUJA 5C0ND 4AQ8A 2O5ZH 4MD5A 2P9SC 3FCSB 3SPVB 3WE6A 2AK1L 1J5OL 3BQUB 4DZBB 4W9ZA 4I3SL 1DBMH 1CYWA 1QFUH 2X53A 4PGCB 1CZ8L 4JHZA 2EDRA 3OKMA 2XDHA 3QUKB 1CLZH 4LF3B 1XIWD 3ZTJG 2Z2NA 4S2SB 1MY7A 4ZI8A 2DQJH 3IJCA 4MDJA 4RDQG 4XXCA 2ADYA 1WPCA 3ZT6A 2P48B 1DJIA 4ODVL 1K9TA 3RVXC 1PZSA 3WJJA 2WSDA 4MQXC 4APQA 5JW5B 4OGXL 3MV01 3OAUH 5IB5B 5HI5D 2HMIC 3UTQB 2CIIA 3H3KA 4GSQA 1SJVA 3PHAA 2BINA 4M8QA 3PWUA 3DRTB 4X7CC 4PJHE 5FW7A 4AUJA 5H94B 4R7VA 1J0YA 2DYSB 2FJUB 1P0SE 3ASOB 3C9NA 4AKPA 2DQCL 2CN3A 2OQJA 2PCPA 1MFDH 4Z8FL 2H6OA 4Z0XA 3GBNH 3LXBA 3EADA 5GGTA 3O0RH 5C9KA 3STLA 1BFVH 1E9OB 3GTVA 4QWWC 3T8XA 5F1NB 2B2XH 4GO9A 3IVMA 1MQ8A 4TNVF 4GBXB 4KOCA 3NBNA 2AMUA 3RDTD 1X5ZA 2EYRB 4B9ZA 3MLZH 3RRQA 2VLJA 3P2DA 2DICA 4U1LA 2C3HA 1I3GH 3OQ3B 1LWRA 1GGYA 3ZJAA 5I5IA 2MPAL 3RRMC 5F21B 3WNNA 3O6FC 2NZIA 2HT4D 5FKPB 2V9UA 2VKWA 1I75A 4MB1A 4ODHL 5JOFA 3POHA 1JF5A 1F4YL 5ISZB 1NMBH 2OKMA 1P69B 1BVZA 3IDNB 4MRCA 5IHUH 3V6OC 4M00A 4DP7X 1QRNB 3BXNA 1SRDA 3OZKA 1ACYH 3MX0B 4V11A 1AJ7H 3FSWA 3DSFL 2P9PC 2P3YA 4M1GH 4MMYB 5B21A 5D2LA 5HYJE 4HQQL 3U7YH 3WDIA 2QGBA 2OVPB 4XVSH 3O6LL 2D3JA 1KIUB 4WNJA 1DDTA 1I9RL 4MCZA 1JYWA 3TIEA 4PSXB 3QDGD 3TN0B 1NBZA 3I6GB 2NZ1A 4GW5A 3TA3D 4YC2B 4XTRD 2NY1D 3EHBB 1YA5A 1TR7A 5JW3L 4NNXA 4MWFB 2MEJB 3MHZA 3VD9A 2AQ5A 1VFAB 5FO9B 4JEGB 4TNWF 1UQSA 3NCYP 3QORD 1GRWA 2J1WA 2OXGB 3RDJA 5HYQB 4JDTL 3H9HA 2HXCA 2CDFB 3CBRA 2BHUA 1J5DA 1WH0A 3TFBA 1MLBB 1NIBA 4AEHL 1V10A 3J8F7 1Z5YD 3OB0K 1D9KA 2GYSA 2ZXEB 4GEJA 1U36A 4RGMB 5MP6H 4BSVA 1ERNA 4ELDA 1WFUA 5CJXC 3GSQA 4H44C 3SE3A 5LQBL 4WJKA 1E5BA 2XVLA 1RL1A 3EOBB 4KXZI 5BRQA 4N2FA 2H2SD 4PJ9D 2BOLA 2J8UF 4X5LA 2BH0A 2ZWYA 1AD9B 4IBLT 4LSPH 1CXLA 3GEFA 3QNZA 1OK8A 3X14A 4KHXL 3LD8C 1UVQB 3FO1B 5TTRA 3ZDZB 1SVZA 1DBJL 2JB6B 2R0LH 4PMFA 4JGJA 2Y7QB 1N8OE 3N85H 1S7SA 5IK3A 3LKSB 4AIEA 4DWHA 1L9TA 4FG0A 1JPSH 1S3RA 5BZWA 1EO5A 4CN6A 5C92A 5D7IF 1SXZA 3EH2A 5HGAA 1P84K 4HJ0D 1DFBL 4NRXA 4J8GA 2BSTA 1N64H 3V4VA 2OYLA 1WIUA 3K91A 4WFEE 1XH2A 5EEXA 5HI3C 1NEPA 1FLTX 2GAZB 3I7OA 2H6NA 5D6CB 3OX8A 3VFVA 1OLZA 3P4OB 5CXBB 1JERA 4U1KB 4XZ4A 4M1CD 1JZGA 4JSVC 5C07E 4CUCA 2O1AA 1A6WL 3TBTB 3BH9A 1MAJA 1P53A 2DQEL 1BXVA 3QH3B 5HGHB 1XB6A 4Q6YA 3D2UD 1WEJL 4K5MA 2NLJB 1NAKL 1S7RA 4G9DA 1MUJB 3OR7A 4JMXA 5GS2D 3GIZL 3ISWA 3GM0A 2VR4A 3VW3H 2DY2A 2F54E 2WIMA 1KN4L 2RCSL 5L88L 5K1JA 4ADJA 4F7KA 2VISA 4MJIB 3ALPA 3GDBA 5E2WH 2QGDA 2YIHA 3SGEH 2R2BA 3PXLA 3QP3A 4HOMA 1K3IA 3F7KA 3ME0B 1NC2D 3DXAD 4PBDA 4QOKD 4K2UL 1XCQB 4X6DE 1ED3B 1N68A 2WBWB 2GBVA 1KCRL 4AH2A 4BFBD 1BEYL 3T08A 4LIQH 5IT2L 1KPVA 4JUTA 1QX1A 3KZ8A 5FCUH 3E38A 1U95A 2FUTA 5GGUB 5HHXL 2ZP9A 3UYRH 1OANA 4OLWL 4L18A 1B0RA 4KK9D 1V3KA 2XI9A 4XN2A 4P4RA 2Q6WA 4NN5B 3O81A 5F7YC 4AYID 3D0VB 2Z7WA 2HRGA 2IALA 1Q94A 3SDDD 3ZQ9A 4KTEL 2E8ZA 2AK4B 2M83A 4H0HB 5MEPA 4AL8H 4A09B 3OHXA 4M7KL 4NP4L 1H8SA 3N43F 2YD4A 4NHUB 2R69H 2COVD 1K5NA 3LNDA 4TVPL 1BD2E 4WVRA 3ZZLA 2IH8A 1U3HA 4BRVA 5IFAL 4BH8B 2V8MA 4CN4A 3GS0A 2EO9A 1YN7A 3CGTA 4P46B 1HH9B 2BJML 3PUUA 4KDWA 1JPST 1QYGL 2Z8RA 1GC1L 5JO5A 2DMKA 2HLAA 2JCCE 2GIYA 3BDYL 3WFEH 3L4ZA 4OIAA 1JK8B 2DWEB 3QEHA 4IEFB 4WW2F 3DUHA 4HUXB 5CU5A 3NIFB 3CZSA 4N20A 1QQDA 2K7QA 4PG2A 1S4UX 3VI4F 1YDPB 4FTDA 2B4CL 4QHLB 5DZLA 2JVUA 1AZCA 3A6BL 25C8H 1TVHA 1A6ZA 3D39D 3D48R 3L5WB 4H8QA 2UZXB 4LKCB 5AB2A 2WQAA 2PM9B 2F1EA 4M29A 1A21A 1EERB 1M7DA 4LSRH 3PL6C 3U4BL 1IX2A 2WBJA 3NTCH 1DJSA 4XMKL 4D9RD 1RZGB 4A7JA 1X4YA 2ZOKA 5IBLD 1CG9B 5K9JH 4C8XA 2ETWA 1EXHA 4J84A 2EIZA 4GSRA 1JD9A 1N9PA 4N5EC 4X0KA 2HFGL 4X5WB 5B4WA 1ZTXE 3ULUE 3OKOB 2L0DA 4MAYA 1K2DA 2GITB 2OMWB 4IJTA 5E6YA 4LE8A 1EUTA 5JQ6H 2ZKMX 1E5AA 3Q44A 3LKOA 2MHAA 1ZANH 2R69A 1QABA 4OZHF 3TO4C 5IF0B 5I8KH 4PG9A 5I71B 2XX0A 2BVOA 2F58H 1UJ3B 5F89A 2VUOA 3LKQB 5FKSA 3GXMA 5ES4B 5E1AA 4NNPL 3GLZA 3O9WB 1USZA 1T4WA 2CJUL 2DIJA 5CINH 2OYPA 3TEZA 3PWVA 4FNTA 2RFXA 1DLFH 1PLBA 1N7MH 3NJHA 1T0NB 5JXEA 3RVWD 2WWKO 2B1HL 3R06B 2O61B 3MFGB 1XX9C 2J2ZB 5I0DA 1XF3B 2YA0A 1IM9A 2HVBA 4K5OA 4LL1A 4ZODA 4WU5A 3WOVA 1NGYB 3GHPA 3Q05A 4PS4L 1N10A 3HRZB 1F56A 4K8RH 4YWGH 4L4VB 3OKEA 3A4AA 4LNRB 4QY8B 1UYWH 5C2BH 5GRJL 2BIMA 1I1FB 2EKSB 1CD8A 3HN3A 1MFNA 3MV8D 4Y4KD 4HLJA 5ESVB 5FFOA 2X9ZA 3F58L 4IW4C 5MENE 4BP9A 4MA3B 4TSCL 2QADD 1Q47A 1QNZL 2J73A 3RGVD 5AW5B 1DE4A 2ZOLB 1TTGA 3OWRA 4JFDE 5I6NA 3PS6A 3QUYD 1ZPUA 3DBXB 3UC2A 2QHRH 2XT1B 1ETB1 4P5KB 3O45A 1GPOL 5CXPA 3VXTA 3P3TA 1QSVA 2D2CC 3K72A 2WP3O 3PFUA 2EXWD 3FRXA 4HBQA 4WIQA 1DJHA 2TRYA 1WUZA 3C6SA 4TULH 3TWCL 3V0AC 2X70B 5FKRA 3SQOH 4AITA 1WAAE 1M6UA 2MMXA 3EYVB 3GD1C 1A9BA 4FTVD 1SOQA 5IHZA 2OSWA 1S78C 5T1KB 3HB3C 4MJHA 1DZBA 5E2VH 4GQZA 2A99A 4G71B 5T1LD 1CDUA 5GGRA 4ZOZA 1H3PH 2R0KH 3CDCA 2WQXA 1QTPA 1J8SA 2W5PA 4N8PA 4HXAL 1H2XA 3D4GA 3HS0B 4LT7A 4QRPE 3C8KB 3QEQB 1N26A 1Z3RA 4HKBA 5FGSA 5CEXB 1FHNA 3IAQA 1MFBH 4PCSA 3KE0A 4JFFE 5AOZA 3I89A 2VN6A 2X0UA 4NO3B 4U1IA 1R5IB 3NIDF 2ED8A 5DJXB 1UH2A 4UINH 2EECA 5I76A 4IOSA 4XE5B 5DQJA 5IW1A 3UBXA 1YEKL 1PZ5A 1HNFA 3NSDA 5D1ZD 1MIMH 2X89D 1HE8A 2CR0A 3WKML 3GXUB 5KVDE 2A7BA 2IQAA 3ZSTA 3O3EA 4KHTH 4OLVH 5D93C 1VFBA 1L7IL 3AT8A 4OFYD 4U1HA 4NC2B 4XNMB 5GZNA 2PXYA 4HIXL 5DYFA 3CDYA 4ZK8A 1THAA 4FYSA 2ZOOA 1KTLA 2WLMA 3AG4B 3CVHB 2I32A 3B2UC 5HP5A 4O5LH 5ALBL 5JA9A 5DS8A 5IB1A 5SWZB 4P9ML 4PLOB 4F57H 1QMUA 1B9YA 1WAEA 3SIKA 3SDAC 1FVCB 1ES0A 2FWLB 2WLKA 4I0PC 4CNIA 3AQDA 1YUHA 3KYMB 2DWSA 2KI6A 2CUAA 4JFQA 2W92A 2ALAA 4UIKL 2XJLA 5GSRB 4FQXD 5JHLH 3LS5L 1MCKA 4NRYA 4YHOL 2D31B 2E86A 1AD0B 3U2IA 1HQRA 1U33A 4L3EB 2ESVB 1ZTMA 4KJPD 5K59F 1NGZB 5IB4B 2I9TA 1U3NA 2MNJB 3Q1SH 5TEFA 1SFHA 4QXWA 3C75H 3RWHB 1HINH 4AM0B 2X4QB 1MH5B 4Z7WB 5E1QA 1D2OA 3K2UL 1V05A 2XQYA 5HJ3A 5JR1L 1YJDL 4MNQE 1MHEB 1ADQL 3EI1A 1HHJB 3OWEA 2P47B 5CMAB 4LG9A 2KC0A 4Z7UB 4Z0BL 5JORA 4I79A 1BD2D 2GSIA 2F7RA 3OR6B 4GLRH 4UTBL 3BESR 4JDVA 2IBZX 4AG4L 1GA2A 4S1SL 2HLEB 1NCUA 3AW5A 3HHRB 1FCCA 3D69A 3HPLB 4XBPB 1WV7T 2G2RA 5EZLA 3WNKA 4Q97A 4ONGL 2XY1A 3BPLB 5KG9A 5IT9g 1NCHA 3K74B 4NKIH 2DQTL 3I85A 4JGMA 4J3OH 3CLFH 1LEGB 5D71H 5EOCJ 3V4PL 5L6YH 3L9YA 3BVNB 3B83A 7PCYA 3JTSA 4DKTA 4NZFA 5I18H 1VCAA 2H2PC 2VDNA 1MCIA 4FG6D 1PD1A 1L5GB 3KYKL 3P2TA 1D5IH 5JHLA 1ZVHA 2VWEE 2ZCLL 5D4JA 4B53A 4MA8H 1K6QL 3NGBC 5IFHL 3FFCA 2W59A 4A2EA 1D6EB 4G6ML 1CFQA 1PZAA 2CKBL 4K9EC 3MVDK 4NUGH 3EZ8A 3EJQA 4JAMB 1P1ZA 3ZIYA 3NJXA 1HSAB 4AMKL 3EFOB 3VFSA 4RH4A 4PP1C 2H13A 4N25A 4Q6IA 4F1SA 3DDUA 3GGWB 5L4MA 2MJWA 3FOMB 3EXJA 3UJJL 3V5WB 2ZOTA 4KO6A 3WE1A 1JWUA 3NOIA 3F64A 3L3JB 3WDHA 3NJGA 4K3JB 4UB0L 4PJIB 2VDOA 4XVJL 1ZD6A 5DD1H 2OR9H 4HFUH 1P7QB 4WV1C 2CR3A 1BZDA 5AW0B 5H17A 3B1TA 3HMWL 2CRZA 4WCYL 1FNSL 3SPVA 3EJTA 3ZT7A 4CW1B 3BQUA 4DZBA 3E8UH 3SCMD 1QR1B 1T5XB 3UIZA 4A6YH 2EUWA 1NCCH 4PGCA 2P8LB 3JRPA 5IQ9B 3MACH 4XO4A 3KGRA 1EQWA 1UD3A 2J5LB 1GHFH 3QUKA 4LF3A 3ZTDC 1V27A 4S2SA 3VH8A 2FX9H 2E9JA 3HNSH 3L1GA 1RIHL 3NCJH 3F7VB 2FHFA 2BVYA 5JPMC 4P2AA 3L3IB 5A43C 4LDEB 1TVDA 2MKWA 3SPCA 3MCLL 4YSCA 3BSZA 4HJIA 4MNGB 5JW5A 4GM9A 5IB5A 5IMKB 3UTQA 1YZZA 1YY9C 1R6VA 2ODIA 2YLKA 5FYLE 2V3DA 2KKQA 1BYOA 4AX3A 4KKCC 5DJ6A 2HCZX 1JL8A 2VDLB 3E9UA 3UG3A 4H20H 4Q56A 4J73A 4PJEE 5D1QD 2O5XH 4DN4H 3ECQA 2EIKB 3HAEH 1K4DB 1X9UA 4DGVH 2JJSC 1I1RA 4QAMB 1I3VA 2BBKH 5GSAA 3EH3B 4PGBA 1OOAA 1E9OA 1JD7A 1WHOA 1UOLA 1YPZF 1S7VB 3MV11 3O4OB 5EOCH 4I18C 5F1NA 1FWXA 3LXUX 1SXAA 4GBXA 4L9LC 2MCAA 2F7QA 1AFVH 4OGYL 1MXDA 2EYRA 2P4AB 1NMCB 2X28A 1GJIA 1NQBA 1MHHB 2QZ5A 2QELA 3NVXA 2Y72A 1JF6A 2VIRB 1JBJA 3RURA 4V1DB 2C3XA 3MODL 3ZDXB 2FNBA 4GAJH 3MLSH 1IKNC 3MBXL 1PNDA 4WKZB 3PLYA 3V7AG 4F9LA 3IDNA 1I1AC 3DJZA 1RK7A 4BUHA 5FOBA 4GP5B 3IXAB 4WI7A 4JPKH 2G60L 2E27L 1EWHA 3D3VD 3MX0A 3DGGB 4NPKA 1H0DB 1HCZA 1A66A 4HK0B 5EBWB 2VC2L 3NCWA 4XCYB 4CGUB 3SBWC 3RKDD 3LEXA 3SGKA 4CC1A 1FBIL 3ARFD 1PNCA 2J4WH 2JKLA 4D7PA 4ODTH 4QF1A 4QTFA 4GAYB 4MWFA 1VFAA 5FO9A 1Z9MA 2H1LM 1LEKB 1NFDE 3QCTL 3IJSB 4Y19A 4S1QL 3LSOA 4R7NB 2IH3B 3VMPA 5I1JH 5DJ0B 4LLMA 4YSAA 1UUNA 1FNGB 1GZHC 3NG5A 4POUB 5H14A 1HU8A 5CU9A 1OB1B 2NY6C 3V5DA 1JDCA 4JFTA 2CDFA 4ZFOL 2O26U 2XQBH 3H3PL 3H42L 1NGWB 2Y1VA 2GQHA 4OCNC 5TF1H 4YDJB 1MLBA 3DECA 3QNYA 1ID5I 4J3OF 2VDRH 5EU7E 2X41A 3WI9A 2GJ6A 4KJQC 1JOIA 5DHEA 3C60B 1S7XA 1E8WA 2ZG1A 1KXQA 1XF5B 3V0JA 1NCDH 3MXVL 1EZVX 2PWEA 5JXAH 1DJZA 1SXBA 5FW6A 5FGCB 5FK9A 5MERA 3UAEA 1LP9E 2ZKYA 2A38A 3CJJA 4GW1A 4B0MM 3ULVE 1F6AB 5SWSD 4FQJL 3OAYK 4PY8I 5DO8A 2XG4A 3FO1A 3ZDZA 3MJ7B 3UTSB 2JB6A 2Y7QA 3I02A 3LKSA 1I8KB 2EDWA 4AQ1C 3MV9E 3PXSD 3ZDYA 2CGRL 4RGOL 1JZ5A 1TZAA 2VXUH 4R2GD 1AGFA 3Q13A 1NPUA 2EIJB 4XAKD 4FP8L 4W81A 1M57B 4KI5E 1ZT1B 4HIJB 1L0QA 2GAZA 2WY3B 3OL2A 2QLYA 5I8EA 3CDGB 4CA4A 5D6CA 3P4OA 2ZXWB 5EBLB 5CXBA 5I19L 2B7DT 3OGCA 4C56A 4U1KA 3RTQB 3NSYA 4OZIE 1REIA 1YQVH 2YK1L 1UT9A 2VN4A 4H25B 4AC2A 1IKOP 5KSBE 1I8MB 5EARA 3TBTA 1TO4A 4KTYA 3WFDH 2GTZB 4G7RB 2ICEC 1BXXA 3QRGH 3QH3A 1DSYA 1L9OA 4UYPA 5HGHA 3T3PE 3ZE2F 2LFGA 5D2LE 3RDTC 1MUJA 1FO0L 2ILLA 1ICTA 1UWEH 2QHLA 2PTVA 3MRRB 4IBTA 3VWJC 3EMHA 3CQPA 3QVAA 3VD1A 4R4BA 4PJFE 4WDIB 4LBEB 4UT6L 1TUPA 5HGBB 4JCWA 4F7MB 3LRLA 4MJIA 4QT5A 1E7UA 3L5JA 5JIHA 3MBEA 2H32B 3BT0A 3BX7C 3MLTA 3B34A 2XXMB 1T5WB 3BO8B 2RAMA 4R96B 1KEGH 4I1RA 4JFXB 4L23A 5CHNB 3JTTB 1R17A 3ME0A 3OTTA 4A08A 1XCQA 1UOOA 1ED3A 2Y07L 4W93A 3CZJA 3MRIA 5DD5H 3C2AL 1E2VA 3NQKA 5LGHH 1G4MA 4KPHH 3K2MC 3THML 2IFGA 4PJAB 3CUPB 4WWID 3LNEA 1OVZA 3TV3H 1SDAB 5KVFL 1CN4A 4PS7A 5GGUA 1XGYL 4KQ3L 4X8JB 3WBDA 1Z66A 4IOFC 5I1DA 5IEHB 1HSBB 3MCKA 4N0UB 4Q74A 4PJHF 5E0QA 1A64A 4X7EC 2B16A 2D3NA 4PRIE 1TEYA 5FGBC 5ALCL 1E5ZA 3DYPA 3UJTH 1TZHB 1LE9B 4QNPF 3IBOA 2UZPA 2NUTB 4G7SB 1P9MA 2Z31B 1BBJA 1PD6A 4A09A 3CLWA 2YD8A 1PIGA 1U6AL 2WV3A 3OW8A 4NHUA 1WRFA 4LVHC 1KB3A 4UOJA 5DMKB 1O6VA 1EHLL 1GW6A 1CXHA 5KYYB 2I69A 1VGEL 5CGYC 2JTYA 5A3IC 2Z93B 3OJ2C 1TTCA 2CE6A 2R29A 4P46A 1G9NL 1HH9A 1AKPA 4JRFA 4UIMA 2R83A 4EDWL 3VCLB 4ZMNA 1EJOL 2IXQB 1U4FA 3BSHA 3FUHA 1TTFA 4IEFA 4LEXL 1PQZB 4HUXA 1RPKA 4TLTA 4HPHA 2ZX7A 1P2CA 3EI2A 2J1KA 2EEBA 1LM8V 1UH4A 1IAMA 2OA9A 3L5WA 4LKCA 2IDSA 4G6FB 2W18A 5CEZD 1BQ5A 1UA6H 2PM9A 3NJMA 3KPNB 5T5NG 4ZYKA 1SLXA 1WZ1H 5BW7A 3F5WB 3PQYD 2G75A 4PBXA 1RZGA 4ZMOA 1CLCA 1WE5A 5TQ0H 5BJTB 1OT4A 3G6JB 4X5WA 1OZTG 3HN8A 4HWEL 4M1DL 1ZE3H 1QFWI 3BKYH 4W68A 3VTAA 4XPTL 2X5PA 3HBQA 2GITA 2ZKHH 1FJ1A 4ZDHA 1PEVA 4AXWB 5LDUA 4NWTH 1EEUA 3MFFA 4KVCH 2OW7A 3OXRA 4HC1A 3AWEA 3DV4B 1BCIA 3V0FA 1PBYB 1UJ3A 3QG6A 3LKQA 3P77A 2Z65C 4R97B 4AYSA 3IMRA 4NHCH 4PCTA 4HZ1A 2CHWA 3BWAB 3P11L 3EJYC 4I13B 2JLPA 1SJEB 5B39A 3T4YA 1CIUA 1B2WL 2Z92A 3PP3H 2X9WA 4NT6B 3BMVA 4TOYL 4NAMA 5A2JH 1DQLL 5ANME 4YDMA 3ULUH 1JJUA 4JR9L 3R06A 3L6FA 3QHYB 2J2ZA 2BSEA 5KW9H 1MDTA 5ESAB 4PTUA 1XF3A 4HBCH 2YSSB 1L7TH 1H9VA 2YSTA 3FCUB 3FONB 3EDFA 1ZSHA 4H8UA 2X6CA 1E6OH 3BJLA 3RVUC 4AUYA 1AQ8A 3INUH 2K70A 2HT2C 2OI9B 1JNHB 2E3VA 3RL2B 4CAGA 4OIBA 2D0GA 4ABQA 4APQD 3IULA 4O45A 1N4XL 4P05A 5FO2A 3QARA 2XWBA 4X7TB 5I8OL 4NAJA 1J8HB 2G5BB 2P5EB 1FC2D 4G5ZH 3FFDA 2FEEI 4KKRA 1SEBB 3PP3K 4MA3A 5IMOA 3MLPA 3S2CA 1IAIH 3CFJB 3JPXA 2ORBH 1YYML 1A14L 1ACCA 2ZOLA 5EWIH 4WNSA 1S9YB 3SE9H 1Y6KR 2AQPA 4TLSA 4WWNA 1F3JB 4NKOB 2YAQA 4O2FA 2VE6B 1DEEA 4Q6KA 3OKDB 4WZ9A 4ZOXA 5DHMC 4LLVB 5M5RA 4H8HA 2KERA 3T77B 5ENWB 1W6LA 2R27A 4NBMA 2C1OB 5I6LA 5DU7A 1XCTA 1BVOA 1JS4A 4XPGH 3EYVA 2VLJD 4JO2H 4Z7NB 1WC7A 1QFMA 2JXMB 3ABKB 4PVNA 2V7NA 2CHDA 3NIGB 4HLZH 4QHMB 4MLSA 5EU6B 4E5ZA 5F44A 1BWMA 2OR8A 3CFIC 4Z7QE 4XMXA 1SQ2N 4KX7A 4JKPH 3X17A 2X6AA 3DGDA 3L16A 1CO1A 2BZDA 3LZFH 3G9VA 2NOYA 3VD7A 4GXUN 2X0WA 1W72H 4ZMTA 2DV6A 3EJJX 1KJ3L 5FHAL 4ERYA 1HI6A 4H1LB 3MDJA 2BX5A 2WLZA 3D9AL 3HMXL 2LU5A 3C8KA 4OJYA 3AREC 5CEXA 2XWTA 5CYKA 2CXGA 4PJBF 1YNLH 4X42A 1OAYH 1XH0A 3LJ3A 1NDMB 5IREA 4X6DF 1QLFA 4GQPH 1R5IA 5GGRY 5DQDH 4FFVD 2ZP8A 4DGYH 2R23B 4GS7B 3P4MB 4HS3A 2VQ1B 1NOAA 4OV6F 3DURB 4G8FB 1EZUA 2DQ6A 3T2NL 4YDIL 1A02N 1U9KA 4BUJC 5F3HB 4XNMA 1TZIA 5EOQL 4J6RL 1ZGLM 5CZVL 1ILUA 1QATA 3RNQB 3WXWL 4ELKA 3UZEA 2BCJB 4RE6A 4JPIB 5DVLA 1FG9C 1F90L 2R4SH 5E56A 1XL6A 4FFWC 1BVLB 2XPYA 2W07B 3D0LB 3KYMA 4TRPH 1OSPH 4NQCB 2AP2A 1D9KD 4RQQB 3NPSC 4IIZA 5DZNA 5L8KB 2JJWA 1B90A 2E7MA 3NDYE 3NRFA 3N41F 5C0IA 5KVDH 5E8OB 2FECI 3NA9H 4L3EA 2ESVA 3PV6A 4NRZA 6FABH 2F7OA 5IB4A 3LX9A 4N28A 1FDLH 3GSNH 3RWCB 3ZPDA 4AMZA 4AM0A 1NIAA 3MOAL 2XFXB 2JCCF 4Z7WA 2NXYB 3H4HA 5D7JB 3CFEA 2WXFA 4ZOAA 4WUUA 4PJ7A 4BZ2A 3F12B 1HHJA 5CMAA 2QSCL 1ZGLP 4FDWA 2V2TA 4LOFA 4NKDB 4Z7UA 3N1FC 2AVFA 4W4NA 2Q86B 2CO0A 3CVIL 3V52H 3OR6A 1QHOA 1TTBA 3E3QE 3FXIC 2AI0H 2O30A 1VB9A 4IRZH 3IFOB 4FA6A 5B7MA 3PXWD 1NCWL 4LPUA 1IC5H 1OOWA 2DLFL 3HZMB 5BS0E 3D85B 4R6UA 2KDGA 5IVXA 2VNCA 3LS4H 2FUQA 4O02B 2ZUTA 1H3GA 4OKVB 4PY7B 1Q0YH 2OP4L 3KJ4B 4O2WA 3ULUF 4MQTB 2XCMC 3BVNA 3BG1A 2NY7H 1ZANL 3I2CH 4ZSOA 3RWJA 2Y06H 1TIUA 2F58L 2NW3A 3GMRA 4ICXA 2UWEB 35C8L 1L5GA 5CINL 2EXWC 4HV8B 5HHVH 3LXCA 3TFKD 4QLWA 4IBUA 2XZQL 1F4AA 4FMVA 1KMGA 1D6EA 1H5BA 1XEUA 3I75B 4JZJA 4AQZA 2DLGA 3GSNA 4JAMA 1J0IA 4N8VG 3FT0A 4OZFH 4YDVB 3UTPE 1HSAA 4JLRB 3EFOA 2QKIC 1MFEL 3GEWB 1ILSA 4NFDA 1A7OH 3D4ZA 1OM9A 3WL9B 1THCA 1KJ2L 2BWQA 1URLA 4IRSC 4LSQH 3QZLA 2FLBT 2E76C 4LP4A 4M6NH 3MTRA 3CFNA 4LSVL 4PUBH 5LBSL 5M95B 1A22B 3L3JA 1MRFH 3VA6A 5EMKB 2BIPA 4N0CD 4W1TA 1FAIL 4XP5L 5EDSA 2ENSA 2VDMB 2WPGA 4JPVH 4YXKH 3PSLA 3C6EA 3NMEA 1ZT4B 3WJLC 1JWSB 1U8IB 5EN3A 2HA1A 1KIPB 3ULSA 5E1HB 5J1TC 2JJTA 4EN3B 2P8LA 3IE9A 2BVUA 5GS1B 5IQ9A 5HHQB 3K46A 3U1SH 3C09B 2F1BA 1KV7A 4YS4A 3N55A 3IMBA 4LPXA 5T1MB 4LARL 4GGAA 3F7VA 4P8QA 2OMYB 2N0MA 2ZE0A 1P5VB 2W88A 2RB8A 4P2CG 1JZHA 4GQ2P 1AKJB 2V3FA 2QV2A 4MNGA 5I6OA 5LDSA 5IMKA 4CSTA 3IF1B 4HEPG 3LAFA 5LJYH 1SN2A 4XOAA 3SOBL 2K9UA 3F7YA 4DH2A 2MOQA 4NQEE 4Y4HA 3A0OA 3KPSB 4A38A 2VDLA 1IC7L 4AW4A 2EUVA 4K0OA 1U3HD 4NQSA 3S48A 5FYJU 3T6VA 5I1LB 4LCCC 5CCKH 3T3MA 1K4DA 3C5ZB 4KJYA 1Y0LA 4UOW0 2FBRA 1S7TB 4GQ9H 1RZJH 3IU4H 3L7EA 2HB0A 4QCIA 4LLAA 5LHDA 4QAMA 4FNUA 1DCEA 1SEQL 3SGJC 4BUGA 5I2IB 4ERZA 4LHUA 3BP4B 2ZCHH 5HHMB 4IOIA 4E9SA 3U2SA 4G8GE 2NY0C 2EEAA 3REVA 5ADPL 2H1PH 3G7TA 1MHHA 3S3JA 4XWOD 1VGKA 4ODSL 4XP6H 5IBTL 4BQ6A 1JPGB 2B9AA 2NR6C 2VIRA 3GZQA 1QFPA 2IV9A 3D2TA 5KBMA 4V1DA 3BOVA 3WLBB 5E24E 4KQ4L 1QFOA 4QRJA 4NYLB 2WBJD 1EDQA 5LN4A 2XVBA 4OVVA 4E42A 5KYXA 4H5SA 5CZXD 4AYEC 3QEGL 2XTLA 1DSFH 4DK3A 1RCYA 3FT1A 1HHIB 1FL5B 1RHFA 4MAYD 3UAJA 1H0DA 3MUY1 4BHUI 4EIBA 5EBWA 4F57L 4JDEA 3GFUA 3L54A 4XCYA 2F74B 4RX4A 5I5RA 4GB9A 4N4YB 2VDKB 1N6QH 3GRGA 1AVAA 3OKKB 4G8IB 2EDLA 1ZLEA 2V5RA 3WS3A 4GAYA 3ZZ1A 3BPOB 1ZRUA 1G0YR 1RD6A 3B9DA 5HDBB 4FXKA 4AX4A 4R7NA 5HHPB 1B6DA 2IH3A 4XN9A 1R3JA 5DJ0A 3V5HB 3KMDA 1QSEA 4NJ9L 5JXED 1FNGA 1SNRA 2DIBA 1ACZA 2QEJA 5KUMA 1MWOA 1PLGL 1UGNA 4GP4B 2NNAA 4PV8B 1NGWA 4HT1H 1HKLL 2IAAA 1IM9D 3AWFA 4YDJA 3D87B 3ZO9A 1VYHC 1GZQB 4ZAKA 4F27A 3U7WL 3IJ9A 1JGIA 5LGYA 1CE1H 5CWSA 3NABH 3C60A 3EOTL 4DKDC 4DSYA 4BFNA 2XG5A 1UD5A 1JZFA 3O6FB 4JZNA 3DVNA 3TXAA 4XO5A 4M5SA 4OFIA 2IV8A 2DMGA 1WLHA 1NKGA 4Q2ZB 1B9KA 3ECUA 4NM8L 4XNQB 1Z3GL 3FUKA 5DO2D 2BOBA 4NKIL 4DPRA 1IMHC 4PJGB 2DEXX 5D71L 3QAQA 3MJ7A 5BQ7B 5L6YL 3UTSA 1UCBH 3OZLA 4FA9D 1SMAA 4MZRA 2C34A 4N5UA 3VYPA 1CURA 5I18L 5B3JE 4IHBA 1MAML 5AUMB 2P8PA 1C12A 2OTWB 2VERN 1ROWA 3N91A 1YAIA 4L1TA 2ADFH 4N0FA 1ZT1A 1LJMA 1RVFL 3G5XB 3KS0J 5D1XC 2DI8A 3CTTA 2FZ3A 5DHDA 5E2TH 4CU8A 2EP6A 3LY6A 4LDOB 3X1FA 3CDGA 3RP1A 3ULVH 1XGRB 1AAJA 1J1PL 2YAFA 1NOLA 1QLRA 1RZPA 3AU1A 3G04A 4GKNB 1HQ4B 1L4IA 4LSSL 4PBVC 3TC9A 4H25A 4X6BB 5ISZE 1CMOA 2I0RA 1XZWA 2BSBA 5DMIH 3CXDH 2Z1KA 2FVNA 1IAOB 5EU4A 2GTZA 4LSTL 1HILB 1QRNE 2DTSA 3WUZA 5KTEH 5DD1L 4KK5D 1I1YA 3PHQB 4HFUL 2ERJC 2F68X 3FB7A 3GRWH 4YXLL 3WN5A 2J57G 5JW4N 3MRRA 3D8MA 2KBGA 2NMSA 1IT9H 2MCPH 3NT0A 1PY0A 4A6YL 4IOSD 4F7MA 2O6PA 4KY1L 4WW1A 1EAPB 3MYZA 1NLBL 5EUOA 5EZJB 5HE3B 4HD5A 4NDMB 3CVCA 1T5WA 1GAFL 4NXKA 4HAGA 3A6CH 5DVKA 3BO8A 3I6KA 5AAWC 4I5BB 5TDNA 4D3CL 4ERSL 2UVEA 3JZ7A 4NGHH 5AVUB 1VJSA 2PXYD 2Q20A 5GZND 1E4JA 3KRWB 3LD8B 3MU3A 5L9DL 4FZEH 3EGDB 1C08A 4KZEH 1OGPA 1U8JB 1SBSH 4PJAA 3CUPA 3FU3A 3VWKA 2QSTA 2HJKB 2B1AH 4QQEA 1TO5A 2J43A 4FYTA 4UBDC 4X8JA 5FYJE 4CVXB 1QPPA 5E6RB 3DWTA 5AOLA 3T6XA 1HSBA 5IEHA 2ARJB 2DDQL 4XT1C 1PF3A 4Z18A 1RU9H 3LQAL 4PJEF 4DNWA 5HTSA 3GREA 1G6RB 5IJ8E 1TZHA 1LE9A 5E99L 1CDYA 1FGNL 1C5CL 2YD9A 4XCCL 1KEMH 1QI5A 5TH2B 1K8KC 1G9HA 2GW5A 4YFDB 5BO1H 5I30H 4QHKJ 3UDWC 1OKEA 4I48B 3EYSL 4GP8B 3BWUF 4LDLB 4XXDB 1KTBA 2VN7A 3OF7A 5DUPL 5DMKA 1AY1H 3FQYA 4YSSA 1T7WA 1H6FA 3WEXB 4N2LA 3VXMA 4I4WA 5CILL 4L3FA 4ZNEA 1M53A 1T66D 4Q9RH 2HG5A 3BKMH 3PWPB 3V4UL 4QGYA 3VVWA 2AJZA 1JYXA 3FSAA 1NAML 5ABZA 4ALAH 1PQZA 4NUMA 2DAVA 3TESA 4ORZC 2KDYA 2DLIA 4WGKA 5GS0H 2ZD0A 5D7SL 2FX8L 2X6MA 4FEIA 5LLIC 5AZ2L 1BJ1J 2NZ9C 3C8HA 3KCPB 2GK2A 2P28B 3VDAA 1TJMA 3NSFA 8FABB 1KBPA 2R2CA 3KCIA 5IKCA 1HYSD 4FYQA 4HGWB 4JFPB 3F5WA 2DF3A 4FFZL 4Z95L 1O7DC 2DD8H 4A2GA 5D7HA 3FFCD 3G6JA 1RZ7L 4RIRA 3AVEA 4NZRH 1S3KH 5K1CC 3KL5A 1LO3H 4OLYL 5DJAA 4AXWA 4JX0A 1MCOH 1MWAH 4FNLH 4EI0A 5H2BB 5AD0B 4YSUA 4N1CA 3IJHA 4ZJ9A 3CZFB 3DTXB 3LPGA 2W95A 2XTJC 1VENA 4PRHB 1PBYA 3I9GL 5GIRB 4E9XA 1Y1UA 3VB8A 1UGKA 3SPJA 2EDYA 3IJYB 2HFFA 1BP3B 3VXUA 1C5BL 3BWAA 3WEOA 2DYRB 3OZ9L 2NY4C 4ABUA 1CICC 4I9WE 3PGDB 1WIOA 2O4EA 3S8FB 4NT6A 3MN8A 1PAZA 3BQUD 4FFYL 4XNYL 2BHZA 2FYVA 3UROR 3EXLA 1WS8A 1UWXH 4YL9A 5F0PB 3V0IA 4BWWA 4OF7A 2F9BT 5DRNA 5KVGE 5IW3A 4KOBA 3L4CA 3E6HB 1B9ZA 2YSSA 2WXRA 3FONA 6TAAA 3FCUA 4O2CB 5F7MC 1FPTL 1OAQL 4PR5A 4NFCA 2BM3A 2AJUL 1JNHA 1CUOA 2AK4E 5A6LA 4CADA 3P9WB 5KSAC 5TF2A 2ZYIA 3P40A 5AYQA 1ZK5A 1A65A 4MA7L 2ENYA 1XCXA 1YYCA 1GL4B 1A3RH 4XC3H 2GHWB 3LB6C 3KR3H 2P5EA 3D18B 2CO3A 1IC4L 1KBVA 4FULA 1RUPL 2HN7B 3WIAA 5IM7B 1E8NA 1SEBA 1DVTA 2FQEA 4KI5F 1MG2A 3N0PB 4N8CH 3FO2A 3TU6A 2D2OA 3QJUB 4RA0C 3WNLA 1F5WA 5MHSD 1UWXK 2F0CA 3NZ8B 3EYQC 2X42A 4GXUM 1U92B 4K23L 1F3JA 2KLRA 1MCWM 4NKOA 3ZOAA 2VE6A 2H47C 3OKDA 2VL5B 2WOYA 1F6FB 4YAQA 4OZIF 1RIUL 3NIFE 1BJ1H 5KSBF 2CM6A 5ENWA 4WWKC 3II3A 2C1OA 1Q1JL 4GBXD 2R1WB 4WSKA 3TO4B 1ML0A 2WQVA 2V17L 3T0EB 1HHHB 2FATL 2ZKWA 1Y6NR 2I07A 4Z7NA 2JXMA 1UA3A 1INEH 1DVQA 5D2LF 1ZS8B 4ZW8A 4QHMA 3TPUB 1JTPA 2DL2A 5I1KH 4TL4A 2Y7MA 5B1AB 3QDAA 4PW3A 3D07A 2PETA 1A7NH 3KLAB 4PJFF 1JPTH 1GYAA 2H0EA 5JYLA 1T7YA 1OWRM 3H7BA 1BPOA 1FYTB 1KB9J 3WFCL 1V7MH 3HNTL 2XN2A 1JZ3A 2OMZB 4C4KT 1UT2A 4Z7VA 1M05B 4WI3A 3EBIA 3LIUA 4NBZB 3VQ1C 1MPAL 2F8IA 4W9DC 5FLVA 1NDMA 5AVYB 3NP4A 4E41A 3MJ9H 1SXSA 1KB5B 3CN0A 3Q0HA 2R23A 3QQ4A 4H4NA 3P4MA 2K45A 2AGJL 3RWDA 4X6CB 1JYVA 5AL8A 2VQ1A 4XMPL 3VO0A 5KAQG 3RY6A 1S2EA 1N3NB 3EHBD 3DX0A 4ZX3A 2DM3A 3MLYH 2WHVA 1KWGA 4ZFZB 1JN6B 1SY6A 4JY4B 2NY2B 5E5RB 5F3HA 5B1BB 4JFHE 1BJ8A 5F3FA 4Y19D 3A47A 3FTGB 3J2PA 3MRLB 3QUZA 1OARH 3RNQA 3B9KC 3U82B 3SJVB 3C99A 4ZUWB 3GZKA 4JPIA 4RFNC 5F72S 3T0VA 1I7ZA 3VE0B 4OZ4A 4NPYA 4PLJD 5C2UB 5JTWA 1YYLL 3MC0A 3IGFA 4N0YL 1OP5H 4NQCA 4RFOL 1KXTB 3HC0B 4RQQA 2O6CA 3IS0X 4L4VE 32C2B 4AGPA 1CTOA 3S35L 2R39A 2GJ6D 2VR9A 4JPWL 5E8OA 3DX1A 1PPIA 2W38A 1JVOA 2WXMA 2EIDA 1OCRB 4MMZC 4K71B 1J48A 3HB3B 3AGVA 3VFWB 5C6TH 3T0BA 2V2WA 1G1CA 3NJVA 4OJFH 3O4HA 4KJWC 3T6QC 4OIFA 1OW0A 1PG7L 2J3SA 5E2JA 3OGOE 2VO5A 5I0WA 4QPEA 3MJ9A 4HJSA 2XLLA 2KYIA 4OGQC 3FU7B 5SV4A 5C86A 2K1MA 1AR2A 1LMKA 4FL4C 1JVLA 3ETTA 2BSSA 2WCPA 2WINA 1CFSB 5T5FH 3DARA 4P9HC 2ATPB 3NH7H 4N90E 4P23C 4CL7A 5EALA 3BD3A 5J1SC 2Y9RT 3HZMA 3KG5A 2B39A 3ILDA 2PW2B 5IJ7E 1F00I 4NKMB 4KRLB 4WO4A 1M9WA 4P2RD 1DN2A 4KROC 4OSUH 4ZO7A 4PJCB 1CU4H 4C56D 4HHGA 4JN2B 1QKZH 1E9QA 3WFZA 1I85A 3QEQE 1MEXH 2UWEA 2Y3NA 1PYWB 2ICWI 4X4MA 5F7EL 3UABA 4NHCL 2I0TA 2G9HA 2AQTA 4I0PB 4X61B 3B56A 3EZJB 5T3XE 2Q3ZA 4DTGH 5HBBA 2IWKA 2G3MA 3I75A 2ZCKH 2PYFA 2N1KA 2FCBA 1ZTXL 1YNTA 2E74C 2FT6A 2Y24A 4TUJB 3S5YA 4WHTB 4MJID 2H41A 4UAHA 3MBED 4L3AA 2YXWA 2C26A 1XGPB 3O4LD 2ZXDA 3JVFC 2CM5A 1G1OA 4WY7L 1B3IA 4Y2DC 3L95A 1AYRA 4TLKA 5CJQH 2B5IB 5C0RH 3VFTA 5SWZE 2A77L 2VDMA 5LNEA 1WFJA 4QTHA 4ZW6A 2AXHA 1HTYA 1ZHBA 1ZT4A 5C6PB 4IDJH 1U8IA 4I9WD 1QWNA 3VRIA 1IKFL 4MMXA 3D50A 5E8EB 1TTAA 1MXGA 4EDXB 4EN3A 3NQIA 4X4YA 5GS1A 2YARA 3HG1E 3VM7A 2Z2OA 2OYMA 5HHQA 2X6UA 3AUVA 1TKWB 1A8JH 2X2UA 3SE9L 4L3EE 1VPOL 1KPUB 4PGJA 4K73A 3SE6A 4XNXH 5IUSA 4MX7B 4EVNA 2IOIA 2UYLB 4X98B 3IF1A 2C9RA 3L3HA 1XD0A 3QO0B 3CLEL 4WHYH 3O2VH 4Z7UE 2WD0A 1IAIM 3HE6A 3KPSA 2XQYG 4YHZL 3EGSB 1JPEA 5I1LA 3NGBB 1K4CB 4KGJA 3ZWLB 5IQLA 3C5ZA 1T04B 2NNXA 2V9TA 1ITCA 4Z7QF 1S7TA 4P46D 2QPUA 3ZKND 2EYTB 4ZXBC 3WSQL 2BK8A 2F8VA 3LZQA 1PX4A 5AYTA 5PCYA 5GZOC 1U58A 3HR6A 3TBYB 1A4KB 5FO8A 2W9DH 2VDPH 3P9LA 1UD6A 2VO8A 4PRPB 5J8OA 4KRNA 1MLCB 4BZYA 1CDGA 1NM4A 3C6LA 3KLSA 3MRKB 4M6AA 3HE7B 5G4NA 4PTTA 1JPGA 1IGML 1TDQA 4WV1B 5AVQB 3WLBA 4D0DA 5TE4L 2BWIA 1KGUA 4AT6B 4OGAC 3B7YA 2Y5EA 4NYLA 1MVYA 4OH2A 4R0LB 3HUJE 1NBVL 4WW2C 1PKQB 2DTMH 2YEZB 3QIBC 2D3VA 5FECB 4D94A 4G8EA 1A9EB 3ESMA 5FKAB 1HHIA 1FL5A 4XI5D 3AY2A 3D0AA 3JWNE 3KJ6L 3F3HA 4PRAA 2BC4B 4OT1H 2F74A 4YIQB 4KZDH 2HTKD 3G08B 3B5TA 4G8IA 4YZFE 4PJIE 3K4AA 4ZOYA 1R3IL 3BKCL 4EI6A 5A2IH 4XVTH 4WUKH 2FBOJ 2HT3C 2VRKA 3V0GA 3FAXA 4YHIA 1T1YB 3NA9L 1QPXA 3GMNA 4OIIL 5B3NA 3TT1L 5HDBA 3MLXH 4EAEA 3V5HA 2DLTA 4J12A 4LKXA 1I4FA 1JHLH 2XL2A 4PV8A 2E6JA 3N04A 4JJ5B 1I3RB 3ECBB 1QPKA 2AJVL 4I18B 3ZX1A 4D6VA 3RNKB 4X60B 2OL3H 2F08A 1GZQA 4L9LB 2HRPH 1BQRA 1C7TA 5C3TA 4EIZC 5LVEA 3VH8G 2IQ9L 4J3OG 1OSZB 1EDHA 1ZT7B 5DJDB 1JGEA 1YR2A 3SHFA 2RIKA 3ATEA 4POZC 1IC5L 3CFCH 2Q8BL 3O6FA 3VD5A 4MXQC 1CS6A 4LLDB 1RZFL 3BAJA 4Q2ZA 3LS4L 3RX9A 4LU5L 2A83B 3AABA 5EMJB 1DQKA 1BOGB 1I1AB 1L0XA 1Q0YL 2IAMC 3BMWA 4NO2A 3V6OA 3JVGC 4K9JA 5BQ7A 1JAEA 4B3EA 5E5LA 3BFWA 1DBBH 4DVBB 2VQUA 2OK4A 1FQ9C 4WJG3 4XRCB 4UV4L 4M7ZB 1WITA 2A9DA 4Z6AT 3V8OA 1H9DA 2P49B 1HHKB 4ZOEA 4JY6B 4F2MA 3RFZC 2LW3A 3ZGHA 3JWDH 5KJRH 4HALA 4U2YA 2FX7H 3WMSA 5IROC 1HDMB 3G5XA 3P0YL 2WQ8A 1SHMA 4YHKH 4V1DE 1W0WB 1PSKL 3ZDXE 1JFQL 1UJTA 4NUJB 4XMLH 1CGVA 4GKNA 1A6TB 4HX1B 4JKWA 3GMPA 4PWKA 4X6BA 3GLEA 1IAOA 2NY6B 1WDAA 1HILA 3JWOL 3MLWL 3ZO0A 2HJBA 2OIZA 5C0BA 1QA9B 4YHLL 3RGHA 2Q2EB 5HXMA 3FT4A 3ATBA 1I7TA 4BZ1L 2APXA 5CJXA 1ZS2A 1CFNB 4MXWH 3ARGC 3ZDWA 5HYSG 1RI8A 1LILA 5IGXL 2GNQA 2ZXQA 3U1SL 4NDMA 4IKNA 1MKFA 1YEIH 2XXCB 3DHUA 3V55A 3V6FA 4KO7A 5EF2A 1U4CA 5EAPA 4MVBC 5LBGA 1CGWA 3HAEG 1CFVH 1XIWB 5LBVA 3EGDA 3EUUA 4S1DC 4PJXB 3KWWA 1U8JA 1MIEH 1OY3B 4KX8A 1XR9A 4H7VA 4AL8C 4AQ1B 4RZCB 3Q2WA 3NJJA 3RX7A 2ZZUT 5DWPA 5E6RA 2IFFL 4F93B 2Z64C 1HS6A 43CAB 5FB8A 2C1PA 2BNUA 3LEYH 1G6RA 1XEDA 3BPCB 4GOSA 1NKRA 2ESVD 3SJLD 4L4TE 5A2KH 3U0PB 5IG7B 5IJCC 5TH2A 1R75A 4ABWA 4O4YH 3RN0D 2Q9OA 4LVOC 4UT9H 5E8NA 3AZUA 5F7BA 4I48A 4UTAA 4KUCD 3MXXA 1BQHA 4LVNC 4WUUD 4XXDA 5DGRA 4LGSB 1MNUL 5FYLL 4PGZA 4AVHA 4CBPA 2ICEB 1R34A 1RV6X 4DO5A 3MV7E 5FYJH 1AH1A 3RDTB 1UXWA 4J4PC 3VWJB 2WUCL 3T65B 4PWGA 1KBGL 4HS6B 3CPLB 1EHXA 4OCXH 3KPTA 1G5GA 2P24B 4IU3B 4UOZA 2NY5H 3CXHJ 4GKSA 2V6HA 3TGXA 3VFGH 3ZMRA 5KBKA 4Q9CA 4Y1AA 5AAPA 4RMVA 3ZRFC 1ZWIA 1GYUA 3MUZ1 3FO0L 2E6PA 2WKLA 1Q72H 2OZ4H 5B4MD 2FHCA 1Z6JT 5IVNA 2CU9A 1PX8A 3QUMB 4F8NA 2ZP0T 1IJ9A 1XGTB 1BIIA 4JFPA 2WANA 2QQNH 3Q43A 4NN7B 4HAKA 2HKAA 4JM2F 5CZKA 4K3GA 3M86A 5IOPA 3SN6B 2ZQKA 5C9ZB 2FBJH 5AVXB 3BDXA 3U4YA 3J07A 2NY1B 4JQIA 5DZ9A 3GJFH 4MHHI 3BZFB 4UT9A 2FH6A 4NC0B 2P46B 4XVUC 1NDGB 5AD0A 2J8HA 3QORB 5KBLA 3DTXA 4KX9A 3IIYA 4QRSB 4QXUL 2AFNA 2WBKA 5IW6B 3IJYA 5IJVB 1R5WB 5FLXg 4HF5L 4LVHB 3V0WH 4K8RC 1ZV2A 2D03L 1EO8L 2FWOB 3EYUL 1PJWA 4NOFA 4ZMPA 4FF9A 2ZSVA 2X4TB 1E4WH 6PAZA 5LCVH 1XH1A 2A6DB 2FL5B 4N0UE 3VGZA 3IGAA 4L1BA 2IOOA 3BW9A 1M1XA 2CZNA 3GJFK 4NZTL 4BCYA 3E6HA 3GSXA 4Q52A 5E23A 1YN6A 5DHVH 1VE6A 4PJ9B 4U1NB 4QTIL 2FR4A 1HZKA 3BUTA 2FGWH 4CDHA 4QEGA 2QVTA 5B3JF 3BAEH 3CFBA 4WI9A 3PFQA 3WLWC 1MCFA 1YEJH 3OLDA 2IPUK 3GMOA 3JBG7 2HN7A 1O9ZA 3FUFA 3PL6A 2AGLA 4RDBA 4Y4HD 2BY0A 3ARBC 4O9HH 2LHAA 5KVGH 4BL0A 1TYQC 3LNGA 3V95A 3DC0A 5ITFB 4NBYB 4JO3L 5GGTL 1U92A 3IK2A 1F13A 2CRYA 2VL5A 5FLUA 1IL1B 4PRNA 3FQXB 1MREH 4LHUD 1T80A 5DYOB 5ICYB 4CRPA 4QHNB 4NQVA 3O2WL 1SFDA 2DIEA 3R4RA 4AJVA 3TO4A 4E36A 5H1MA 3DK2A 3GRWL 3W9EA 4F5CA 1HHHA 4AQAB 4FYRA 4ZS7L 3WNJA 2F19H 1MCDA 1DZ0A 3I50H 3U0TA 1SJHB 5HJBA 3VYOA 4TS6A 1PU0A 2V5MA 3BP6A 4ZOCA 4V1DD 2FNWA 1YMME 1FIEA 4XC1L 3FN0L 3NCFB 4L48A 5B39B 5DT1L 5GGSY 1JNNH 1F6LL 4XHJD 3G6JE 2AAAA 3LPOA 4NJAL 1LDPL 2OMZA 1MDAA 3IDMB 3O0LA 4HJJH 4XO3A 1BJMA 1M05A 4YHML 2GIMA 1HZHL 3FF7A 1NSNH 5KYNA 4ZO6A 1W91A 3UAJD 5KWYC 2WC7A 3LH2H 3CN2A 4QOKB 1NC2B 3DXAB 4GG6B 1KB5A 2W65B 4AYGA 2OJZH 4OB5H 4RX4D 4LZKA 1DANT 4AI7A 1T03L 4X6CA 2FSDA 4HISA 3ARUA 2CNZA 3TS8A 3QJSB 4X9BA 1JN6A 4ZFZA 1VLXA 2CR6A 5E6SB 3TCTA 3WGUB 2RJMA 3AU0A 1AC6A 4HWNA 3FTGA 4D0BB 1IAKA 3SZKC 1J9CT 3MRLA 4AJWA 1B9XA 1QSED 3EBGA 1QLEL 3SJVA 3HLAB 5B39G 1MJUH 4ZUWA 2PTTB 3RJOA 5I30L 3B2DC 4KRPC 1SMDA 4GY4A 3VE0A 2ZF8A 4MNHB 3B37A 2KZ1B 4B7LA 2UY7B 4P5TC 3SDDB 4XPHH 2KMWA 1KXTA 3HC0A 4L0PB 4ZAKD 3ZDZF 5EEUA 4FMFA 32C2A 3EF4A 2A73A 5K1VA 4FI7A 4NB7A 1BQLH 5F2FA 5GS3A 3FQNB 1RUQH 1KGIA 3C60D 3IWUA 4N2OA 5ICUA 1TQCC 1J8HE 2W80C 5L2KB 3HVDA 5CUSL 4NWUL 5D4QA 3PRZA 5SXMA 3VFWA 3DX2A 3CIAA 3EGXB 3GSWA 4X80L 4LCWA 3FN3A 5FUCC 3UAFA 3RFHA 4UDTB 1GMEA 3ZKXC 1G7QA 3D05A 2BRRL 2Q7QA 3MZLA 1QFWH 4ZUSA 1E2WA 2QQLH 3PWNA 4JZOB 3AREB 4DW2L 3FU7A 4J3OC 3UTSD 3DVGB 3U0WH 5I1IH 4DNUA 2IDUA 2VXQH 4JQVC 3EI4A 1UTDA 1CFSA 1ZLWH 4AGLA 1LO2H 2ATPA 3D39B 4OUUB 2ZUUA 4TSBL 4XWGL 4M8RA 3V4VL 3PWJB 5GRYA 4Z7NE 1FZKB 4ZS6D 1BVKA 3NIGE 2TRCB 2XU9A 3QWOB 4IRJC 1ZVSA 2B0SL 2NTFB 5EU6E 2VQ4A 3SO5A 4D8PB 3HS8A 3UVMA 1RJYA 4OR1A 1LO3L 2YLHA 4ZNCD 1KWKA 1GVIA 4FNLL 5B1CA 3IIWA 3L4XA 4PJCA 4FA5D 5I8CB 3QEUB 2EEFA 3DMMC 3HEIB 3FQWA 4JANB 3TT3L 5GPRA 1JGVH 3SDAA 1R46A 1TXKA 4I0PA 3GTTA 1J0JA 3VXOB 1ZLWK 3JV6B 1ZEAH 4LPWA 3S2AA 3HG5A 3JZNA 5I1EL 4EZMA 1IV8A 4D0KA 3FM0A 3PGCB 1U8LB 3KYNB 5EN2B 3NRQA 2ZWNA 4WHTA 2X1OA 1A7QL 1Z32X 4FABL 2D7TH 3VGHA 3RUGA 1HYRC 1XGPA 3AH8B 1OD7A 2XWCA 3UR4A 3RB7A 3RE0A 4KMLB 1E6JL 5D7LB 2HX8A 3QUXC 3RIFK 1KLGB 2PO6C 4LVEA 3OPUA 3ZRSA 5E0FA 3K8MA 4M7JH 1ZHKB 5T3XH 5AL0A 1YC8A 3QQDB 3VG0H 1TU2B 3V7DB 2HPTA 1GYCA 4MXVE 3VWKD 2I7OA 5SX4I 3LVTA 4EDXA 2W94A 4NQCE 5F3BB 2WMPA 3ZN6A 3BI9X 5TEEA 4JO4L 3ODTA 3Q1EA 1TKWA 1KBWA 4H26A 3MV8B 1KPUA 4HLZG 4Y8AA 5C09A 4QUOA 1KYUA 3LQAC 1KELL 2DKSA 3X3FL 2CBMA 2QADB 3U6XS 3CVHH 1A7PL 2ADGB 1B0IA 4X4KA 5I73C 3QUYB 2BHFA 4HDIA 3NIFF 3AC0A 3I9PA 3HPJB 1G6VK 4A1RA 3FYEB 3DOHA 3CH1B 1UADC 5BPPA 4KUZH 5CR8A 1MHPH 3AY4C 4ERQA 2PR9A 3VXMD 3EGSA 4UQ3A 3UGEA 3VG9B 4XCFH 3F7LA 2C9SA 1OSYA 3TYGL 1JMZB 3QHZH 3U30B 2EYTA 4FTVB 1SYSA 3K0YA 3E0CA 3CFUA 4APXB 3LRSB 4DOHB 2GUOB 1A4KA 1R3HA 2AEQH 5T1LB 1WO2A 4IRSB 1S5IH 3RI5F 1OM3H 1CXIA 2WGNB 1CD1B 4KTDH 5E4IA 3A5VA 2VMFA 3REWA 1MLCA 3SDXB 4NO0A 1SHYB 3MRKA 3U7AA 1N0LA 5BCAA 4G6FD 2LTQC 2DI7A 3H54A 4WV1A 2UWEE 4TPRL 2VZTA 2YD2A 4X4ME 3W2DH 4AT6A 1A6VH 1F4XL 3QUGA 1JXFA 1P4IH 2CK0L 3MLYL 5J5EA 5C3IA 1MJ7H 1BAFL 2EH7H 4PRBA 1I7RB 4HKZA 1PKQA 2BIHA 2H26B 3H85A 2YEZA 5D1ZB 1FNEB 2YA2A 4F8LA 5FECA 1CXFA 1T1WB 3Q2VA 4R5XA 4H0LC 5FKAA 5FDWA 4G55A 1QEWB 2VGLM 4KZCA 1ETA1 5JPMA 5DTFA 4OD2B 2BC4A 2W91A 3CHPA 4JHNA 5GQBA 1SZNA 3LZNA 2FRGP 4JB9L 4YIQA 3STBA 4PJ8C 2ZWSA 3G08A 1OTUC 1GSKA 5JNYB 2GC4C 2F5BH 4RMRA 3ZW3A 3ECVA 1HJBC 3VXUD 4FQIH 1CK0L 1LE5B 4TNFA 1N5YH 1J18A 4LCCB 2GT9B 4FA7B 4FQXB 2JJSA 1MW2A 4OBSA 4LRNL 5E70A 2IG2L 2BMKB 4JJ5A 4ORGB 1I3RA 3T8MA 3ECBA 5GS0D 1KIRB 2X1WL 4I18A 5B8CB 3HKZA 3L3DA 3H2QA 4L9LA 4KKAC 4HS8H 1BYNA 2NY0B 4JL2A 1OSZA 2KT6A 3DIDA 4KKBC 4UQ9A 4XNUL 2BSDA 2R51A 4ZUUB 1ZT7A 5DJDA 2MCG1 1I7UB 3KLQA 4FQQB 4MQSB 5TDHB 4I2XB 4D9QE 2ADJB 3ZYIA 3DUUB 2P5ED 2YOAA 1HNGA 3QR0A 4FZ8H 3KPSE 4ZMVA 2LOEA 3GSUB 1IKNA 1KGCD 2N0KA 1QEXA 1JZ7A 4QKXB 3BGMA 1BOGA 1I1AA 5DMJB 4BFIB 3H3BC 1U30A 3WV0A 1NCIA 4OZFG 4DVBA 1EAQA 4XRCA 2LLGA 5BVPL 4OCWL 3J7HA 3R19A 1E42A 2YR3A 3G5WA 5HHME 2CUIA 4N6QA 2XWXA 1HHKA 4TVUA 2X88A 4UT7L 4JY6A 2J88H 1UD2A 5ID1A 3SBWA 1W2KT 3IB4A 2W0KA 4LEBA 1R5MA 5TQ2H 4CMMB 3AG1B 2BCMA 4POYA 4YDKH 3RLMD 4KMTH 2AQSA 4YSPA 4OZGE 1W0WA 2HXAA 2ITFA 1KFAL 5D9SA 4HCFA 1AMYA 5FHBH 5J3HC 4XPFH 1A6TA 5SX5H