3V4PA

Crystal structure of a4b7 headpiece complexed with fab act-1
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
587
structure length
582
Chain Sequence
b'YNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLVGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHSTEEFPPLQPILQQKKEKDIMKKTINFAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-4
molecule tags Cell adhesion
source organism Homo sapiens
publication title Structural specializations of a4b7, an Integrin that Mediates Rolling Adhesion
pubmed doi rcsb
total genus 131
structure length 582
sequence length 587
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3v4pA02
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3v4pA01
4Z7OA 1JV2A 4UM9A 2VDRA 4Z7NA 3K6SA 3V4VA 5E6SA 3ZDXA 4G1MA 4Z7QA 4G1EA 1U8CA 3ZE2A 3ZDZA 2VDOA 3IJEA 2VDKA 3VI4A 3NIDA 2VC2A 4WJKA 3K71A 1L5GA 2VDMA 5E6UA 5FFOA 3T3MA 4WK2A 2VDQA 3NIFA 3ZDYA 4WK0A 1TYEA 3K72A 4WK4A 4MMXA 3ZE1A 2VDNA 3VI3A 3T3PA 2VDPA 5E6RA 4MMZA 4O02A 4UM8A 1M1XA 5HDBA 3FCUA 3NIGA 5FFGA 3FCSA 4IRZA 2VDLA 4MMYA 4NENA 3V4PA 3ZE0A
chains in the Genus database with same CATH superfamily
5CF3A 3MCYA 3RVWC 4PRIB 5J9PB 3LKSB 4HC1A 4BH6A 4C56E 4FGMA 4PWKA 1GMEA 5IFHH 1QKZH 3VFPB 2YXWA 5KYYB 2XT1B 4OBRA 1EFXA 3DVIA 5JIQA 4GGDA 5J12B 5LGJA 2OP4L 2VDMH 3GMLB 4JX0A 3GF8A 1R9FA 1BBDL 1K4CA 2VLME 3FW6A 3EGSB 3MOQA 2FVNA 1QSFB 2EDWA 1OAXL 3ZY7A 3GSQA 1JAEA 1NGWB 4D9SA 3HZVA 1RLWA 4FAVD 4WF7A 5AL0A 5FK9B 4YNYB 4ZFQA 3ZE1E 3F7VA 3X17A 1B2WH 1ZKAA 3CZKA 4NN5B 2CMRH 3VWKC 4AEIH 3CH1B 3FCSB 1QLEB 4JPIA 2OZ4H 2CRZA 1KTJA 2XTSA 3K6DA 4ZUWA 4WZ9A 1EUUA 2LAAA 3V9EA 4JM4L 1E2VA 3TONA 4GS7C 1WS8A 4YS4A 2W65A 4E41B 4QJ5B 1X7QA 1KJMB 4ZUUA 4DEUA 3QFJE 3OKOB 4W9LC 1FL5A 5E0FA 3SHFA 1QBMH 2IDTA 3VQLA 2WYIA 3QUZB 1DJSA 3K0WA 4Y1AA 4ESGA 4GAGL 2XWBA 4E54B 4TUJA 4YIQB 2BRRH 4C59B 1AIFB 4QCIA 1W80A 2X9XA 3UZEC 3TCLA 3L3OA 2VKXA 2QELA 4PJ8B 2VCOA 4NZ8A 3SDXF 1AOZA 1ZA3B 3HG1D 1S6NA 1KYOK 5A2FA 1MHPL 4OZIB 3G5VB 1UHVA 2X89A 3H8NA 2XQ0A 1WA0X 2XQBL 1FZKA 2EXSA 4P5TD 4UQEA 4N22A 2XG5B 1M7IA 4AJWA 4D9LL 5DJCA 1V7ML 1CBVH 3GMQA 1JVLA 1NUDA 1DQQA 4RRPG 5M7QA 3G6DL 2PWEA 4PY7B 1O7VA 5FA5B 3H0TB 2FIKA 2K4AA 3C5ZA 1LK3L 3B2VH 3N0DA 3FFDB 3BH9B 3QXTA 3PHQB 4AUYA 3LZRA 2ZF8A 2H32A 1KCLA 1SXCA 1AP2B 4YGVA 3X2QB 2K4WA 5AYTA 2PPAA 1ZE3C 4G7VH 2AERT 5HJ3A 3PVWB 1HQRB 4JFSA 2QPSA 3RY5A 1QSVA 1XMEB 3SN6N 3RVXD 4A11B 2NY4D 5J4MA 4GAJL 4H1LB 4TLKA 4JM2A 5E51A 3WFEL 3VWJA 2ALWA 1MCLA 4BUQA 3MJ9A 3IGFA 4LE8A 1AO7D 3QZBA 1SBSL 1HSBA 3WSQL 1PZSA 2OR9L 3RGVC 2AEQL 2OK0L 3TBSB 4QWWC 2WWNA 1E5ZA 1E65A 3VAEA 2ZKYA 5F1NB 4AJ0A 4I85A 1VE6A 3T65B 3P4FA 4MZRA 4U1SA 2EDHA 3MZTA 3LXUX 2PCYA 4L1HA 1XCQB 4D9QD 3G5YB 1MWAA 2VN5A 5KW9L 5LB1A 4FLOA 5AWNL 4AV0A 1IKNC 1XB6A 3ARFA 3T3PE 5EU6B 2JWYA 2GTZB 3AM8C 5T3XD 2J8UE 2JH2A 2R29L 5GS2H 3SKJH 2XZZA 2VXTH 4LSRL 3VXNB 1VGEH 2XN0A 5BOJA 3IDXL 3LS5L 1ZLSL 2VDMB 2F8IA 3HUJB 3U1PA 3CC1A 4XO3A 4QTHA 5TE4L 1KV7A 3VG0H 1T3FA 2FNBA 1MIEL 3GQFA 3BX7C 1BF2A 1F3RB 3FO1A 4J2QA 2P7TA 4I9XA 4JDZA 5AW7B 5I23A 2WQUA 5A2LH 5HHPB 1XBDA 5JA8B 1UATA 2OAAA 4OW6A 3P9LB 5IGOA 1CXLA 3FUJA 3CDGB 2ZCLL 3IDNB 1FFPB 1DVFA 5D1XD 3X13A 1XL6A 2EILB 4JN2B 4JR9L 5HY9A 5C0BE 1OAKL 1NWOA 4AQAA 2H9LA 2NY2B 3I6SA 5D5ME 3H2PA 3Q5OA 2KBGA 3C87A 3FQNB 4LKXA 1BMGA 1S7WB 4AIZB 4E5XA 2NTFA 4NUJA 2AANA 1JYVA 3VD1A 1F4YL 3SOTA 1FIGL 1BD2B 4EI6B 1AHMA 1OCWH 2CGRH 2EE6A 4F2MB 5EZPA 5KYXB 1OY3B 4K7PH 5FO8A 1CWVA 5EMMB 2FECL 2PYEB 1OP5K 2CBQA 4TQHA 2V5SA 3TBTA 1KCVH 1QG3A 4UQ3A 1EEQA 5MEQA 3MXVH 4M61B 5JLZB 4N90E 3OXRA 3PXSD 1AS8A 4F8QA 2E9WA 2NNAA 4BE6A 2VN4A 3OLGA 3ZHKA 4QNPE 3VFUA 1J9SA 2H5UA 4EXPX 5CU9A 1JHTB 4N0YH 2FAUA 2RCSH 1KXTB 4PJGF 3TA3C 3ZJAA 1ACZA 2FH6A 3QUXA 2QQQA 5DD5L 4WWKA 2XACC 5CCGE 1CFQA 2YD4A 3O11A 4QRSA 3HBGA 3EYUH 3MMEA 3EYQD 4PB0L 1CF8H 3SDCA 3IAGC 1DANT 4NQDD 5KVDH 2X3AA 1VA9A 3P4OA 4CADA 1BFVL 4FULA 2DQFA 4IJ3C 1EPFA 4LIQH 3I75B 1NAKL 1MFCH 3EYVB 3GXUB 4C8XA 1AJ7L 3JTBA 4XOCA 4H8VA 1A66A 4OZ4B 1JPFA 1O7DC 1C5DA 3O41A 2V9RA 3OPZH 3DROB 1N5AB 3EDFA 1JF1B 1CPUA 3SGDH 3MLSL 1TJHH 4RFEB 4MHHI 4PTUB 1SYSB 4Y4FB 3VFTA 4ES0A 2UWEA 5AZUA 4XX1E 3IUMA 2AQ3A 2I60L 4X80L 5B38A 3VSQA 2V8MA 5DJ2B 3PAZA 4LDLB 3NDYE 3V0WH 5SWQB 4XH2A 2VQUA 4XN8A 4MMXC 1M2VB 1FO0A 4KXDA 5I1EL 1WIOA 2RHEA 4FMVA 4PJ7E 5L88L 2IV8A 2TAAA 3LMJL 4HKZA 3VG9C 2W92A 3BWUC 3CE1A 4OFKA 4XXDA 3CFQA 1CMOA 5DR5H 2ZICA 1S5IH 3HNSL 2VDNL 5IIEB 2Z91A 4LLYA 2C4FU 1G43A 1H8OA 4GIPD 4YHIB 2WJ7A 3QQNA 1ROWA 1I85A 3HAEH 4D0CA 5CD5C 5EMKB 1I3GH 4IRSC 4KK9C 2K3HA 1A3ZA 1KACB 3QORB 3SBWC 1U4FA 4I13B 3FB6B 5C0ND 4HSQA 1W0YT 4YVUA 3ULUL 3E7JA 2LVEA 1AZZC 1IKFH 1A14L 4NN7B 1ZLUK 3O6ML 2WV3A 4LVHB 3HZYB 5DJXB 3RI5F 3WNMA 4KX9A 3U4YA 3OKKB 4RFOL 3VQ2C 4Z3JA 4QHUA 3VXPB 3HNVH 1CZ8H 2OJEB 3NYKA 2G2RA 1TETH 3JV0A 3VFSA 3SYQA 1JI2A 2RIKA 4R97B 2PR4L 1V7MH 4XMUA 5DS8A 5KSUA 4HW6A 3UBGA 4KU1A 1ZVHA 4HJTA 1NMAH 2VJ0A 3S35X 4R2GD 3W5NA 1Z2KA 2BP5M 3BKYH 3I6KB 1XFPA 4ZAKD 1OT2A 1G6RA 1EQWA 3GPSA 4GP8B 4KROB 4AX4A 1CL7H 1Q9KA 4XBMA 1T2QL 4UOJA 3GFCA 1AKJD 3DNKA 2XG4B 3QIWC 2L7EA 1LYQA 1MG3C 3WEMA 4O51B 1F86A 3N40F 3VX1A 2VH5H 3GNML 3MA7A 3EG6A 3ZDZA 2EDBA 2HT3D 3EUUA 1A7RH 5AVZB 3FT9A 3P2BA 3ABZA 1E9QB 1P2CA 3TZVD 3STLB 1BAFL 1ZWIA 2R2BB 5C09E 2OULB 3FUHA 4A38A 2PTTA 3GJFH 1MCNA 1G7LA 1WGVA 4Y9CA 3S5ZA 3SPVB 1EA9C 1U9KA 1N9PA 2ZX5A 3DBXB 5ECJE 2QQNL 1GCFA 4HWUA 3FTUA 5JW4R 4LPYA 4LP5A 2H41A 1U3NA 3ZIMA 4Q4IA 2CA4A 5D1QD 4OV5A 3MZKA 3RSEC 3WIHL 5AVYB 3QUYD 4ZSOE 3IDJA 3SDXE 3FTZA 1CXEA 4KKAC 2ZCHL 3JT0A 4MD0A 25C8H 4Y2DA 3I7OA 4GEJA 1N8ZB 3O0RH 4QAMA 2IPKA 1PF3A 1A64A 2NY3B 2ITCA 4JDEB 4LQFH 3SLED 2CO6B 5E9DD 1UGKA 3GI9L 1CD9B 1RZIA 2YOAA 3AG1B 4YHOL 2O5ZH 1BZ7A 5F3FA 1FVDA 2B1OA 4AYEC 1SXNA 3LPPA 1CN4A 2GK0A 1U8NA 3EFFA 1E7UA 1NFDA 2EE9A 1FLRL 3I3EA 4TNVK 1CD1B 3JV5A 1H3TA 5ENWA 1XIWA 3QULA 2SEBB 2AXWA 1KIPB 2EH8H 2G3ZA 3U30B 2W91A 2GITA 3B83A 4B3VA 2ODIA 5ABDE 1ZS8A 5DURD 4KWUA 5DD3L 4NJAL 2BSRB 2CBTA 2AABH 5IF0B 4RWHA 5DHDA 2VLJD 2JNZA 4QHKI 4BFGA 1WFIA 3PY9A 1WAAE 4YHLH 1R46A 1BXUA 3B9AA 2RFXA 4QRPB 2H9MA 3GLAA 2IBZX 3WD5H 4LDEB 3STLA 2B8OT 1ZV9A 2VDQB 4N8UA 1YEIL 2YBGA 3SGDI 4PG9B 5CS7A 3QO1B 3TEXA 4LHUG 4RBPH 2NY5C 4NQCB 5TE6L 2DTML 1RI8A 1EEYA 3D2TA 5KANG 3FT2B 4MWFB 2GC7C 4RGNE 5IG7B 5EBLA 5F0JB 2XFXB 4FABH 3EOTH 1KCVL 2EIJB 3GRWL 3RX8A 2AJXH 3SDXB 3NJGA 4BUHA 4FQCL 4Z8FL 3PL6D 1PLAA 2BNQB 2RACA 4BCXA 1PI6A 1G1CA 4UT9H 5LXGL 5D6DA 4AMKL 4WQOA 4X99B 1WZAA 2H8PA 4OCRH 4R90L 3APMA 3HI6L 5TF0A 1VFBB 1MCBA 4PBXA 5FO2A 4A7UA 2FHCA 1F00I 4P4KC 3EOYG 2KL6A 1NCAH 3ROOA 1SHYB 4QXGH 3LY6A 5AYUL 3GMRA 2P9NC 2GSMB 3UJIH 5E4EC 2P9RA 3M1CA 5IW1B 2AQRA 1HCZA 4QR7A 4JAMB 3GD1I 5JWZA 3CWGA 3DO7B 2Q8AH 3BVXA 1CU4H 4ZX6A 1F4XH 2JQZA 4BA0A 4MCZA 4MHHG 2XTJB 2FWOA 3H6JA 2F53B 4N0RA 5JR1L 5HI3C 4U1MB 5F7HA 4N20A 5GRUL 2VKWA 5A3ID 3OMAB 1P7QA 4WUUD 1GGUA 5T3ZE 3VD9A 2WWMC 1NGQH 2NSQA 3HKFA 4J3WA 1OTTC 4PRPB 4XN7A 4DW2H 3KPRA 3LZFL 1LE5B 3UYPB 2XQYK 4ELKB 4G1MA 5IHHA 4A2FA 4HS8H 4CSSA 1OAXH 3I74A 4GUQA 1HNYA 1V3KA 1G94A 3FT4B 3IM1A 1IGIH 1Q0XH 1QLFB 5JXEC 5IB5A 4F7TA 3DUSA 1CCZA 1JUFB 2AVGA 3DETD 3QAZB 5F7YC 2A2QT 5FO7B 4BFOA 1BFSA 4U4IA 3C6LD 1Z9MA 1F1AA 4O5LL 2V2XB 4Y5RD 3TBYA 3ZO0A 2VZTA 4IBWA 3K2KA 3FFDA 5GS1C 3C99A 1IU1A 3KWWB 5DHMC 4BEIA 3RRMC 5EF0A 3H0TA 3EGDB 4FA9D 1ZSDB 2WXPA 1IKNA 3ARFC 3ULVL 4C56D 4P23D 4I18C 1W6WA 4KX8A 1WCQA 3CVIL 1YPZB 4NERA 1RVFL 4QNPF 2VWEE 3B9KA 4ERZA 4TPRL 3HW7A 3UADA 4J6RL 3G5VA 2FE0A 2HLFD 4XPHL 1BM7A 5GRVL 3VU1A 4X98A 2HLAA 2AEWA 2WXLA 3ARBB 3U46B 3I7PA 1A6PA 1TYJA 1AC0A 4M4RB 5JHDD 1AMYA 2R2HA 2AAAA 5JW4Q 2XZCL 1AYRA 2ZSWA 4UF7C 2J73A 1JNLL 1OSYA 1RIVH 2BSBA 2D2CC 3QDMB 3RMZD 4W68A 4MMYA 3EYFB 2F53E 5E8DL 2RJMA 3ZE2B 4A0BA 1GA2A 5INCB 3C8KA 3MLWL 4XVUD 5EC2B 1WT5C 4UZUA 3LS4L 5LNDA 4EUPA 5HPOA 4PW4A 2ROYA 3BWAB 5D8JH 5TDHB 1DCEA 2VXUH 3TJEL 4BFIA 5I75B 1CIDA 2BOCA 4DZ8B 1V3LA 4GLRH 5C9JA 2G3MA 1OE3A 2GJRA 5FKAB 4J0XA 4NPKA 3C8DA 3P4MA 3W57A 3EF4A 3NIGA 4Q9QH 4K5LA 1DCLA 5ESVB 5DHYA 3W2DH 2QDWA 3LV3A 1KLFA 1OPGH 2F54A 2NNRA 2B5LA 1XSOA 1OF2B 4XMKH 3AWEA 1F0LA 2ZKMX 1JHLL 1TNMA 3MO1B 2H14A 5C8JB 4L4TB 4RZKA 3MACL 3N1QC 3I8CA 4X6DA 3MUY1 4XP1H 2APFA 1L5GA 4Y1TA 5AKTA 5GRYA 4Y7OC 3O8XC 4P46D 3NJKA 1HQ4B 3CSGA 5FKPB 3CLEL 1PG7X 1PD0A 4MA3B 3U4EB 1JL8A 1HL5A 5KOMC 3JYBA 4PRIA 4UDTB 5J9PA 5I5MA 3AS1A 4WUKH 3WE6A 4AYSA 4QGTA 4LAJH 1UJ3B 4GKZB 3OG6B 3X13B 1DFBH 4MD5B 2NY5H 5JHLL 3QIBC 2AK1H 5IG7A 2CKBH 3SDCC 1U30A 2R51A 2OVPB 4I3RL 1CLOH 4N6QA 1FA4A 1UH3A 4DP5X 2Y23A 3PGCA 2VDRA 3BUDA 3UTTD 4V1DD 4GP4B 5E8EB 3BLPX 1QBBA 3CN2A 3FONB 4NCC2 3UEQA 5B7FA 4ZT1A 4K71C 4P2QB 5LBGA 3K3QA 3F64A 2NLJA 4GRLC 5HY9B 2FK9A 4LQFL 5CEZL 3O4IA 2RFXB 4BUJC 3BKJH 1N12A 3IDNA 4BP8A 2A9BA 3BKCH 3BCDA 1HHIB 4NT6A 2W81C 2WSDA 4YE4H 5DD6A 1UUNA 4YSPA 2EABA 4M7LH 4GFTB 4GGAA 4L1QD 1RZJC 2FWLB 5EU7E 4XP4H 3CSYB 4HG4J 1EHLH 5LWYH 4QYOB 4KY1L 3EQ9A 3GO1H 4P57B 4PREA 1HILA 2Z0BA 3QZWA 3U9UA 3DM0A 1KG0A 2H0JA 5HVFB 1T03L 3IUJA 1X9LA 4JQIA 3QR1A 1KN4L 2VJ8A 2GI7A 5J13C 3WL9A 4NLAA 1A7NL 4JSPC 3ABMB 3M8OL 3R06B 3DIFB 3ZL1A 1RFDH 2B2XL 4GPVA 3MMYA 2LFEA 4ZQKB 1OK0A 2DKUA 2WNWA 2HVKA 4JM2B 5HI4C 4PJCB 4ALAH 2WQAA 3TO4D 3QQ3A 3V9CA 3RZCC 2H13A 1YAZA 3TH3T 4Y4FD 2ITDA 4NNYA 4XMXA 4GH7B 1NDMB 4JREB 1JWUA 1NCOA 2PWFA 5LUMA 4A6YA 4JPSA 3MI6A 1PYWB 5CYKB 4G6KL 4GSQA 4L3HD 4AMZA 1WSST 4NHUB 1NSNH 3IRZA 5ACLA 3GXMA 2VSCA 4KTDL 4GAYB 3VRJB 3HKZA 1P2CB 3CVDA 4PJFE 4JO1L 4YHML 2WIIB 4F37K 1RURL 1XTLA 1NLBL 1KTLB 1HILB 3Q1SH 1ACYH 1A25A 4Z95L 5A2CA 3VI3F 4PJGE 1KCSH 1ODUA 1TMQA 2AGJH 1TQSA 1E4WH 1YUHB 2HT2D 3NESA 2CJUL 2IWGA 1HHIA 2BP0A 3GPEA 4NT6B 5KAQF 1PD1A 3OF6D 3S96B 2Q3ZA 2ZCKL 5CD3A 1P5UA 1YY9D 3L95A 4KOCA 1HCFX 5EU6E 1KBKA 5F6HJ 1KJ3H 1BCIA 3P40A 4NQDA 2P5ED 3QEQD 2DI7A 2CWRA 2FJGA 4FFZA 2O30A 1LM8V 1DVXA 4NQSA 4X5WB 3HZ3A 2FYYB 4PP2B 4Y2OB 1Y07A 2J71A 3HG1B 4ONHB 3V0AC 2O9KA 4DGUA 3ESVF 1TVBA 3RTQD 4AWJC 2ENQA 1JN6B 3MRIB 5C2WB 1HHKB 2D7MA 4KJYA 3LMJH 1AGDB 2EXYC 2FRGP 3SJVE 1NUNB 2FLMA 1UB6B 4FQ1H 3S48A 4AMXA 3K27A 1GC1H 4W4OC 2Q86A 1ED3A 1AACA 1KZQA 5PAZA 3NZUA 4PJEE 2F8OA 4WJ5A 5FYJD 1HI6A 3H55A 2YK1L 5JW5B 4ODBD 2H4EA 1VSCA 3EF7A 1JPGB 4H8WC 3VQ1C 2V37A 3ZYZA 1NBYA 2NY0B 2H3NB 3VB9A 4AT6A 2CO0C 2CRYA 4G9FB 3AXLA 1TTRA 1LO3H 4GKNB 2NT1A 5FKAA 2QR5A 2DQCL 4XBPB 1L5GB 1ZPUA 1ZXKA 1JV5A 5CGBA 4KJPC 5TK2A 2AI0L 5HYJB 3ZRCC 2AW2A 2WQWA 2E76C 3MRLA 4F7MA 3QWRA 3PQYD 3GMMB 3HG1A 4ONHA 3TYGH 1AMXA 2VE6A 3UBXI 1B0GB 2UUDH 5DUMH 3RVTD 1PZDA 3FRUA 1KJVB 3Q48A 4YDNA 3O4LD 3NQKA 4P05A 4KJYB 5T1LD 3LXBA 5E8DH 3MNVB 1YQVH 3CDYA 3IVKB 4IDJH 4J3VA 1M7IB 1J88A 3TIDA 1LMKA 3TFKC 4J4PD 1YEEL 2Q7AA 2W5PA 2OZ4A 1GW0A 2EDXA 4PP2A 3O3BB 3CAFA 5I0ZA 3TJEH 4M43L 1P4LB 1WLHA 1CDUA 2WQVA 1V05A 2FO4A 2DYSB 1GYWA 4AEHH 1FG9C 1RJZA 2CO3A 5CJXC 3TNMA 4ZUTA 4GW1B 3VGFA 5L0QC 4PLJC 3OKLA 1IGMH 3P9MA 3KPRD 4IIQA 3QO0A 3UZQB 1ZHBA 3WEBA 1HEJC 1UFGA 4I77H 4RDQG 4RMVA 3GMMA 1EJ6A 1A7QH 2YD3A 3EOBA 2BNRE 2DKMA 2PN5A 3V4VA 5HGDA 3IDUA 2Y0SA 3GJEA 5M61A 1QI4A 1GSMA 4N2NA 1JV5B 1NDMA 4NJ9L 2G60H 3NCWA 1NH6A 4OVVA 2G75B 1A5FL 2IPUK 2LU7A 3AXLB 4GKNA 4G1EB 2G3NA 4I2XB 1MJJB 3UTSA 3DIDA 3KPRB 1LE5A 1BG9A 5AAWA 4MQTB 1HS6A 2B4CC 2QADC 4QYAA 4MS8D 1PVHA 4HJUA 4PJ8D 3DX2A 1S4IA 4JGJA 2VC2L 5EU3A 5G5DB 5E24E 1QLFA 3LRGA 1S7SA 1S7WA 2WVSA 3T0ED 3UTTA 3VU2A 2EEDA 3WIIL 5EIIB 4XWOC 2MWCA 5GGRY 1Q38A 4NP4H 1D9KA 3ZZ1A 4HK3N 4OB5L 5CINL 4D8PB 1VZIA 4DKEL 3T1FA 5LCVH 1U2CA 5F2FA 4UU9A 5FYJL 1XR9B 4H0LC 1J0JA 4WUUB 2EUZA 3KM1A 3VI3A 5DMGD 3QGVA 3S37H 2DQUH 1E42A 2V3EA 4CZYA 4B96A 1DJXA 4WI3A 2O6FA 3WENA 2APSA 5HE2B 3WI9A 2XBZA 2WXGA 1E8ZA 3CCHA 4RGMC 3HB3B 5J7CC 1GMIA 4G11A 3EG9A 1KN4H 1AKJB 4I7ZC 4Q9BA 5AB9A 2R27A 3CTTA 1O75A 1HWGB 1L0XA 3B6SA 1GTNA 3QXAB 2J6EA 4J3TA 4A0AB 3I84A 5E4AA 1LK3H 3B2VL 3GIZH 3UPAA 4HWEH 3QHYB 2WLLB 4UYQA 4WW2B 1KB5H 4AUUA 1LE9A 2OPCA 3QRLA 4R7DB 4LGRB 4NC1C 3D0LA 1FIGH 3PYCA 3GS0A 4LHUB 2IUQA 1D6VL 1LP9B 5FV2A 1FG2A 2AQ1A 4U3SB 2WWKO 2XL3A 5IW6B 1A9EB 1GRWA 2VRQA 1G6VK 4OZGB 1PTZA 3SKMA 5FIEA 3N1PC 1QUNA 5GS1B 4MD5A 3AAZB 3VFWB 2EZ0D 4Y19A 2GIXA 1AXTL 3L2NA 2OMXB 3M07A 4JZJB 4FJZA 2DDQH 2AEQH 4UOQA 4K7FB 3T2OA 1IC4L 3ILDA 4F57L 3V55A 1QO3A 2VAJA 3DIVA 1HHJA 4MNHB 5AYUH 4KK5C 1HOCA 3CFNA 4TUUA 5C2VB 2BH0A 3AY4C 3HRZB 3IDMB 2W9LA 1M3JA 1U8KA 3LYRA 4N2OA 4LSTH 3TTYA 3UAAA 2AGJL 3BLKA 1KELL 4O4YL 3HLKA 4G7YL 3SE8L 1FNLA 1BEYH 5F7LB 3LIZH 1V55B 2CCLA 1QRKA 3HC3H 2NYKA 3OR6A 4OLZH 3S6CA 3ZL4H 1M2OA 3ULVF 2DQDL 2CHDA 1TJGH 5DUPH 3O2DL 5EULV 3ZR6A 1F4HA 4ISVB 1MF2H 3FCUB 3PPEA 4J8GA 4YSOA 2ED8A 4G5AA 3L6FA 2VDLL 5E2JA 1C5CH 3K8LA 4XP6L 2ODHA 1PLBA 2YJQA 2GK0B 3REWB 1T6BX 5DZPA 5HGBB 1I31A 3S36L 5FXYA 2YQ2A 2DQJH 2XIDA 2MQCA 2CJ3A 4Y5XC 2ATPA 4DVBA 4GXVL 1AANA 1JNNH 1XCWA 4JGNA 4U33A 2VL4A 4ZW7A 2WOBA 4RFNC 3UGEA 3PLYA 3SCMA 1MI5A 3IE9A 4R3SA 4O5LH 3VH8B 2WOYA 1QMUA 2JLLA 3DGCR 2CE9A 1MEXH 3FUFA 3ARTA 1GOHA 4OI7A 1A1NB 5FXCH 4R7NB 3O6KL 2IC2A 3I2CL 5FYLD 4B9JA 5EIQA 3ETBJ 5JDJA 5HBBA 2ESVB 3B8YA 5EN2B 1KGCE 1DLHB 4L0PB 4CW1A 4KUZH 1SYVA 2DJMA 3ZKSD 1BJ1H 5GPRA 1Q9KB 2QMJA 5GS2D 2GHZA 1C9SA 4A7TA 3MX0A 4B0MM 2AI0H 5IHZA 2YNNA 1NZRA 4M48L 4P04A 3T0AA 3OB0H 4N8PA 4PRDA 4JY6B 2V7HA 4RX4D 1E6OH 3GMNB 1C16B 3AQZA 3TV3L 3WKYA 1H8LA 5FOBA 5JIIA 4S1SH 3ECWA 4RAUA 3UVKA 3O6MH 2CJSA 4B9YA 4EUPG 2IFGA 2HXCA 2HX8A 3JZHA 3WNIA 2VXSL 4AMYA 5LO7A 3GB7B 2CK0L 3GD1C 4GM3A 1UD6A 2UY6A 5DURB 5CLZA 1XF3A 1QNZL 2QZ5A 4Y9GA 3BN3B 5GGUA 5DYOB 4JM0A 1A6ZA 3L3DA 4ZTPH 5A1AA 5IV2A 4QXTB 1TO4A 4H7VA 3WN6A 4UCFA 2V33A 4ZTEA 4ANXA 4Q9QL 4ELME 5INDB 3FSAA 3U6RB 2F5BH 1U0QA 3LKNA 2DQTH 3RNKB 2JB6A 4X4ME 3S37X 4NQCE 3W0WE 5F0MB 3FRXA 3VXUE 5F1IB 5BUGA 1UOPA 1T66D 1M42A 4XNYH 2HLAB 4NEHB 1YN7A 3POHA 4MNGE 4RBPK 3EBGA 1ZGLP 2F6AA 3CV5A 1QABA 4EXKA 3I6GB 3QJTB 2BS8A 1V54B 4HGWB 5CEYA 5D71H 5HGGS 4ERSH 4LOEA 3BAXA 4ZBJA 1VJSA 1LP9A 3KJ4C 3QQDA 1ZLVH 3EYSH 3QIBA 2CKBL 4GOSA 2OYLA 5JUEH 3PWPE 1RV6X 5ETUA 1KGIA 4QOKB 1N10A 4AXWA 1DJYA 3LRKA 3WOVA 4L3EE 4X6BB 1YRKA 1S5IL 5K1JA 2JJUA 2VDNH 4UAHA 1QSZA 4HOMA 1TQCB 4LOUC 3FPYA 3GHPA 3PXWD 3PV6B 3HVNA 2EEBA 3WELA 4ETQB 2AJ3A 4LHJB 4J0WA 4PTTA 4GMSL 2ERJB 4R26L 1XO8A 4HP5A 1GTFA 4X7CC 3OQ3B 4XB3A 5TDNA 3WIIH 1KMGA 2GQHA 4G7QB 4UM8B 1YJDC 4GBXA 1KGYE 3RJQB 3DGGB 5AZ2L 1T1XA 2W9DH 1H15B 4RAHA 5F97E 3VE0B 1G7JB 1K8IA 3F3HA 2JJSA 2HAZA 3BFOA 3ZN6A 2WTPA 2F5AH 3DIFA 3OHMB 3U0WH 3FRPG 1MFEH 3IEAA 1NEXB 3N55A 3QWOA 1T0MB 3WLWC 2NQ3A 2X4RB 4LLAA 2QSCH 5EOQL 3HG2A 5BO0D 1ILUA 3SO5A 2G9KA 4GS7B 1CI3M 4NJAH 1MLBA 4ODWB 2AABL 2A9NH 1QWHA 5I75C 4K2UL 4FFZL 1JV2B 5HJBA 1IKOP 2K7QA 3WMQA 1BIIB 5IB4A 5JLZA 2R39A 2W9EH 1FSKC 3GMRB 5D7EA 4FMFA 1P1ZB 3T3MA 4AMWA 4X6DF 3KEHA 4YPJA 4ZX4A 3MNDA 4K3ID 5KVFE 1BD2A 1Z9LA 2VDKL 3T1WA 3HRZA 1MJJA 1RZKC 3TCTA 4NQEE 2Q6WA 3ZUCA 4FXTA 1IC7L 2G75A 4QOKE 4KKPA 3US9A 1G84A 3VO0A 4PD4J 2VW4A 2FD6L 3ZDZB 5ESQA 3KWUA 3FAXA 2CKNA 4MJ2A 2AJ3B 3BP6B 4EN2A 3MYJB 3R1GL 4FFWD 2CH8A 2XTLA 3FQUA 2WBKA 1AZVA 4PLOB 4QRPE 4V2BA 2DMBA 2WXOA 4MA1B 2C3XA 2J8OA 4X50A 2IQAB 3IMUA 3V0DA 4YSTA 2FQFA 2UZXA 1FAIH 1HNFA 1QBAA 4JG1H 4U3CA 1ITCA 4Z76B 3BN9C 1YYCA 3SE8H 3KZ8A 2B5MA 3RDJA 2C1OB 1E9OB 2VR4A 4RGNB 1FI8C 2JB5H 1S9WA 3FUEA 3FN0L 5F96L 4WO4C 1JTPA 1F45A 3VTMA 1R47A 4MMXB 5E5UB 3BW9A 4OJDH 3JWNE 4Z1PA 5DSCA 5EUOF 4ZDHB 2WTOA 4ABUA 1AKJA 2O5ZL 3T2NL 1FE8H 2C3VA 5CZXD 5I5JA 4POZD 4ACPA 1XBRA 3VXUA 3MV8B 4UNVA 3RX7A 5ENWB 1P1VA 4Z7NF 4HK0A 4Q0XL 3CZJA 2C3WA 2IH8A 1NFDB 2FB4L 4KI5F 2IUPA 1Q94B 3EO0A 3GSUB 4U0QB 5A2AA 5IV2B 3ILEA 5ALCH 1IV8A 3RHWF 5FA4A 3N04A 4TOYH 2ZPKH 5LBSH 2XWCA 5GGSA 3GWJA 4OCYH 4JDEA 4D0CB 3WIFA 1TEGA 4L4TE 3W9DB 1VF5C 3QDMA 4N8CH 3BHBB 2GBVA 4WEUD 5TEFA 4OUUB 4YHPB 3IXTA 5CJOH 2O6DA 1IL1B 1OW0C 2XWEA 2J57A 3MLYH 3GGWB 2E7CA 4FNSA 4LNRB 4M56A 3QUYA 3LRMA 1TYEA 3JXAA 5JIMA 4A67A 2JK5A 2QSVA 3P77A 4U3HA 4UQBA 5HHME 4JQVC 4E9YA 2ZIDA 3E8UH 1WUZA 1IM3A 2GSGB 3NCYS 2N3JA 1BOYA 2O6EA 3U82B 3KS0H 3NTCH 4M6OL 1JSYA 1NFDF 3QFDB 4J6RH 4M6NH 4S0HA 4P0DA 5J11C 7TAAA 1ZTXL 3T04D 1E28B 5JW4M 2VLRA 4NS0A 1PG7L 1T5WB 1Z0MA 2ZJSH 3X3GL 3P30L 2OMZA 3JZGA 1E4XL 4BFBD 1X5KA 1USZA 1FAKT 2WSPA 3UG4A 3QIWB 1WCBA 2FIRT 1QFUH 4U6HB 3LZQA 5T5NG 4XOBA 4RE5A 1MVUA 1LILA 2NUPA 3C5XA 4MQSB 2PXYC 4PRPA 3QJRB 4J3XA 5DGRA 1UFUA 2A0LD 4W9GC 4CI1A 3KYOA 3E3QC 4CU8A 1ZA3A 5E1GA 5C08B 5FA4B 2F53A 4CC0A 1HESA 2ZWYA 3ZMEA 1FZOB 4ZS7H 5IROD 3HFFA 4IRSA 5J89A 2ICWB 5CGTA 4UWQB 4YLCA 1XMWA 3EW3B 3SD5A 3ZDZF 2ADYA 3GBLA 4TL4A 2KDGA 4GT0A 1UZ8B 2JKSA 4LRNL 4WI2A 4NZUL 2ZOKB 4GM9A 3W39B 2UX6A 5AOLA 2KPNA 5K69A 1SQ2N 1WRFA 4X9YA 4KNTA 3TC9A 5L2KA 3LEXA 5JA9A 2E8YA 5BJTA 2I24N 2X6CA 5B4MC 2CO2A 1KGXA 1YMMD 4X9BA 2DAVA 2WIMA 5JHLA 4PCSA 15C8L 1MG2C 3FH8A 5MEOA 4HGKC 3Q3GA 1JOIA 2IPTH 3D39E 3VFPA 5KYYA 4MJ6A 3CXHK 3V5DA 2K3TA 1A6VL 1JN6A 4QI3A 4FEMA 2VR8A 2Z7ZA 3MJGX 4J1UB 1WFUA 5AUMB 3WO3B 2HVJB 2NY7L 3MYJA 4FYRA 3WAKA 2WXHA 1QSFE 1A9EA 2YUXA 3DURB 1XAKA 1RZKH 5DRXA 3LHAA 5T1MB 5IMLB 1KG0B 2Z7WA 4NFDA 2P9IC 2BW5A 3WEOA 4GAFB 1MJ7H 3V5KB 2J55H 4AQAB 5EU4A 2H2SC 3WO4B 4WW2A 3G6JE 3L4CA 5IJ7E 1H3PL 2MJWA 4X5XB 1CTOA 2H2PC 4PJ5A 4MMXA 3SN6B 2ZNWA 2BDNH 3M46A 4PGCA 1L9TA 4YDZA 1IGJA 4O45A 1IGFH 2XY1A 4HIPA 1ZS8B 4U7AA 3IDYB 1FFOA 3BRGC 4A09A 4R4NC 5BS0D 4AM0B 3KYNA 2H0FA 5HPMA 3WXVH 3QAQA 5DK2B 5L7XL 4G71B 5IBLD 2EEXA 2MH4A 3Q6GH 4BH7A 5FW7A 3KLHC 2W9EL 1U8JA 3P4NB 3S88L 2O26U 3N5AA 3S96A 4RRPA 5TE6H 3T0VA 5JMRA 3QCVH 4Z7NE 5AUMA 1SN5A 1VIWA 3NRQA 3E80A 1NCBL 4MA8H 2XRAH 3PXJA 1TFHA 1U36A 1NKRA 4XO4A 1PYWA 4FABL 4BZ2L 1BX2B 1L7IH 3ZK0A 3GREA 3RVVD 3DK0A 5AAMA 4C4BA 3D33A 4JFUA 2CDFB 4AYFB 2R0LH 4Y2NA 3RY6A 4ZFFA 4W6WB 5C8JA 3WS3B 4HXBL 3V79C 2WLKA 2WVVA 3HI6H 1GOFA 5D93B 4TSCL 3DHUA 1RIHH 4DPBX 3FOLB 3KR3L 3ARQA 2ZKHH 5DJYB 4PJXF 5CLWA 3DRQA 2GB2A 4FQXA 1OEZW 4IIQB 4M93B 4OZIF 5EWIL 4KKLD 4U2YA 3V6OA 1XEUA 5ETUB 3QJUB 1E5YA 1A65A 4XN2A 1JD7A 1SMOA 4WK4A 1KCSL 1A6TB 3WV0A 3B8SA 1BDYA 1T5XB 5DTFB 2PWHA 1M6UA 2CIIA 2VUOA 2A77L 2HFTA 4HGWA 1IIKA 3QYNA 1CU4L 2JB5L 1OKEA 4BINA 5AWNH 4FTVD 5D4JA 1DBAL 4X3EA 2BVPB 4PVBA 1OAYL 2K45A 3N43B 4Y8AA 5I1AA 3GS4A 3RFZB 2NNFA 3IURA 2WQRA 4WVRA 5CGYC 5JPMA 4WK0B 1MZZA 3C6EA 1IZKA 4K94C 3RFZA 3NCYP 2NUPB 1H15A 2PTVA 2J56A 1BIHA 4QHMB 5E9DA 3KPNA 3VACA 4PWJA 4JZNB 2YSSB 4PFEA 3K4AA 1J48A 1EDHA 1UT2A 2DL2A 4DGWC 5GGVY 3KDMB 4DUWA 3MLRH 5GSVA 1B0GA 3IJSA 3VGBA 4RGMB 5LCVA 1IGJB 2MQ0A 4L8SA 3C12A 2Y25A 3O9WA 3QPXH 1N18A 3Q7JA 5KBMA 1FYTE 3DMMB 1XF3B 5DRZB 2F61A 1CLVA 2XX0A 1IBYA 3ARDC 1N4XL 4HKBB 2WBXA 3H56A 3MV7B 2P1YA 3L4WA 1T7VA 1OSEA 1NC4A 4XI5C 4NKIH 4XNXH 3H9YA 1IC5L 3VGGA 2NDFA 4PIBA 2YOCA 3KPQA 4XB8A 1XDTT 3IMVA 1RVFH 1QSFA 1Y1DA 3FQ2A 4MXQC 1F8TL 1HDMA 1TLKA 1E4KA 3INUL 1XGUA 3NT0A 1RUKL 2FYVA 4JO8A 1CFMA 3PWPA 1BYNA 5HYJA 4M6OH 4M9OA 1E6OL 3V5DB 3FCSA 1K3ZA 1SEQL 5JOPD 3TV3H 3D85A 1PX3A 2JJSC 3T5WA 4N24A 1EXUA 1ZTXH 2NR6D 3VYOA 3S98A 2A9ML 4BQCA 1FZOA 1HH9A 3NIDA 3CFUA 3T8XA 2BSCA 2RCSL 4QXTA 1WG3A 2DV6A 3LD8C 4EUPB 4I48B 1J8KA 3FFCE 2OL3H 1MPAH 1KIQB 4IMLB 3A21A 1KB5A 1A2YA 1JZ7A 5IBUB 3E0GA 2YSSA 4NX0A 4PY7A 2AQ5A 5E08L 4H26A 2BSDA 5C9JB 1PW3A 4LVEA 4QHMA 3L95B 2DZEA 5TJWK 4OIAA 3QIUB 4P07A 4EIUA 2R0ZH 3AM8A 4A2MA 1XZ0A 1PMYA 3S8FB 1NIAA 5HD8D 5I1AB 1OMWB 1Q8MA 4MJ5B 2MOVA 3NIGF 3IGLA 4PMFA 2WK2A 3FZUC 2YZ8A 4ZS7L 4E0RA 1EFXD 1S9VA 1OPGL 2LU4A 2FJGB 4RESB 3EMHA 4HPYH 2IG2H 5KSBA 3V4VL 3IJHA 3L81A 3BP5B 1DLFH 1TQUA 4MAYC 1SQ9A 4LRNH 3VA6A 1J87A 2ZWNA 3ZIYA 5I66A 5JYLA 2H1XA 4EIBA 3BRFA 2XIIA 5ERWB 1NICA 4FQXD 4F1ZA 5D2LA 3RY4A 3UC2A 5L2KD 1SYVB 3QDJD 2GSGA 3V0WL 1WHOA 3N9GH 3LEVL 3QQXA 2ORBL 3HZKA 4HS6A 3A67H 4NJ9H 4XZ4A 3T08A 2VUYA 1ESOA 2NZ9D 3D25B 2DQIL 4QHLB 4FI6A 4WHYH 4ZW6A 4PGEA 1LEIB 4K5PA 4NP9A 2ETWA 4AQ1B 3RFGA 2CDFA 4AYFA 1JCKA 2AEIT 3U2JA 3ALWA 3WJLA 3X12B 3FU8A 4YWGL 4CVXA 1ZSDA 5FO9B 4QL1A 3D85B 1OP3H 1BW8A 5EUKB 4M7ZB 5K5YA 2QTEA 4GQQA 5F7DA 5TDOB 5CXPA 3TTSA 2KYIA 1G9ML 4NQCD 3LNGA 4NO3A 2CXGA 5J8OA 1FH2A 4UBDC 1I9EA 2QQKH 2AGXA 4UIKL 4ZJ9A 1BOGA 3FRPA 3H2QA 2P28B 4A6YB 1PJWA 1R75A 2YMTA 5CP3A 4YHKL 2WNKA 5D7JD 4N68A 4LPXA 4IOSA 1C8QA 5DD1H 5I73B 2WMPB 5FYJH 2IEPA 4JO4H 3QQ3B 3ZYOA 3I02A 4OR1A 7FABH 4GMTL 3TA3A 2X89D 4BA8A 1FJ1A 1WBZA 4GEIA 1DVFB 1ZCRA 1DBKL 1UACH 1KIUB 3A4EA 1MW2A 2OIZA 2A6JB 2GYSA 2R83A 5HDWA 4E9WA 4DSYA 1VGKB 4P5MB 4AE0A 3CFTA 2VOTA 3L3IA 3TBWB 1MCHA 2HU7A 1HIMH 5E9DB 2VITB 1H3XA 5CZVH 1NPJA 3RQ3A 3RWHB 4F3FA 1GGCH 3TURA 5J3HC 4ODTH 2VXQA 2O1AA 2OYMA 4JRXD 4PBZA 5DQDH 2ESVE 2W60B 5K9JH 3G3LA 1JS4A 1L7IL 4H8HA 2AFNA 4W9HC 4M7LT 3R1GH 4D0BA 3V5KA 4F1SA 1BAWA 3DDFA 1QASA 1TYRA 4MLSA 4WGVB 3WSQH 2X2UA 4WI9A 2WSKA 3EHBC 1BJMA 2DLIA 1ZGLM 5K93A 1I8IB 2OMUA 4MXVE 5IVXB 3EYQC 1OD7A 1QZ1A 3UL4A 5TF2A 2DDQL 4KPHH 3LHPL 1R3HB 5DHYB 4HWZA 1JVKA 2P8PB 1E9PB 3I2NA 2UZYA 3UTSB 4I79A 2KPWA 3CQQA 4TQIA 1KFAL 1ZANL 1E3ZA 5F7NC 2AF2A 1OM3L 4ADJA 1R34A 3BDYH 1BF5A 3JV6A 4YSCA 2EIKB 4ZXBA 3ILPA 1HZKA 1OCCB 1PQZA 2WZPD 2HU8A 4TQPA 1F58L 2NZIA 2HKFL 1WFJA 3D3VD 4EZKA 2HKHL 3I3BA 2BOBB 2F2HA 4DT2A 4G8GB 3RWGA 4GUPA 1K2DA 1QI3A 5ITFB 5IMKB 5MHSD 1UENA 4OFVA 4PV9B 1S7RA 1SHXA 3L4UA 3QQ9C 4PRPE 5AG8A 5K19A 2YRBA 1U8JB 4W1TA 1DQLH 4CVUA 4ZMQA 4YSRA 3SCMD 4BYHA 4OCYL 4PREB 5E1AA 2G4EA 2QGCA 1NAMA 2WKOA 5DMYA 5I6MA 3ARZA 1JK9B 3DV4B 3HPLA 3UZEA 2C34A 4XMZA 1E8XA 2DM7A 2PCPA 4G8AC 3MFFB 2FX9L 3CC5B 3QG6B 3OZKA 4K71B 5E95B 4J3OH 2EUWA 3SDYH 1E28A 3BRDA 1H3VA 3NIDE 4YLBA 3DJSA 3W82A 4PMEA 4X8CA 1NCGA 3FU9A 3GS7A 2P47B 4L5FH 5TEEA 2ROXA 1RCYA 2D7OA 4X7DC 4PR5A 2X4NA 3L9RB 3QUZD 3BO8A 3WDHA 4ZUUB 3I3DA 1QFMA 1D6VH 5J6HB 4F7CB 4HEME 1CGSL 5ACZA 3LKPB 4FQQA 1RZGB 4E41D 4GI6A 1CBJA 2IMNA 1WZLA 1KUMA 4NNXB 5CXBA 2K6YA 3T09A 3ZKMD 2NY1C 4FQCH 4JG9A 2AS5M 4N0YL 5I66B 1T80A 4G9FA 1IBBA 2X40A 4FL4C 5AVQB 4PVMA 4HBQA 4JM2C 3PHSA 5INDA 4X0NA 5IWLC 5E6ZA 1HHGA 4F57H 3EH1A 1AZCA 2YQ3A 4PWIA 1U8PB 3V7MA 2PPFA 2RMNA 3QG6A 4O51A 3O3BA 4FXKA 4I0PB 4UTCA 5F88B 2GJ6A 2Q87A 3O6FB 2CK0H 1I3RB 2J4WH 4JZOB 4LK4A 5D1QB 5C0DB 3D34A 1ZTMA 4JFFE 5EHFA 2JLPA 1EK3A 1NAMB 3R0NA 1F13A 4OLZL 2K6WA 4TVPH 3SZKC 2IPUG 5BZWB 4HZAA 3FCUA 3P11H 3LNEA 1PFOA 1VCAA 4JFHE 3W9DA 1LNUA 3O4OB 3DMMA 3KCPB 4P5TB 4P3DB 4IKJA 5IMKA 4OCWL 3AXIA 4CMMA 1FHGA 2ICWI 2F5BL 3FU6A 1FL3A 2XWTA 2O5XH 3VDCA 5JORB 4NQSB 4X5WA 3MJ7B 3F5WB 3L5XL 4JFDB 5M5UA 1T21B 2DQJL 4JZNA 3BUYA 4WU7B 4JDTH 4XODA 4HJGB 2BNRD 2ARJQ 4IHOB 4ATTA 2LE9A 5L88H 1T4KB 2Y69B 1I9RH 4QY8A 3PSLA 4U1JB 3LEVH 1IGIL 5KYWB 4JNXA 1CLYH 2D7NA 2IPTL 2KS0A 1LO5A 2APXA 1XGUB 1CE6A 4R2GB 3P0VL 1NCNA 4CJ1A 1S5HB 4LCWD 1QSED 3UTTE 4ZMZA 2YPLD 4DEPB 2XWJA 2CKBB 2ZYSA 4PR5B 3OL2A 1I3GL 3DA0A 3D2UB 4JFOB 1BD2D 4J7RA 2AQNA 2AJVH 5HI5C 1IM3B 3APNA 3IKKA 3VI4B 2NQDA 3GZPA 3PQYA 4L05A 3RDTA 1RZGA 4OI8A 5I1DA 3GM0A 3VXSA 2VM9A 4LFHD 2DQEL 5CO1A 4IEFA 3ZT7A 3UG3A 1M9SA 4KQ3L 3D6GA 3GBEA 2BLFA 4MAUL 5AZ2H 1DZBA 3OTTA 1HINH 3N1FC 4JDZB 3S37L 2R0KH 2E7HA 1VEOA 3FFOA 3UZVB 3O4HA 1SYSA 1OGTA 1A4AA 3O6LH 1U93A 4NUPA 2AGWA 5LGHL 5L4MA 3WS6C 1J12A 2ED6A 1NLDL 3R06A 3I9AA 3X3FH 3G6JB 1HL8A 4HUWB 2GSIB 4FHKA 2FDBP 3HCVA 3UMTA 3ZO9A 3QNFA 4A7GA 1UWGH 2QQLH 3W11C 3AL9A 2LLGA 2VERN 3AL8B 5K59E 1SFDA 1PLCA 3QCVL 3M45A 4P57A 3KPOA 3FYEB 4MJIB 3JTTA 4DF9A 1E6JL 2M8XA 4L1LA 5I71B 1YDPA 3C5MA 3FUMA 4X7FC 1BXXA 2NY2C 2HRLA 2D9QB 3PL6C 2IH9A 3ARDB 3VM5A 1T89C 2R4RL 3LH2L 5LN8A 1V7NH 4FYQA 3SKMB 4UQ2B 1FL6A 4F27A 2DIBA 5DLLA 5TDOA 3IN2A 2IOMA 1QFHA 5ELIA 4P4KD 5FO9A 1MFDH 2VJXA 1AR1B 2H6UA 2RALA 3HG5A 3CDZB 1SY6L 3OKNB 2J7LA 3T8VA 2MQ3A 1MCJA 3NVQA 4G9DA 1O6VA 5GS1A 1P9MA 1KPVB 3ME0A 4M03A 3WE6B 3X14A 2B20A 3VYPA 4NO0D 2Q10A 4X61B 2V9UA 4PJFF 3BT0A 2A74B 1CLOL 4JFYB 4DPCX 4NQCA 1B88A 4JLRA 2UZPA 2CU9A 4MJID 4Z7WE 1D9KD 1DN0A 1TQBB 1G7MB 1XVSA 3II2A 4AENA 3B9KC 2ADGB 2QR0A 4M1GH 3G08A 3CFVA 1MUJB 2RR3A 3H6AA 4X2UA 1OP9A 4A08B 4CZXA 3HG1E 3N2JA 3WO4C 2D3JA 5I6KA 4KZEL 1P7QD 4S1DD 4LP4A 4WUUA 3G9VA 3FTGA 5DC0A 4ZMWA 3KVQA 2Y22A 1ETB1 1F4WH 4X4YB 2V2WB 7PCYA 5FX3A 4DEWA 1A7OL 1XCQA 5IK3A 5FLXg 4KFMB 1RK0B 1IE5A 4PBYA 3AU1A 3HE6D 1Y18B 1XH1A 2Z4QA 4HFUH 4W9KC 2IH1A 1BXAA 4AG4H 1QSEA 1RIUH 3OKDA 2B5IC 4J3OF 3OGCA 4CN1A 1K3IA 2YLKA 2A9NL 3OXSB 2P44B 4N8CL 5A2Qg 4JR9H 4P3DA 1XGPB 3GXPA 4HG4K 1RFDL 2B2XH 4UTAL 2BY1A 3LKRA 3AG4B 3PG2A 4DPRA 5I16B 4ZD3H 1A1MB 2I0RA 1J9CT 4U1SB 3CFCL 3RUGB 2N0MA 1A3QA 4KDVA 3MZLA 3F7VB 4W9CC 3GBNH 2HPOA 3HC4L 4N87A 2XZQL 2QZPA 1XF1A 1BXVA 1RULH 3BZ4A 2GVYA 2ZP9A 3GMNA 5AW6B 3G5XB 3LDBC 5TPWL 3EO1A 2BNUA 4ADGA 5D93C 3QEGH 5C0JB 1RH8A 3F85A 1KXQA 5I1HH 5T3XH 4M7ZC 5HJGA 4DFIA 4JT5C 1EERB 5KVDE 2YMXH 3AS0A 3DI2B 3QBTB 2YBRB 3H9SA 1MCSA 1RJZB 1NEZB 3KLQA 4PB9H 4U6YB 5IJBC 5E6SA 4ZQTA 5TE7H 3SYPA 3TPUA 5CEYB 4JQIH 2FUQA 1QLEH 4QDGA 3L2LA 2HMIC 3AROA 1I8UA 1MHCB 4JG1L 5FW6A 4F9LC 1J0ZA 3QG7L 4PRID 3L3OB 1IJ9A 5D2LB 3LKQA 1U2VC 2H9NA 1YNLH 3HPLB 3PJSA 1AIFA 1CD0A 2I07A 4HMEA 2Z7UA 2B0SH 4Q58C 5E1AB 5C0RL 1Z9SA 1ZT1B 5GZOD 1GS8A 4UTBL 5IGXL 3NPZB 1J1PL 5I18H 3LDBB 5JPMB 1OHQA 2HUEA 1AO7A 4ZMLA 4S0SD 1U3JA 2QTVA 3OPZL 4GRWF 3FMGH 5EB9A 4Z3IA 1XF2A 2CPCA 1OGSA 3N9GL 1DSFL 1H8NA 2EEFA 3AU1B 4PSWB 2RD0A 5TH2A 1OANA 3VXSE 4MYPA 3VRIA 3SOBL 2X0UA 1HHHA 2YAPA 4OLUH 2G0KA 5G2NA 3UTPD 4EQ2A 1JF5A 4B7LA 1YNTF 5E99H 1R5IB 1YYLL 2WXQA 5F88A 5HYSA 5IB2B 1J9TA 2YXFA 1IQWL 4BSJA 2HT4C 2YA2A 3LN4A 5IJKC 4ERQA 4N8VB 4DN4H 5C09B 4DVRL 4JJHA 1ZTXE 1AGDA 5C9ZB 4GT7A 1ZPLA 2Y06H 1RKRA 1KPRA 1WFMA 4FNTA 1R3LB 1XGQB 4WCYH 1PCXA 4MXVF 1QHPA 4PJ5D 1KPVA 3LQAL 3ME0B 4RVBA 4RGOH 3MUZ1 1EZUA 5C0IB 3VMOA 2WAQA 3Q5YA 4MAUH 7FABL 3BE1H 2E59A 3EU7A 3KPQB 4K4KA 3CHQA 2YNPA 2PYEE 1OIOA 5KYNA 2B1AL 1KYUA 3CCHB 3NFNA 1H6TA 4YFEA 4QHKJ 2YEQA 2P5PA 3C08L 4A09B 4HUKB 4LEOA 1IBGL 2JF1A 1S3KH 3E0CA 3ILQD 1SLUA 4HBCH 1JWSA 2XWXA 4Y4FC 5JHDE 4YSUA 4ZG1A 4BE5A 1OLLA 4KK6D 1P5UC 3PNWB 1XF4A 3MBWB 4BQ9A 2F58H 1KXVC 4Z76A 2HG5A 1KIPA 5DQDL 1AQKH 4BK8A 1UWXH 2BWQA 2ZG2A 4ZPTA 3HBQA 4UI9R 2EDDA 4Y9FA 1CL7L 1DVSA 4QLWA 4NPYA 4MA1C 1S9XA 1FNHA 1OTUD 3OJVC 1QFOA 4JHBA 4WTWA 5KUKA 5BRPA 3SDXA 1N6FA 3FRPB 1TVHA 3VUAA 2VL5A 5KJRH 1Z5HA 2AXFB 4FF9A 2QFRA 4KHTL 5L4IA 2F9BT 3L4MD 1USQA 1YNKL 1YJDH 4XP5H 2ZF9A 3CN1A 2CIIB 2R0WH 4MMZA 4FTDA 4LCVA 4KJQD 1D5RA 3PP3H 2HT2C 4M61A 5I82A 4DNUA 4I88A 5JXEA 2J6EL 1SN2A 4HK3J 4LPWA 4KXCA 3V0EA 3II1A 5AAWC 3DRTB 2CRMA 2VN3A 4ZXBC 1YY9C 2NY1B 3QNYA 5B1JA 3H7BA 1WBYA 2BIQA 2ZOTA 4PXWA 4POYA 5J06A 1D5XB 3WGUB 5F96H 1T20B 4PJHF 4XCCH 2VC2H 5F7DB 4LCWB 3D2UA 4JFOA 1E9QA 4E5XB 5DFVD 1BVLA 4LQ1A 2W07A 1ONQA 2VXTL 4EEEA 3AG3B 3W3BA 3F3FA 4M1GL 3JROA 1CICB 2Z31B 4ATWA 1LEIA 3QPKA 3ISRA 1Y0LB 5F9DC 3QJZA 2XG5A 4KXBA 5BRZD 5IZ7A 1JDCA 3RY6C 2DKSA 3N44F 1NGPH 2GY7B 2WANA 4GQRA 3AUWB 1IGCL 3HCVB 3PHQA 3QWOB 3MLUL 3HMWH 3BAKA 5F8QC 3OLIA 1KBWA 5LDUA 4JFDD 3X1NA 4UB0H 4QKXB 3VNZA 2BDNL 1BSIA 3FKUS 4IU2B 4NPYB 1HX0A 3CPUA 1YY8A 1WAAF 4LBAA 4QHNA 1PZ2A 3MBED 1MCOL 2VN7A 4GBXB 3O3DB 5PCYA 4DP7X 2VLKD 5ICYA 3QEUA 5E1IA 1KIQA 1NBVH 4M29A 1MY5A 4LG8A 2DBJA 2IANE 5J11B 4PSPA 4CC4C 4GQ2P 2PF6A 1NC2B 4UTAH 2P5WD 4C54A 2OM5A 2OYKA 3BPCA 2WBJD 4XNXL 4XMPL 2AV1B 4Z0BH 1M1SA 3QIUA 2E9IA 1CICC 1G4MA 2Z31C 4GB9A 4HH9A 5TTRA 1WE5A 4C4UA 1LK2A 3FONA 3QFDA 3ZHNA 1X3DA 2PM6B 1P4IH 4HUCA 1F8TH 4Z7VA 3FUNA 1A2YB 1Q72L 2VIRB 1T5KA 4A6YL 5F3BB 4X6EB 4LEBA 3NIFA 1OO2A 4N6RA 1QTPA 4FXKB 4I0PA 1S46A 2H1LM 3PXLA 1NGZB 4K5OA 1Q1PA 4PN6A 2B16A 5HYSB 1NLBH 5IB2A 1K4CB 3ATBA 4ODHL 1V3JA 1FYTB 2D7TL 2QPEB 2XVBA 2ZG1A 4GQPH 4XYHA 3GSWB 1F6AA 5GS0L 1KPRB 1AE6H 1T4KA 2B14A 2VLJE 4OSUL 2Q5BA 4P06A 5AZEL 4E9QA 3F12A 4OLXH 4N0FA 4PWGA 3U9PL 1MCPH 5KS9B 1DVFD 3ESMA 1AXSA 1KY6A 2YA0A 1RZ8B 1U91B 4KROD 1UOOA 1HNGA 1F3DJ 1I1RA 1XGPA 4PGZA 3D0AA 1A02N 3P11L 3H3BC 1JZHA 5E2UH 1T4WA 1DEEB 3LEXB 5HGHB 3DHMA 3UJIL 5GSVB 3NIGE 2VABA 3MLXH 2WLIA 1QRNA 5CEZD 4UT6H 3L4YA 4NB7A 5E56A 5E9DE 2V4LA 3ECUA 2UY6B 2OSLB 4K3JH 1TU2B 1CFSA 1NOFA 4GRLA 1H9DA 1PKQE 1JPEA 1NIFA 3QJHA 3W9EB 3TGXA 3FB6A 3K5SA 3RWJB 1VEPA 2BCMA 3ULSA 4EOWL 5ADPH 2IBZY 4JRWA 1S9WB 2MMXA 1DLFL 1JERA 2QV2A 4Z7UA 5HYQA 1DSFH 4GXVH 3P4OB 4N28A 4EE2A 4QRTB 3QPXL 1BEXA 3MYZA 2XXMB 1CDCA 1KTLA 3CMOH 4HT1H 4IOIA 4JMNA 4MS8C 1UM6L 1XX9C 4ANKA 1F56A 1SJHB 4JN1H 3OAZH 4UOW0 4MX7B 4TLSA 4GJTB 4DGIH 3MNZA 3F7PC 4NBMA 1MHCA 1YUHA 3QHZH 5EORH 3RG1C 4H40A 4PSRA 3CSPA 3PJLA 5J0BA 4Z8LA 4E5ZA 2X44D 3PGFL 2QGDA 2BM3A 3FO0H 3INUH 4IJ3B 2J5WA 4HCRH 2J8HA 1J0KA 2IMMA 2DD8H 3FT4A 3QZNA 1J86A 4HUUB 4WLCA 3SKNB 4LEEA 5CIPB 4WK2A 2X6BA 4MMZB 4M3KB 4HAKA 4DH2A 3LQAH 4FNRA 1KDJA 4M48H 4QTIL 5I1JL 5I16A 1I8MA 4UDUA 4IU3B 3H7BB 2BNUB 5AFAA 2JFCA 3SMRA 4CI8A 1CB4A 1ZJAA 3DRTA 3NVXA 2AKRB 1UCBL 4DN3L 5I1LB 1M3IA 1YC8A 2QPDB 4LCCC 4JHVA 3VFGL 3WTYA 4GSUA 1D2PA 3TJHD 1BQ5A 3F7YA 1BV8A 2HB0A 2BHYA 4AM0A 3P3UA 2IANA 1QVOA 2AV7A 5A6MA 4WWOA 5T1KD 5KSAD 2WWOA 5I9QC 2VXQL 3SGEI 1S7XB 4A08A 4M9PA 3MU3A 3QI9B 2W0PA 1D3CA 3U9UB 4HWNA 3O3DA 3B9EA 2YNOA 4ELDA 3RTLA 4YZWA 1QO3B 2WLNA 4GXUN 3MRKB 5ACMA 3HJEA 1KTDA 1GPOL 1JXGA 1VFUA 2EJ1A 4JFYA 1FZJA 2SODB 3FTGB 5E5MB 5E5LA 1UXWB 3X14B 1ZA6A 3J2PA 1AZUA 1IJNA 4WO0A 1X5ZA 3UGXA 4UTAA 3E9UA 4KK5D 1MUJA 2ZKHL 4P2OC 1AC6A 5D71L 3OKMB 3HR6A 1U8LB 3CN0A 3FHEA 3GSXA 5JDSA 2JJTC 5JQIB 2YLHA 3VD0A 2HG0A 2D2OA 4HWBH 4WSKA 1J8HB 1J8SA 5MEOB 1PIFA 3EGXA 2PM9A 1OTSD 3IULA 1E2ZA 2QHLA 4QPEA 4HDJA 2A77H 4QRPA 25C8L 3CFBA 5FM5M 3MRGB 4XX1G 5BJTB 3BDYL 2BVTA 1H3WM 3F83A 3ZDYF 2BCJB 2L7UA 3P9LA 3C75A 3D87B 4MZ3A 3P4MB 5HHOD 5K59F 4XPTH 3QO1A 3BAEL 3B9VA 5IHUH 5GRWA 3C60D 3Q3GB 4XCEA 3T3PB 4TVPE 4TSAL 3MO1A 1ERNA 5KYUA 2ZWKA 5HGDB 4ZMOA 3CVHB 1H8SA 2EDKA 4YPGB 4L37B 2A4ZA 5G4OA 1RJLB 4N2AA 2P8MA 4Q9CA 1SVZA 3Q9PA 5FB8B 2YWZA 4ZOEA 3P2DA 2MCMA 4DESA 1PG7W 3ZDXA 2W94A 1GS6X 4ENED 2OMBA 5GRZA 1FJ1B 1S9XB 1N8ZA 4IKLA 4EQ3A 1EGJL 5G55A 5F7BA 4JM2F 3JTSB 1RQ5A 2NX5A 1JD9A 1E4JA 2YRZA 2HYEA 1KT2A 4FFZH 2V7NB 5JOFA 4JZOA 5D1QA 1VZ2A 4FQJH 5DRNA 4MXWL 2GC4C 3UJTL 5CZVL 2F74A 2YPVL 1C16A 3BD3A 3ARGA 1HSBB 2VQ1B 3L1FA 4BK4A 5DVKA 4MBOA 5FWQA 1HHGB 3NK3A 2WXRA 5EBGA 3GHBH 3TPUB 3MUGA 3CHSA 5GRJH 3ULUC 5C0BD 1T1XB 2Y2TA 5IHZB 2UYLB 2YBRA 3H9SB 4YXHH 1MCCA 1XXFC 3JWDL 4L8CA 1HJCA 2XHNA 3KE0A 1QFSA 4LVOC 3MODH 4YAQA 3TBYB 4IRZL 3QS2A 3H9HA 5D6DC 3UO1L 4IBVA 4KZDL 2XV2A 2PLTA 2X41A 3QUXD 5DFAA 2DM3A 4RMSA 1FO0B 2LAGB 1XD0A 2CCVA 2EDYA 4PJ5E 3LNHA 2E7DA 1IEBA 4OJFH 1ZLWK 2DQGH 3K81A 2OL3L 2R23B 3OAYK 4H0HB 2ESVD 2DJUA 3JWNH 1OB1B 1KELH 4O4YH 1MCFA 2DLEA 3I50L 4Z95H 1GIGH 2NW2B 2O61B 1IFHL 1JPGA 4J84A 3DVNB 4NOBA 1TTFA 1CXIA 2R0ZL 3LN4B 5C1MB 2Q8AL 1T0PB 4UTBH 3SD2A 1D5ZA 5EM2B 2DWEB 1Q90A 3EJZD 4HD9A 3N0PB 3THMH 4X5QA 1E4KC 3QUKA 2NX5B 4ZMYA 5CUSH 1HHHB 4KHXH 3K4DA 5C2BH 3N85H 5EAPA 2ADJA 1GZHA 3Q9QA 2ZP0T 1NGQL 4X6FB 2ICWA 2C3VB 3K2IA 2FGWL 4NSXA 4HZ1A 5I8EA 3RJOA 3ZKQD 3F62A 4JFDA 2DF3A 2IAMA 5EOCJ 5D70L 2WKOF 1AD0B 3OR6B 2ID5A 4L8SB 4ZO6A 1NR0A 5KVFL 1AGCB 3MBEA 4JDTL 4LVHC 4A7JA 1KXTA 3KDMA 3ZOAA 3EI4B 3IDMA 1A9BB 1IBDA 2R9HD 5F1KC 5SX4I 4L3FA 2DQIH 1KDIA 4LOUD 3I2CH 3U6XS 1HAUA 2MCAA 2V2WA 2WYTA 5MEQB 3PAYA 1AKPA 3A5VA 2GUYA 2CM5A 1JYWA 1KV3A 5B22A 3MFGB 4WWPA 5FA3B 3T6VA 4F2MA 4Z7OA 3HEIB 4BK5C 1ZIBA 4ZI8A 5CSZB 3DOHA 3IJ9A 4I2XE 5ID0B 2VIRA 4F7PA 3HTLX 5E6IA 3WFBL 2NR6A 1GZPB 4HUXA 1U8LA 2ICCA 5F7EL 2BIPA 3VFVA 3H9ZA 1JYNA 1SGKA 4NWUL 5C0JA 2B5NA 4EZLA 4U1KA 2NXZD 4PI0A 2XXCB 2MHAA 2C7FA 1IMHC 2JK5B 1P1ZA 3P77B 3MGTB 1JP5A 2J12B 2BIHA 4F7CA 3ALPA 2Z35B 4NN6C 5IB5B 3NA9H 2DQFB 3O6LL 3RU8H 5H14A 3ULVD 2BVUA 1X44A 2CR0A 2I7OA 1YDPB 3RYMA 4OD1L 3TBWA 4Y4FA 5MEPB 1KC5H 3AY4A 4TN9A 3U25A 5ITBL 1C5DB 3HUJA 2VDMA 1U4CA 4B9PA 2BY0A 1EJFA 3AREC 3EFFB 1EDYA 2J1KA 3D39D 5DK3A 2E27L 3PP4L 3RPKA 5KSAA 3ZDXB 2VQTA 4PJ9D 4R4BA 1KIUA 3LB6D 3F3PA 4L37A 3PF2A 1O6TA 1SXAA 2H0PA 2ITCB 3APDA 3RRQA 3SDDD 4UOZA 2OS7A 5E6YA 4AEHL 2JI3A 1FORH 4KRNA 3W2DL 2YPLB 1W6LA 2LFGA 5KJRL 1INDH 4QRRE 4UYPA 3PAUA 4OFIA 4YX2L 2MPAL 2OP4H 4N0UE 4PJIB 4BFRA 1X5LA 3FSZA 1E5TA 2ARJA 4AZUA 5CFAA 4GZ8A 4LARL 2P8LB 2YUVA 5GHWH 4NO2A 4ILDA 2EINB 3GSOA 2B08A 5DJYA 5JOPE 1N7ML 1X4ZA 3EYSL 3IWUA 3Q6FB 3F65A 4TVPD 3ABLB 1EWHA 2Z64C 4YN3A 4LXFA 4CGUB 4UT9A 4NO0B 1UEYA 4BXVA 1PL3A 3BN9D 3P0VH 1AZBA 3AREB 5K39A 5FYLH 3T9WA 5FKSA 4MJIE 2YD0A 2CKBA 5C09D 1MDTA 1JI1A 3BH8B 3BP7A 3D12B 4JZJC 3TN0C 2A74A 1LE9B 1YC7A 1Z3RA 2KZBA 1GY1A 4TRPL 1KLGA 2DQHL 5HYEA 3RVWD 3IDIA 4F7KA 3LPGA 4XPTL 5IW6A 1FYTD 4HIXL 3U4EA 2DQEH 2X2YA 1MAML 2ATAA 2RB8A 4GW1A 5CKGA 1B6DA 2D4FA 1I4FB 3BPNC 3NJXA 1C7TA 2F54D 2Q76B 5A3IC 2ZOUA 3LRHA 1ID2A 4F93B 1Z9OA 2WWMD 3U2SB 1KN2H 4ZFZA 4KZEH 4L1DA 5FR3A 1XF4B 3MBWA 4YLQT 1A22B 3GKZA 1H3PH 3UO8B 4XPAH 1UYWH 5FUCC 3CDGA 4P2RA 4LG9A 1MCEA 4J6IA 1Y6KR 1X5MA 4A2LA 3NOIA 4FQHA 3L5JA 2IH3B 3GLDA 1IC1A 2J8UF 3FB8B 3JWOL 3OMNB 4MVBC 5DVPA 2NLJB 5IQ7H 1E4XI 1G7PB 3H4HA 3M8OH 5IVOA 3F7KA 4M5TA 2UZIH 2OW6A 4I3SH 3WEXA 5CEXB 5KG9A 2YARA 1KF9B 4IIZA 5T1DH 3C6LC 2E74C 1UB5A 4XNZB 3UPRB 1VZGA 4XPGL 4O3TB 1S7SB 4ICXA 1XH2A 2R1WA 3MBEB 4PUBL 1DEEA 1XQ4A 2XPGA 3F3GA 1F4YH 5HVHB 4ZW5A 4IBZA 5ILTL 2ZUUA 2PBIB 1KBGH 1DJIA 3O81A 2G2NA 1MXDA 1D5MB 4XBEL 2K0RA 1AXSB 4ERYA 4I0PC 4UQDA 4X6FA 4BZ2H 3MRHA 4JY4A 4U6XB 5AKRA 3IWVA 4YFDB 1U21A 4M8RA 5BW7A 5CCKH 4FJYA 4B9CA 2CBMA 4H88L 3RWDA 4DAGL 1MFDL 4PTTB 1I9JL 1DUZA 3ETSA 5E2VH 2OMZB 1MCPL 5EDSA 2XSKA 1L9PA 4S2SB 2B59B 5AVWB 4OM1L 2XI9A 1UC6A 4MX7A 5FGBA 1JGLL 2XX1A 2QXVA 1JNHA 1UB6A 5D7IE 3FTXA 5J6SA 4XVTH 1I1FA 1IB5A 3QXDB 4MNQB 4NAJA 4OUOA 1EMTL 2X9ZA 4IOFC 1I2MB 2MTPA 4LHQB 2VDPB 4FDWA 4YVDA 3BJ91 2WZAA 1KJ3L 3KPRE 2VQ1A 4J3OC 4QJ3B 3I75A 5E94B 4GW4B 4RE6A 1TMCB 1M2VA 2XETA 3QB7C 2Y72A 1ZLSH 3UBFA 2CSPA 4MQ7B 4NBZB 1SJHA 4NXSA 3RVXC 3UDWA 4JKKA 5JPMC 2WUCH 1GJIA 2HRGA 5IJCC 1ZLDA 4RFEA 2LT9A 1A4JB 1KB9K 3AS3A 4M7JH 5B4MD 2FO4B 2CBOA 2R2HB 1T21A 1E7VA 4Y4HC 5L8KB 3RGVD 4AIEA 2I60H 3KGSA 3TH4T 4X80H 1OF0A 1I9RL 3EBAA 1QYGL 4QOKD 2AJZA 3CMOL 1F6FB 4HT1L 2F74B 4JHWH 4MJ5A 3HUJF 2VDOA 4CMMB 3FUIA 2OJEA 3ZYJA 4AEIL 2DLHA 3ABGA 3S3CB 3HI1A 3B7SA 3VFMA 4R6UA 3WNJA 4KXZH 3TXAA 4E54A 3VXUB 1CFVL 1HHJB 4MNHA 3RIAF 2XKNB 3K46A 4C57C 3QUZA 2WIIA 4DUXA 4HFWA 2XA3A 1UKSA 3BPLC 3HNSH 5I0DA 1JRHL 3KYMA 1ZD6A 4FQ2L 5HGHA 4WWKB 5SWZD 3NTCL 4OV6F 4IGBC 2N1KA 5I0WA 1X5XA 2YPKA 1PU0A 4JO3H 1NMCB 2RH0A 4YBQD 1G9HA 2H2SD 3HRZC 2VLRD 1TQCC 3TYGL 1CFTA 2WNGA 5EUOA 4DPAX 3IXTB 1TZGL 1JJUA 3P30H 5B1BB 1K8DA 1LEKA 4HH9B 4YDKH 1IBFA 2CGZA 4YUEL 4U3XA 2VLJB 1TVDA 2CCWA 1OAJA 2PETA 3MXWL 4LL4A 3WNNA 3D51A 3TT3L 3NIFB 1CXFA 1ED3B 2X9YA 4PB0H 4BFKA 2PM9B 2UX7A 1UWGL 2BERA 2Q8BL 5AB1A 5LBSA 4Z78B 3ZGHA 2UWEB 4JPKH 2CLZB 5BMFL 2X3BA 3QWQB 5DK2A 3DO7A 3INOA 1N5AA 1QNZH 1P5UB 1RU9L 2VW6A 5DC9B 2E56A 1Q9LA 3DPBA 3PWPD 4PBDA 3ZHLA 2ZZUT 5BVPL 3AZUA 4LCUB 1C5BL 3D4CA 3TASA 4WFGD 3W1ZA 2FYYA 1H2YA 3RL2A 2EC9T 5DVOA 4DKFL 2CHNA 3EG9B 2C26A 4HEPG 1Y0LA 1WZ1H 1C1EL 4L5FE 2AJSH 3NCCB 1U8CB 4Q2ZB 1T5XA 1RXLA 2VDRB 3B5GA 4O2FB 5B3JF 2ZSVB 2FX8H 1AOHA 4LMQI 5I1LA 1D5XA 1BZ7B 3DRQB 4FQXB 1RUMH 3QA3A 1T1ZB 2KLTA 3BZ5A 5JHDB 2BOBA 4AOWA 5GS0C 1RPKA 4BM7A 2V2TB 4H20H 5SV3A 1R0AH 3FQXB 4WRLA 1C9IA 3T65A 2N59A 4AH2A 4NQQA 4ZXBB 3VGAB 43CAB 4BRVA 3ZKNC 4GQ1A 2ZCZA 1NANI 5EUOB 1A6TA 4ONGH 4I1RA 3QW9A 4LASH 2NY7H 2BSTB 2ZX8A 3SQOL 4AQ1A 1INEH 1ZK9A 2AEOA 4OU3A 4L1BA 2CJTA 3S4SG 5AW5B 1INQB 1HE8A 3TVMD 4WCYL 2Y9RT 5KYXA 3ULUH 4R26H 3P73B 3NIGB 3GSVB 3WL9B 1D6EB 2OL3A 2YKLH 3RLSA 2W0FB 4RGNC 2ZAGA 1RUPH 1CTMA 3VXMB 4AIZA 4AZ8B 2PO6D 3Q5TA 1F2QA 5FEBA 2AXJA 3CBRA 4FNUA 3U0WL 2HG5B 2EH8L 4HFUL 2OJZH 4NAAA 3SODB 5CZRA 1FFPA 3H4FA 4P9ML 1AFVH 3O9WD 5EC2A 4AQ8A 4LCUA 4HULB 1M57B 2GCYA 4NOFA 4JKPH 1W15A 2DMKA 1X9QA 3C09C 3BQUD 1DJGA 3FHQA 3UX9B 3LPOA 3QCTL 1EAQA 3UTQB 4JKMA 1E3FA 3HBZA 5T5NF 3R8QA 3IJYA 4NM4L 3H53A 3NQIA 5DI8B 2EXTA 4HQQH 2AGZA 4PUBH 1GGCL 5D9SB 2XYCA 3V9FA 3QE5A 3DURA 8CGTA 3RWFA 4JS7A 2JSFA 1SLXA 1K5NB 1J05A 1DFXA 3N41F 4ODSL 2H6KA 3MRFA 2YWYA 1Q1JH 4UINL 2E46A 3DBXA 4YXKL 3TFBA 2H6PB 4ONFL 3LNIA 3FSWA 5DS1A 1JPSL 1IEAA 4BKLA 5KS9A 5CP3H 1EXUB 1FC2D 4BZ2A 4L1TA 2VR7A 5D2NB 1PZUB 5FDYA 1G9MC 4HISA 3IUQA 3PGCB 3KWWA 5D4IA 1IAKA 3PFUA 2NY6D 4RWYL 3M1BA 3IB4A 4KXAA 3V4PL 2P42B 2Y1ZA 3ATAA 2EIMB 4L23A 2BMKA 3T8XB 5LKNA 4MLIA 5FO7A 5AKVA 4PRDB 2YBAA 4QT5A 1K6QL 2X4SA 3QDGE 1JIBA 4JFFB 3SGKA 5LGJB 1BEYL 3PWVA 3WGVB 4J4PC 1TTUA 5CKAA 5HD8C 4FA1D 3P0YL 4OQTL 4C56A 1IBHA 2CD0A 3LKOA 3QQ4A 4ZAKA 2DQDH 2H3NA 3BSZL 4HJGA 3U7YL 1XB8A 5AQ0A 4AVJA 3LPFA 4J23A 3NCMA 4A39A 3GK8L 4HKZB 3NH7L 3Q13A 2XWTB 2YEZB 4HS6B 4MAYD 4OKDA 2HX7A 2ZXGA 3TEZA 2Q86B 3EDEA 5INCA 3LSOA 3UYOD 5L2KE 3B43A 4OCXL 4CC9A 1EFXB 4OI9A 3FOMA 1YQ2A 1OSPL 2K78A 4DW2L 2F19L 5H8DA 5SWSE 4AQOA 1RK0A 2X05A 2ZE0A 2JKLA 2QSQA 2VDML 3RGVA 1R3IL 1NGYA 2AV1A 2NZ9C 3OHXA 4Z7QB 4RMBA 3T77A 1HYSD 4J5VA 1H3GA 1TQBC 2ZXAA 4BWWA 4X98B 4OZIA 5HDBF 3VXME 2X5PA 3SE4C 2V5RA 2WY3B 2NNXA 3OZ9H 4S1RH 5GISH 5ICYB 1JMXB 2WQSA 3KBHE 3GZKA 2W0KA 4YIQA 3U2IA 4JN1L 5EEWA 5IIEA 3NPSB 4J8RB 1IAOA 1QSEE 5T8IA 1A47A 4AV5A 4OGAD 4OLVL 4ZZFA 5CD3B 2DPKA 3KG5A 2HN7A 5A16B 3CFSB 1KJMA 1P4BL 1YN6B 2XN9E 3B7FA 1LO2H 1Q72H 3ZBMA 1K85A 3JB9L 1A14H 3QDAA 4H2CA 3D7PA 3EWEA 2OJYA 3BZFB 3NIFF 4NHCH 4AOFA 1KYOJ 4UT9L 5LQBL 1PKQA 3HAEG 3M86A 4EI5C 4X7TB 1IL1A 1TIUA 3QUGA 3VI4F 1I1FB 3FQWA 3RUGA 1EEUA 1BVZA 1J9QA 5IY5B 1FRGH 3BGFB 2XDHA 5EV7A 3WJJA 2VXSH 1W0VB 2WD0A 3ZHFA 3RFHA 2ZUVA 2WXFA 3SE4A 5ICZB 1MHEB 4Y5YB 5DHVH 1UA6L 4Q6IC 3SEPA 5JHBA 5EDXA 5MI0B 1OT1A 3V4PB 5AB0A 1BMWA 3V6OC 2P8LA 5D8JL 5KSBE 3P4NA 2EYRA 2IDQA 3U4AA 4A2GA 1MCIA 4Y9BA 2FH8A 5BQ7B 4ELKA 4D2NA 1NBQA 4B41A 3IDGB 4K3JL 2WKGA 1TPXB 3N1MC 5DWUH 5ANME 5BXFB 3CFMA 2F0CA 3LZOA 4JRYD 1BLIA 4MCYB 3K71B 3PU7A 3VSUA 2CG9X 4JE4B 1I7TB 3LZFH 4G9FD 1EO8H 2CUAA 2VGLM 3GSUA 3FQRA 3VX0A 5EEYA 3RE0A 4KVNH 2AQQA 4F91B 2ICES 4Q8BA 4EDXA 3C6SB 4WKZB 3S4SA 4BH7B 2N4IA 5HDBA 1T3FB 3RGHA 1COBA 4AJVA 5H37G 3UBXB 4LSVH 2DJ4A 2HRPH 4ZOZA 4ODUA 4PJBE 5JIHA 4L9LA 5F3HA 4QXVA 1NUGA 3MV8E 1FFOB 4DQOL 1Q0EA 2Y7NA 4IS6B 3D18B 3I6LE 3VB8A 1KBPA 1DVTA 1E9PA 2J6EH 1CLYL 4DK6A 1SXZA 2VR5A 4KNQA 2X1QA 5GSAA 4YWGH 2BVEA 1EIBA 2ZXCA 3T1FB 3VCLA 5I30H 3K2UH 3BZEA 5IJVA 4X60B 1YEWA 2OQJA 3ALXA 4OIFA 4KTEH 4APXB 3U48A 5IHLB 3JRPA 3WN5B 1IUZA 4X6CB 4WHYG 3IJ1A 3CN3A 4OKVA 3RKDD 2D0FA 3Q2LA 3AADB 4G42B 3PABA 3KPMA 3TF7C 4BWTA 3BVUA 3UBXG 1BFOB 2XFXA 4JB9H 3BAEH 4LLMB 1N59B 1I1YB 3AC0A 3VSTA 4C83A 1A7BA 4K3EL 3RAJH 2BZDA 5IHUL 5KSBF 1OOAA 3B6SB 4JFQA 2CN3A 4K23L 3W39A 2OI9B 4XPAL 3SJLD 2UXVA 4C47A 4EWRA 2ATKA 3ASNB 2ARJB 4QRFA 4UB0L 1UTDA 3OC5A 3GYRA 1JXFA 1WUNT 4JRFA 4UAOC 1FV1A 1FH5L 4LBEB 1KTKE 1NBCA 1TOXA 3MLWH 4KMTL 4X5RA 1GGTA 5TFSH 3IUNA 1NLDH 1KLFB 1HXKA 2F54B 3VFSB 1BVKB 1YG9A 4ZUVA 4CSTA 5MEND 2UVFA 3SJVD 1UD8A 2ZUQC 1ZVSA 4MCYA 3NSFA 4P2RD 5JW3H 1J1OH 4KV5F 4S0TD 3KW8A 5TQ2H 4P3CH 5IFAL 2HTLD 5IHBA 4N2DA 2W18A 3IKOA 5I24A 1CK0L 1WWCA 3I85A 2HKRA 3FH5A 3DMMC 2X2HA 5I6XB 2D73A 4Q52A 5CMAB 1JPTL 1OCWL 2X4RA 3SBQA 4F2EA 2Z1PA 1DN2A 5IMOB 2NY1D 5GRJL 2VDOL 3JV4B 3PWNA 2GSIA 3NRPA 4ZFGH 1XWVA 4KVCL 3VXSB 1N68A 3LH2H 3CU1A 4AKOA 1K8IB 2BNQD 2PW1B 4TUJB 2VDLB 4JM2D 4NZJA 1EJ8A 3HN8A 4ODHH 4WNJA 4KMLB 4U2ZA 1AHWC 4GNKB 5I0YA 1WHPA 5GJSL 4BZ1H 3VXTA 3LQAC 4XVUC 5HP5A 3ZKXB 1T6WA 2XV3A 4MQ7A 3FQYA 3GLEA 4Y19D 2Y5TA 3V4PH 1MNUL 3DOSA 5HHXL 4JHAL 4HWBL 1AG6A 5FECB 3I6LD 4GW4A 1ZRUA 4X9IA 4ANUA 4R4FH 4WTZA 1WBXA 3EYOA 3P3SA 3SPHA 5C0FA 5E2UL 5HQGA 1YLBB 2L7QA 5K1VA 3EGDA 3RA7H 4PTUA 1SOSA 1NL0L 2MSPA 1FN4A 2J6WA 4XP9H 4EIGB 4LSRH 4R83A 3D39B 3RDTC 5IB1A 3BKCL 2COVD 5E6RB 1J0YA 1JMXA 1ICTA 1QFWL 5JORA 5LGYA 5ICXB 3ZTNH 1LO5B 3QZPA 3SE6A 2XN1A 3S2CA 1ZXQA 2V7NA 5JOFB 1OSPH 2IAMB 3JPXA 1MFAL 3MRHB 3R4DA 4JHWL 4JY4B 4U6XA 5DO2C 3CHPA 2QLVB 2K6ZA 2ZNXA 3NCEB 3O3EB 4YXLL 3KL0A 5AW3B 1HZHL 1FL5B 1UM6H 1F6LL 3BW9B 5C0DA 4MAYB 4AGPA 3BISA 1ZV2A 5ITFA 1E5AA 4DFHA 4J77A 2A4EA 1DVQA 4DWHA 2ADFL 5GGUB 1N4XH 4JY6A 2JJWA 3PWJB 5BO1L 5HVHC 1UB5B 1OCOB 4J3BA 2WXKA 2ADGA 2Q7YA 3RN1D 1GSKA 4BH8B 1BQUA 1KENH 2I7SA 3E8UL 1FNGA 4WFFE 3BQVA 2D9CA 2VZSA 1U8MB 3FB8A 4Q74A 4RAVB 2VDQL 1LGVA 1JZFA 2P8PA 4ZOCA 3ZYIA 4H5JA 1TUPA 2IAMC 5ICXA 1F41A 4JD2C 4I9WE 5LQBH 4D9RE 2JI1A 4N6RB 4YHMH 1A4BA 1NQBA 1CG9A 1P5VB 4W9JC 4AYID 4DP8X 4K07A 1JDDA 2O4EA 4R7AB 2VR6A 4JPWH 4PJDA 4F37F 3A0FA 4RA0C 1SQJA 2B9AA 3NMEA 3FCTB 2CXKA 4HSCX 2UYLA 4E2OA 1E8YA 4EVNA 4Z5RB 4P2CG 3WLWD 1IEAB 1TFPA 3I7LA 4W93A 3SY6A 3HNVL 3EH5B 4PRAA 5D7IB 2DI8A 5HI4D 3SIKA 2EP6A 4JG0H 3TO4C 5IMMA 2CPUA 5E5MA 1PGRB 1PX8A 5DYFA 4A1RA 4LNRA 1F42A 2EO9A 3NJLA 3BP7B 2M2DA 5SWSD 5E08H 1T7WA 3A24A 1E4HA 1JK9A 3DV4A 4LSPL 3CHXA 4CADB 1VACB 4HEPA 2BY3A 3BVWA 1YEJH 1CFNA 2EO7A 5SX4H 5J5EA 2JTDA 4LPVA 3PWUB 3CU7A 3FXIC 5DWUL 5FF6A 4XO8A 1S7QA 1OHZA 5HE3B 3GXIA 1XCTA 2MNUA 1P7QB 1FVDB 4JT6C 3V6FB 1TJHL 1XR9A 1FBIL 4NGHL 2MPAH 2KERA 3CVBA 1TLMA 5FKRA 2OA9A 5KYUB 3CPLB 4YGAB 2OBGA 3JTTB 2NCEA 4GO9A 4EUPH 4MD0B 4FADA 1J5DA 3L7FA 4D6VA 2VISA 2ZXWB 4R96A 1RK7A 5TDNB 4OLUL 5HGAA 4FI7A 3L7EB 3NP4A 2ORBH 1I1CA 1HK6A 2UZYB