3V4PA

Crystal structure of a4b7 headpiece complexed with fab act-1
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
587
structure length
582
Chain Sequence
YNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLVGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHSTEEFPPLQPILQQKKEKDIMKKTINFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-4
publication title Structural specializations of a4b7, an Integrin that Mediates Rolling Adhesion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 131
structure length 582
sequence length 587
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3v4pA02
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3v4pA01
3K72A 3V4VA 2VC2A 4G1MA 4UM9A 3ZE0A 1M1XA 4IRZA 4MMYA 4WK4A 5FFGA 4O02A 3T3PA 3K71A 2VDNA 3VI4A 3NIFA 5E6SA 3ZDXA 4Z7OA 4MMXA 1TYEA 2VDKA 1JV2A 2VDPA 3NIDA 4UM8A 4WK2A 1U8CA 1L5GA 3ZDZA 3FCSA 5HDBA 4Z7QA 2VDQA 5E6UA 4Z7NA 5E6RA 3K6SA 4WJKA 3IJEA 3V4PA 4WK0A 2VDOA 3NIGA 3ZE2A 4MMZA 2VDMA 5FFOA 3VI3A 2VDLA 4G1EA 4NENA 3ZE1A 3ZDYA 3FCUA 2VDRA 3T3MA
chains in the Genus database with same CATH superfamily
4XVOA 3F64A 3MV01 4WIQA 4AE1A 1MWOA 1T4KA 1AHWA 5HDWA 4LOVA 2E74C 4KUCD 3S6CA 3AQXA 4JFDE 4XCFH 5DEGB 2I9LA 3CJJA 3MOBL 1SYVA 1UQSB 1ZDSA 4GAJL 4H4NA 4JHAL 3SN6N 5KYWB 1BF8A 3BAEL 4FQ2H 5CEZL 5T5FH 4HS8H 2CMRH 5K59E 3RWGA 3Q1SH 1JPTL 4AOWA 1OP4A 3OKMB 1MUJB 2WXMA 2P48B 4LEOB 2WZAA 5IEKB 2I60H 3E1ZA 4G56B 1F90L 3BG1A 3ULUF 4RLDA 5JOFB 1COBA 1NLDH 4NO0B 1FSKC 2C1PA 4MA8H 3QO1A 1TF4A 3VG0H 2WVUA 3NABL 1INEL 1M56B 1VB9A 2EADA 2YKLH 3LZRA 4PLOB 1NEUA 4O51A 3RLMD 3V4VL 3ATBA 3MHZA 3DKHA 1N9PA 4WKZB 1KYUA 4DO5A 5J9PB 2BDNH 4WEMB 2PO6D 4WNQA 1UM4L 2VYRE 5F1IB 5BUPA 4I0PA 2YRLA 1IM3B 4BKLA 3K26A 3KPOB 4EDWL 3ORVD 4Z7VA 1MVFA 4KRNA 3NCCB 4S1SH 4DH2A 4D94A 1LD9B 2VLLA 2WXOA 5DYOA 5AWNL 1M2VB 2AMGA 3DO7A 4BSVB 4JPKL 1N6DA 2J6EA 2DLTA 2WAHA 2WLHA 4CNIA 5GMKn 2XXGA 4GRLA 4NZUH 4BBWA 1HCYA 1CBVL 4FYTA 4PJ6A 5F96L 1L0PA 5KJ4A 3RWHA 3RX8A 1FNEA 5TDPB 5CEZD 6FABL 1QP1A 3D3VD 3I7HA 5IJKA 4LLUA 2IF7A 1YEIH 3ENEA 3U4EA 1DSFH 3ZE0B 2C7FA 4MS6A 2NUTA 1BEYH 1ONQB 5CIPB 1OEZW 1DQDH 5C0CD 1WBZB 2P5EE 4ZX4A 3L4TA 4Y9GA 2DQUH 1HZLA 4J78A 1P2CA 3P69A 5CLTA 3NJKA 1RFDL 3QIUA 5SWSD 2YA0A 3OHXA 4QIRA 2PP8A 5EN3A 5EOTA 1EK3A 2B5IB 1OCZB 2AJZB 3PXHA 1CVRA 3AFCA 2GJJA 3BWUC 2WWNA 5EC2B 1OL0A 4WDIA 5KS9A 4PQXA 5FWRA 1EO8H 4G6AC 4B9PA 2VDPH 5C2BH 3EI3B 2G3NA 4GUOA 1I8LA 1KTCA 4HJTA 5F1KC 1S7XA 2FJFA 2X0UA 3MBEA 5JIQA 1N0XH 1H2WA 2PN5A 3RSEC 4B9JA 1BVNP 3IXTA 5AVZB 1AH1A 5IG7A 1JZJA 2R4SH 5MENE 3UEZA 4F7CA 1JYNA 4QAMA 2R2CA 4P5TC 3LKPB 4XZ4A 4B3VA 5T1MB 4JE4B 3FBKA 4NQEE 4X98B 3AL8B 5F9JB 1TDQA 4XVUC 3GSQB 1NDTA 1NCTA 4APQC 3AREB 2N4IA 3CVHH 4FJZA 5T3XE 1R34A 3H3KA 4V2CB 3WTVA 4R5TA 4KQ3L 1HIMH 3CX2A 4JM2C 5LCVL 3EYOA 4W9IC 1DEEB 3QIWA 4F7PB 3IJ7A 4MB3A 5EO1B 1A47A 1TITA 1AD9A 1P6AB 1P7QB 1RQ5A 4FFVD 1LXMA 4WHTA 4FNQA 3AGWA 4FKHA 5AVTB 5JIPA 2OMWB 2Q5BA 1JV5B 3S3SA 2V2TB 2ARJB 2M8XA 2B59B 2Q7AA 1K3ZA 1YMMB 2VL4A 2L3BA 1BFSA 2C1OB 4QHLA 3HS8A 4L3CA 3MFFA 4BZYA 1ET5A 3ABGA 1IRAY 1SJMA 1F6AB 5E5MB 3AXLA 4U6VH 4ZOEA 5EMYA 3MLVH 1V3LA 5ICXA 1KIUB 3S8WA 4OKVA 2PABA 4GQBB 3QUXB 5ABDE 1E28B 2WB7A 2Y5TA 4LB8A 4OF7A 4H8HA 4AUJA 3TJHC 5B3JF 3UZEA 1F11A 5DZ9A 5DJ2B 5FGRA 2Q3ZA 3LV3B 1Q94A 2Z3FA 1DCLA 4HUVA 3HHMA 4OM1L 5E5UB 3KWXA 1WHOA 4NO5B 4WHYH 3VRLF 1T1WA 3DX4A 4NQEB 1VADA 4U0RC 5LBVA 3VE0B 3ZDYE 7PAZA 3UTTB 3CDGA 3NG5A 1KV7A 5BO1L 3MLRH 3QFGA 5LGJB 1QSZA 2BW5A 2EACA 4RZCB 5EUOE 1CQKA 4NPYB 1HE7A 3F62A 3FQUB 1DVYA 5ID1B 1HNGA 5I17B 2E7LA 1WFNA 2QGCA 1I9JH 4G8GB 1SRDA 4J4PC 1T2XA 4L1TA 1KJ2H 3VD5A 3VSVA 4OQTH 2WKLA 3CX5K 1URZA 5JQ6L 3BWAB 4KI1A 3ARDB 4ZTPH 1JPEA 4PP2A 2JB5L 2H9GB 3CFDB 4X6CE 3EO0A 5FYJL 5I82A 4QRPA 4FI6A 2R23B 3V5DB 5ALCL 2QR5A 4F7MA 1NGXA 1OF2B 4Z7QF 3EI1A 3DK0A 3CPLA 4RMUA 2J6EL 3ULVC 3PAYA 1AS8A 1DJYA 1OTTC 2DQIL 4JJOA 5E9DE 1A3RH 3Q1EA 4QT5B 4ZQTA 5CGMA 3HHSA 4MXVE 1CC3A 3O6LL 4Y4FA 2M26A 3EGXB 3X2QB 4FFYH 3CX5J 3FXIC 4CJ1A 3BP5A 1OSPL 1U8OB 4LPVA 2VDNB 1OOWA 3ARDC 2F9BT 2DYPB 4N2HA 5ESVA 4Z8LA 2H13A 4AQZA 2ZX5A 5JO5A 4YXHL 1UJ3B 5DZAA 1CD1B 4OJAA 4PBZA 1F3RB 3MNVB 4JFDD 1XR9A 2VLJE 4G6AD 4U1SB 1MEXH 1QLEB 4WU5A 4N8VB 2NLJA 1NINA 2Z31D 2AJSL 4MJ5B 3BCFA 5HGBB 2DLIA 3GMMA 2EDOA 1DTUA 1QSFD 1YN7A 4XAKE 3QWQB 4KROB 5EUOB 5LXGL 2E6QA 2JJTC 5DURB 1L7IH 3ORJA 4ORGA 2PR9A 5E2UH 4X80L 3WXWH 4FG6D 2EXSA 2CLZB 2IQ9L 2XXMB 4P5TD 4PVLA 3UAFA 4OM0L 2WN2A 4RAVB 1QD0A 4QXUH 1ZJAA 4X9BA 5FDYA 2HFEB 2H7WA 1BWMA 3D2UA 2GJZB 3P0VH 1QEWB 2OP4L 3KJ4C 3QUHA 1R3IL 1TZHB 3VXME 3LN9A 3EG9A 4O9HH 4N85A 2FTAA 4HIEB 3HG5A 4PR5A 3BPCA 1E3XA 3ATDA 4RIRB 5K39A 2WZPD 3IAGC 2WTRA 1DLFL 3P4MB 1I9IH 4JFZL 3MTRA 3GT6A 2H3NA 4ZOBA 5C07E 3REVB 4EI6B 2D8KA 5IBUG 1AJ7L 3RUGE 5IW1A 3VXOB 1KCVL 2FGWL 4K23L 2HKHH 4M43L 1JZ4A 3UJJL 4BL0A 1EAPA 1L7TL 1UD6A 2X7LB 3UABA 4BQCA 3QXDB 5EORH 2Y4SA 2BVPB 2Q76B 1AXTH 2IDTA 5TFSL 4QRTA 3SE9H 5GRXG 3SJVA 4GUPA 1TMQA 1M9SA 4DP7X 2V3FA 4FMFA 4OLXH 1E3ZA 2PM7B 2VW7A 2VC2A 1E7UA 1NBQA 1H3PH 3OC5A 5HJ3B 2MNWA 2VLJB 5D1XC 3ECVA 1E9QA 1S7WA 3TESA 5LBSH 3O4GA 3OKYA 5INDB 1T5KA 4I5BB 4Z8FH 3I6GA 2DQDL 3D6GA 1KLUB 3HE6A 3TJHD 3W0WA 1BWWA 1MN4A 4X4KA 2VR8A 3K0YA 2BKLA 1CXKA 2P5ED 3TCLB 2P9SC 2CUAA 4IBSA 4CVUA 1EZLA 2YPVA 3ARXA 5AKTA 5GXHA 4WK2B 3QZWB 3IT8D 3NEOA 3SQOL 3TA3A 4FEIA 3QJHA 8CGTA 4RQQB 2XRAH 2VN3A 3KG5A 1FHGA 4AYEC 1J1XH 4Z77B 5GRUH 5KVFH 3WUWG 1MDAA 2F5BL 1A14L 2Z92B 3MREA 5EUKA 4XC1H 5IESH 2X6AA 4ELMB 4GIAA 4J4PD 4KQ4L 1CMOA 4AK2A 4QDGA 1A66A 5LQBL 3OXSB 3EOBB 2DQCL 3INUH 1DVFC 5C07B 3V0FA 1U3JA 3ALPA 4LVNC 5FYLE 5MEND 4LU5L 2L7UA 3SDCB 1BX2A 4U1MB 1IGCH 2EVHA 3HE7C 5EM2A 3GUTA 1MFMA 4G5ZL 2JJVA 3SCYA 5EIIG 1O6GA 1O75A 4IBLT 2UWEF 4X42A 3ULVD 2OVQB 1OTTD 3O9WB 4WJKB 5IMLA 1FWXA 4HPOH 5T3XD 4G9FE 2Z2PA 4PV9A 4K9EC 1JGLH 4IRZA 4RH4A 1JZ2A 4K3JB 4TLTA 5JOPE 4Y9CA 4F7TA 2Q7YB 5HYSB 4WEEA 2FEEI 4CGUB 1QBMH 3F84A 4JM4L 2AJXL 4OUOA 3RTQB 4KMTL 5F7LB 1A4JB 2VIRB 4TNVK 1YEFH 2HLAB 3ABLB 2GK2A 3C5ZB 4TVSa 1VLXA 1BG1A 1F4AA 3IJHB 2YN3A 2ZSWB 3DSFL 3EBAA 4KVCL 1FO0A 1LTXA 1OAKH 5A40E 1S3KL 1BW8A 1IBGL 1EAJA 5EA0H 3QJXA 3EJJX 3N04A 3O4IA 3B8YA 4H1LB 5K9OB 5LGHL 4O5LH 1IBYA 3PIQB 4FQLL 5EBGA 4TOYH 5I1AB 4H5JA 2X70A 1I4FB 3N55A 2BSCA 4EUPH 2VERA 3DX6A 3K71A 3LDBC 3PGFL 2JXMA 4AGOA 4LG9A 5SWQB 4Y4HC 3H85A 4XNYH 1X3DA 2XSKA 3MRCA 1DO6A 4G42B 4XMTA 4K55A 2YMXL 4J81A 2OMUB 1M7IA 3QP3A 1QATA 3KPMA 3KPNA 4JCMA 5FM4A 2WV3A 2V37A 3NIGA 3QAQA 2AGLA 3FRPA 1KB5H 2OMTA 3E3QE 2DQMA 4LEEA 1JF1A 3CFCH 4HCGA 1HHIA 2ICES 3WFBH 4QCIA 2FB4H 4HH9B 4EF3A 3F5WB 1CU4L 1ADQH 1IT9L 2A6KA 4WK4A 1E8YA 3EJTA 4CY2A 4LOEA 4OCXH 2A4ZA 3ESOA 3O6FC 5IJBC 3CH1B 4OZIF 2BSRB 3GK8H 3MZKA 4CADA 1I3RB 2E7CA 1KTLA 3N3EA 1J11A 2RHEA 2Y36L 4J12A 4DPRA 1JZHA 2VLKA 3HMXA 3WUWA 1CE6B 1TNNA 2CKBH 2EYTB 2N0KA 2ZNWA 4XN4A 3RRQA 1J86A 1MHHB 3UVNA 2FJHA 3CVCA 3PL6B 3DURB 2IOMA 4MMZC 4BHUA 5E9DD 4KTDH 4JMXA 5D1XD 1JRHH 4LCWA 1IBFA 1K2DB 4XHJD 3O0LA 1Q9KA 3KL3A 1MAML 4TUKL 1CL7L 3ZW3A 3NCEB 4GKNA 1EMTL 2VC2L 3GZQA 3LZQA 5IJCC 1FUNA 3IAPA 4HIQA 2ZOUA 3GXFA 3MOQA 5EIIA 4YDVB 1FAIL 1MREH 4L3EE 2OL3H 4RSYA 2AQPA 3GXTA 4AJYV 3KPQA 4ZNEA 3L3IA 1F86A 3U9PH 3TF4A 1E4XI 2DQGL 1DQVA 1HH9B 4AY0A 2P3YA 3PL6C 2YPVL 1UTCA 2XZQH 1UOQA 1I7TB 3OMZA 4JEGB 3STZA 4DKEL 4BH6A 1ASOA 4JHBA 3RA7H 5G4OA 4CMMB 3UAEA 2GABA 1X9UA 3SJLD 3S37X 4YIQB 3GZPA 3T0BA 3WFDH 2XA3A 3RPBA 1QLRA 2ARWA 1FVCB 3OZ9H 1JHTA 5KOVC 1KBGL 2VH5L 2EYRB 1DVFD 2L7JA 3CFEB 3P11L 1MJ7H 4YUEL 3WUZA 2JVUA 2X6BA 1F00I 4GJTB 4O2EB 1DUZA 2MOVA 1UVQB 1NMBH 3BEWB 3E0GA 4PJAB 5AB2A 3KH4A 4WFGE 1BM7A 1TZGH 3KXFD 5FXCH 3VRJB 4RMTA 3D52A 3D33A 4KKPA 4N2FA 1JNLH 1FGNL 1KXTA 4EOWL 1CUOA 3TU6A 3E3QC 4TUUA 1LDPL 3VXMD 3FCBA 4ZO7A 4HUXB 1Q72L 1UG9A 2CNXA 1U42A 2OMVA 3AQDA 4NKDA 3GHPA 4GFTB 3CSPA 4GW5A 4XNZB 1HT6A 4JN2B 4QTFA 1GW6A 1E3FA 4I3GA 1V3JA 4IRZL 1KYDA 5KN5A 2HP4A 2Z4QA 3TTYA 2DY2A 2OM5A 4L1MA 4X7FC 2NXZB 4M5SA 1TFPA 4IYKA 4NNXB 4RBPH 1PLAA 4JFPA 2AV7A 4PTUA 1BLNA 4A2DA 1JD7A 5FUCE 2XVBA 4UV4H 1KTDA 4JREB 4GP4B 1FO0L 5FCSH 3WJJA 2DQ6A 1S7TA 4KKRA 3U48A 2J56A 4PSRA 3UX9B 3Q6GH 4Y4HD 1EUTA 1ZT1B 3WGUB 1UD4A 2AC0A 1KCLA 3MO1A 5IC7A 1F56A 1H5BA 2VQ1B 2YPLB 5D8JH 2AQ5A 1X5JA 3KPPB 3UO8B 2V33A 3ZYOA 5H4ZA 4G6JL 1CYGA 4PJEB 1T1YB 5TE4H 4WSJA 4LDOB 4RWYH 3BN9C 4Q9CA 1FG2A 3ES6B 3PQYA 1VGKA 2R2EB 4WRLA 4HGWA 1JNHA 4QKTA 5I6XC 3OHMB 3OTTA 4H8UA 4F37F 3OQRA 4Y5XB 1MCFA 3VJ6B 4BCYA 3IK2A 5CXCA 3L3KA 1V54B 2G9HA 2QDWA 2NSXA 4Z5RB 3SDDC 2W18A 1KBPA 2OS7A 1LEIA 2K9FB 3FQWB 4JFWA 3GM0A 3IJYA 3AY2A 2HKFL 3J27A 1MVUA 5CHNB 4QUOA 2W9EH 1CYWA 3CFQA 1FV1A 3IDGB 1YEHH 5A2KH 2CO4A 5EOQL 2BXZA 2Z6FA 4IGBC 5IBTL 4W68A 3HMXL 2HLFC 3MV7A 4ERYA 3BT0A 4FTVB 4D9LH 4DIXA 5I16A 3DPDA 5GGVL 3GBLA 2A74A 1BAGA 2FX8H 4UI9R 3BEVA 3DIFA 3RPIB 3H6AA 5AYTA 3TWYA 3KLAA 4FYSA 1LE5A 2QADD 5LNDA 1NBVH 3HAEG 1HI6A 2H14A 5C9JB 2ADGB 2IBZY 4LHQB 4IRJA 4ZFZB 5LBGA 2DLFL 3MNMA 3OR7A 3ESPA 3MRDB 4MDRA 1H6TA 2J3SA 2YNOA 5FUCC 3AZUA 3QJFB 1UZ6E 4GXVH 2CNYA 2GBAA 2ITDB 3K91A 5GJTH 5HGDB 1OIOA 4MRCA 3JZYA 4PFEA 5TPWL 4Q9QL 3TOPA 4NKMB 1T0NB 3BH9A 2F53E 2KL6A 1TYRA 3PDDA 4OSUH 3OMIB 2ENSA 1BVLB 2Q6WA 2Y25A 2OBGA 3L3OB 3MLYL 4HU2A 4I48B 4LLVA 5IHLB 3TJEL 3MCLH 3ZKMC 3D0VA 3HCVB 4ZDHB 4XXDB 3GREA 3V9EA 4G7RB 4BXVA 3T1FA 1M3IA 1M6OB 3OVUB 2KLSA 3MRHB 3TLRA 1LEGA 4M1CC 1KFAH 3VD4A 4R96A 2VQ4A 2DI7A 1KCUH 4U4BA 4YDJA 4AVKA 3FUIA 2GQHA 5T3ZL 3DTXA 1NDGA 3SY0A 5IROC 4AMXA 1BECA 4QXGL 4WWKC 3I6LE 4GUCA 3QB7C 1KT2B 4J3OC 2YMUA 1J05A 5HYIA 1LVEA 1Q38A 2G60H 1ND0B 2BJML 3NCJL 1P0SE 2AF2A 4NENB 4JZJB 4RVBA 1EBPA 5EBMA 2DEWX 2CCVA 1MRFH 3DK2A 2WQWA 4MNQB 1SXBA 3HNSL 4FF9A 2C8NA 2G5BB 4YDIH 2EVFA 5A1AA 2W07B 2ZKWA 4JQVC 2EIKB 1RJLB 2VDOA 1RPKA 2G75A 3PWLB 3UPCA 5E03A 4FQPA 3VXRA 3WKMH 1RLWA 4GIOA 1AGBA 4GBXC 4F27A 1NBZA 2BNUA 1FFOA 3QR1A 4HHWA 3Q7JA 4Z23A 1HC1A 5IMMA 3GKZA 2HLEB 3H53A 4ZFQA 3T2NL 2DTML 2XX0A 4L3ED 4HJSA 5E9AA 4PJ7A 4M7KH 2WANA 2CUMA 2PW1A 2DMCA 3G5WA 3O2VL 4XBMA 3C75H 3MUY1 3JV6A 1KZYA 4S1QH 4KO7A 4DW2H 2ZUQB 3NZHH 4HLZH 2ADFL 3NQKA 1K6QL 3U4AA 5JORA 4JJHA 1X5XA 4OLZL 3P0YH 5JNYB 3S34L 2Y7OA 1EXGA 1WBXA 1DJHA 3BFQG 3EF7A 3HFQA 4XPBL 1F1AA 1I85C 1TJGH 2BPBA 3HAEA 3SDDD 1QLEH 2XU9A 2V3EA 2W5PA 4KKZA 4FABL 1CN4A 1U33A 2HJLB 4GW4A 4CGTA 5DHVA 2VITB 3WDHA 2ESVB 3I9AA 3T3MF 3NMEA 4W9JC 1G0XA 4IGBD 4FXKA 5HI5C 5GS2H 3MRLB 5AOJA 3PAVA 4K8RL 2V17H 2A9ML 3O45A 4M7LT 4LOUC 3APNA 1WF5A 5CP7A 2PCPA 5KTEH 1NGQH 1BBJB 2NNXA 4UT7H 4DK5A 1OB1A 2ZKHL 4B0MB 1PG7L 3D39D 3L9RB 3MR9B 3QAZB 4HKXA 4UTBH 4YO0B 5E6RB 1SYSB 3GC3B 4N90E 4LIQL 4LP5A 3BZ4A 1NC2D 3CLFH 4WEBH 2Z91A 4HXBL 3QWNA 2XUWA 2BSEA 5T1LD 3UO1H 2G3XA 4I9XA 2GBVA 2WUBL 5MEQB 5BS0E 5C0EB 1FL5A 5EEYA 2WCPA 1P84J 3RIFF 3W39A 3NPSC 1CI3M 1P6FA 4Z18A 5C92A 3ILPA 1QMUA 1X5AA 2C7UA 1H3TA 2P52A 3BDYL 3G5XA 4MJIA 4R3SB 4DP2X 1EJOL 5E1AB 4BQ8A 4J84A 4D9SA 2EC8A 5I1EH 1FGVH 3U0PB 2G4EA 4U1HA 3A5VA 4EQ3A 3S5ZA 3KBFA 5I15L 5KVMC 3AWGA 1JXKA 3U6XA 5LDUA 2HWZH 4M56A 5ICZA 3IFOA 1RJZA 2Z7ZA 5DS1A 5BV7L 3L17A 1MWAB 1WH0A 1N0LA 2UXFA 2HTLC 2YRBA 3L5WA 4UTAA 2BHYA 4ZO8A 1F4YL 4BK4A 5FKTA 4HDIB 4WJ5B 4XAWL 3ZTNH 2C26A 3QZBA 4QGTA 5CP3H 1GTFA 3ZPDA 5FKPA 5KSBB 2VAAA 2ZUSA 4PJXE 3A23A 1AVAA 1AD0A 4WWKD 7TAAA 1TKWB 3K2UH 4F57L 2JCCE 2XIBA 4D0BA 1XGYH 4LAQH 4ZX3A 3ZN6A 5MEOB 5EEXA 2B16A 2AGWA 3SSGA 2HH0H 2ZP9A 2FGZA 3HZ3A 3VH8A 3FTGA 1F45A 4LSPH 2H1LM 2EO9A 2ZOOA 1UH3A 1CR9L 1LO0L 4PJGA 5FGBA 5JYLA 2EICA 4HD9A 1ZT4A 2VLRA 5D7KD 3RNQB 3QJZA 3OAYK 2P8LA 2X4SA 5DS8A 3ARFA 5BS0B 3F3PA 4K71C 4IM8A 5EDSA 4P2RA 4FKEA 2ZXWB 1AXSB 1DBJL 1X5FA 2LLNA 1CF8H 2FUQA 2Y5EA 5FB8A 4CMHB 2VDOL 1GY2A 5FUZH 2QELA 2LU5A 3VU1A 1JJUB 5IMOB 2WQXA 1RZIB 4Y2DB 1ZHKB 4GM8A 1RURL 3FT0A 5SX4H 4PWGA 5B7FA 1IKOP 4FZ8H 3SQBB 1IGIH 1DDHB 2CLVB 3WFHB 2WINB 4R5XA 5AEAA 4S1DC 3FRUB 3LNFA 4R26L 3VB8A 4DP6X 2MPAH 4BH7B 1XAUA 2IEPA 5EU6A 1K8DB 4IU2B 3X13B 5TE7L 4Y2NA 3GNMH 3GEFA 3IFNH 1AQKH 5E5RB 4KX7A 4PJFE 5B4MC 5AYUH 2F53D 4N3TA 5ESQB 3UZQB 2JCCB 3FUMA 4Y2DC 2XG4A 3CGTA 4QHNB 4Z0XA 4M7LH 1DSWA 3WEOA 2XKNA 4OIIH 5D2NB 1JPFA 2VSKB 4NC1C 5G5DA 4ZFGL 5HSFA 4RFNB 1OGAA 2OJEB 3ZE2F 2PETA 3QISA 4L4VA 5EZIH 5I23A 5J13C 3S36X 4PWHA 2W59A 1AQDB 3VFOB 3ROOB 2F61A 2KT6A 3I50L 5HI5D 1JGVH 3VM5A 3G6DH 4B9CA 3N40P 3D7PA 4UANA 5DFAA 5FYLH 5M5RA 2Y6SC 3MPCA 4LCCB 4LOUD 5AZ2H 3E7JA 3T77A 2BNQD 5C08E 4AKPA 4DK3A 3VH0A 1Z9SA 5IFJB 1NANI 3RZCB 3I6LD 4M62L 1I53A 3E6FB 4PJIE 4L18A 3V2AR 1OCRB 1RHHA 3OF6A 3OMNB 4NSXA 4LDCA 2AGZA 1RZFL 3F7KA 2VDLB 4C4KO 2X4UA 4OD3L 1DN2A 1MCKA 1NSNH 1HL8A 2VRAA 4EDXA 3RTLA 5ES4B 1KSRA 4M00A 1BZQK 3UYPB 4DEPB 1M05A 1RK7A 1U3ZA 2X4QA 4AIOA 3MRJA 2E46A 2NTFA 3T0EE 4XGZB 2IXQA 4G7QB 4JUSA 5CSZB 4JG5A 2WPGA 3L3DA 2CDGA 3HC0A 3SCMC 1OALA 4P4KB 1RJYA 3NCYS 4JFXB 4L8BA 5C09A 1QBLL 3MNWB 1MCRA 4LHUB 1IIKA 3W3BA 4CW1A 4GPVA 3RGVB 1UA7A 2WBXA 5C8JB 4ISVB 4D3CH 4N2DA 1ICTA 3VWKA 1WITA 2J8OA 4CU8A 3SGEH 2YMTA 4PRDA 1WISA 1KN4H 1OP3H 4UTAL 4YHML 4JQIH 2A6JA 1RMFH 4A7TA 2R15A 1L0XA 3KPRE 5A6MA 5E8DH 1I8UA 1L5GB 4FA9D 1OMWB 1T1XA 3QR0A 4U6YB 2HJFA 2F7OA 4P23B 5BMFH 4WW1B 1KYAA 1MFCL 3PHOA 3CFBB 3ZDZF 3D34A 4X6EA 2VDRH 1Z5YD 4HKZA 1EHAA 3RGVC 2F58H 1R5WA 3FONB 4HUNB 3K46A 5FFGA 3PPSA 4K94L 5BJTB 4NM8H 1G7QA 4W4OA 3PCYA 1ACYL 1AGEB 2HA1A 2WZ5A 3GIZL 3UFIA 4C83A 4JKNA 4NWTL 1ZTMA 4R7LA 1CLCA 2WXNA 5J7CC 4M1GH 4I3SH 4KXZI 5D72L 2Z7YA 2CRMA 2WBJC 1FJ1A 3ASNB 1OE3A 1BJ1H 5D2LA 3T0EB 4G9DA 3NBNA 1ERJA 4ICXA 1X5IA 1ORSA 4YXLL 2EEAA 1DBAH 4P23C 2ZQKA 4NQDE 4N90D 3ZRFC 4DKFL 5F9WB 1I1FB 5DLMH 1AMXA 5DEFB 4PBXA 5EHFA 3B2UC 1Z9NA 4N6RB 5HHOE 1I8MA 1DJXA 3FQRA 2ED8A 1R9FA 5K9KA 4KUZH 2CXGA 3PHSA 3UP6A 4RE6A 4PN6A 1RIVH 3GI9L 2JTYA 2OZNA 3I02A 3SPCA 1MHCA 3CN0A 3HI6H 3UACA 1CD9B 5AW3B 2B5MA 1H15A 3T0EC 4FX5A 1YYLL 5B4MD 1M1SA 5CJQH 3KPRB 2HT3C 1KCSH 2IIJA 4MB1A 3LCYA 2GTZA 2GIYA 3LNDA 2EIBA 2W60A 3LS4H 2O5XL 2NW3A 4GRWF 3BUIA 3O2WH 4RX4D 1A65A 5LG1A 2X3BA 4PTTB 4DQOL 3S2CA 2Y6SD 1QLFB 3SKOA 1IBZA 1BBDL 2PKDA 1CT8A 2NDGA 2Z8VC 2QFPA 4GIPD 4M61B 3PPEA 3VCLB 2DYRB 3WU1A 2J6WA 2R4RL 3GM8A 4YHLH 3PWJB 3R0NA 5IW6A 3NJLA 3O41A 4YSEA 3J2PA 5J06A 1OAQL 2GITB 2FATL 3QPXH 3GJFK 1FA4A 2GCYA 4ZMNA 4NQDB 5GRZA 1XCQA 5HDBF 3FOMA 2KUTA 3FM0A 3CZJA 3WDJA 3AU1B 3VFVA 2K9UA 3I7KA 4GI8A 5T1DL 3JV4A 4PJHA 4ADIA 3GZOA 1K8IB 4NSKA 4R2GC 3D12B 3FO2B 3L3HA 5L6YH 4X7DC 2XQBL 2CRYA 2X05A 3FFCD 1RZKL 1U8QB 3HZVA 3SCMD 2DDQH 4Y9BA 4RISL 2JKSA 2CO1A 4Q6YA 4XBPB 3IRCA 5KBLA 2CPCA 1PAMA 3WEXA 3D18B 5ECJE 2OQJB 5EU4A 3L5XL 3WE6B 1CFQA 3U4YA 4IMMA 2B0SL 3EH3B 3NRPA 1SMAA 4PRAA 2EE6A 2NY1C 1DZBA 3Q6FB 5JHLA 4ENED 4QHMB 1BGXL 2IOOA 3HUJA 3QG7H 1JP5A 3ZDZA 5TDNA 5FA3B 1M2OA 1YMHB 1ZLDA 3HJEA 5JIMA 3GEWB 1A9EA 2MOQA 4BUQA 2H9LA 4ZS7H 1PGRB 1IGJB 1XB6A 5MP6L 5D7IA 4DVRH 4J3OH 2UUDH 3MLWL 3QUZB 1ZE3C 3TCTA 4G11A 4BUJC 4FFZA 3GBML 3KEHA 1YJDC 4EN3A 3BKYL 1J8HE 2IH3A 1UB6B 1JDCA 2K7PA 2SEBB 2W65A 2XPGA 2IANE 2XWTB 1EJ6A 1I1RA 4UDUB 2HT2C 4ZPVA 1UWGH 6TAAA 1ORQB 3WNKA 1S7RA 3A6BH 4YX2H 4P05A 1RCYA 1RIHH 5GJSH 3IYLW 1G7PA 5D7JA 4XPTL 3TNMA 1JHLL 2WBJD 4JHVA 3BIKB 4FZEL 1CFMA 1W8NA 3SWSD 1A6WL 4LSRH 5EEZA 1EVUA 2P8PA 2FYYA 3B2PA 3WY1A 1Z9MA 1EA9C 5E6IA 1AZRA 4A7JA 3DX3A 1EGJA 5AVWB 2YAPA 3B2UD 4C4KT 5JDSB 1DQJB 4AVHA 1E67A 1TJIL 5I1GH 4FOMA 1EZVX 1X5MA 3SKMB 3VYOA 2R51A 4PJDE 1YG9A 3UC0L 4E41A 4ZSOE 5FOJA 4FCHA 2R7EB 2LVCA 5FM5M 1YAZA 1G5GA 2LFGA 1Z5LA 2WB1A 3GMNA 4Y4KB 5BRPA 3BVNA 3B83A 2Y3AA 3VMNA 1YHPA 1H9DA 1U3NA 1X9QA 1N18A 3K2MC 4ZTOH 1MLCB 4X6DB 4OGYL 1U2YA 1F42A 4OZHB 2OIZA 2YOAA 1FLRL 2AEPH 4ABWA 3EAKA 4X0KB 4LVOB 5DJDB 5GRJL 2G2PA 3OKLB 3OG4B 4PSWB 3MKSB 1AXIB 2P9RA 3BUTA 1J8HB 5I6PA 5I5JA 3F3FA 4YBHA 3US9A 3C60C 4LEXL 4A7SA 2XZCH 2IANB 2B1AL 4HIIA 1X9LA 4LNRB 3V4VB 1JD9A 5J1TC 1OARL 1H3GA 3ARTA 3WJLA 4BEIA 4AEZA 5DRNB 1GS8A 4BINA 1MF2L 1C7TA 2F1EA 1A7BA 4GKSA 3L2NA 4POUB 1I9EA 3IVKA 4LP4A 2YOCA 3PS6A 2IPTL 3ARYA 3LKRB 1BQLL 1EEUA 3EGSB 4N0CC 4RAUB 4AVIA 2EBSA 3L5HA 3FUJA 3JWNG 4PJBF 2G9AA 1UM6H 5F6HI 1MCJA 3WV0A 3DYPA 3MRMB 4HJIA 1N64H 3PWUB 4OAWB 5CXPA 4LLMB 4OD1H 5CUSH 5FUOL 4Q58C 1MPAH 3U82B 3R1GH 4L8CB 3KL5A 3G5VA 4R2GD 1IQWH 1IAKA 4TQEL 5LLIC 1TTUA 4IEFA 3QPKA 4GKZA 4ONFL 4TPRH 5I1LA 2YNPA 4OF5A 1CVSC 1TVHA 2NQDA 3OKEA 3OWRA 3BKCL 4XO3A 4AJWA 4S2SA 1PY0A 3BLKA 3CUPB 4UQ2A 1MCOL 1MVYA 4UNIA 1MJJA 1CLYL 2IAMC 3IVMA 1QR1B 3U7WL 4O4YL 1KPVB 4OLUH 5CGBA 1R3JB 1MNUL 3FTSA 4HSQA 5D4JA 2F08A 3QYCA 3LKNB 4XBEH 2AQRA 3QDJE 3VGDA 4P07A 1FIGH 4OCYL 3RGBA 2NY1D 3SDXF 4NJAL 4M02A 4BDVB 3KYNA 3TPKA 4IDJH 2WYTA 1F3JB 5I24A 4NM4L 2MQ0A 2JH2A 3I3DA 2V7HA 2P46B 5J5EA 2XXFA 4KI5C 3IRPX 4K5OA 1LO4L 5KDOB 2QQLL 1KIPB 3AABA 5JHLL 4PB9L 4OZGE 5HHME 4NNYA 3MGOB 2OMBA 4TNVF 4U7MA 2R1WA 4WI6A 1U58A 3JV5A 1TBGA 3H3PH 3V6FB 3OAZK 1QW8A 4NRYB 4OFYA 2NY5H 4X99B 5B21A 4NRZB 3T6WA 3FO0H 2LQRA 4A39A 2WOYA 2LAGB 2J44A 3EOAA 3EBIA 1OTUC 3HI5L 3IFLH 4NAMA 4XHQA 3SKUD 1U8KA 1T1ZA 3SO5A 4KO5A 3CE1A 5CFAA 4Z1PA 1L3NA 2RACA 1MRCL 2HT2D 3P0GB 4PBWD 4P2OB 1GZPB 4NN7B 4A11A 1RZ8A 4MDIB 1BYNA 1RUQL 5FCUL 2LGNA 2QHRL 4HSAC 3ZKSD 4QXWA 2I69A 3X3FH 1NKGA 3ZL2A 3AFLA 3MLZH 1FHNA 4LOFA 4FYQA 2CWRA 4P4RA 1SM3H 3EYSH 4U6XA 3EJPA 1MW3A 4X5LA 3G6JE 4XCEA 3TONA 3WS3A 4Z7OB 5IIEA 1E27B 3NIDB 1FZMA 2ZPKL 1MLBA 5F6HJ 3OAUH 4XPGL 3EHBD 5FYJE 2RBLA 4Z7VE 4N8UA 1A6TA 3LTVA 1E5YA 2YD1A 3MC0A 2R56L 3FB8A 3P4OB 1EGJL 3QDGA 4M7JH 4P46A 5ANMA 3TN0B 4R0LC 3MJ6A 3L3GB 3BQVA 4P2OC 2L7QA 1I1CA 2BFGA 4Y8DC 3WD5L 3NVXA 3QA3A 3WIIH 1ZD6A 4NPKA 4KZEH 2DLEA 2G5UA 2HJKB 4G43A 3U9WA 5JXEA 4X9IA 4AGMA 3LN5B 1EEZA 3MRKB 4XMLH 3HR5B 4FKKA 5I73B 4LPCA 1IFRA 1Y0LA 4UAOC 1MCSA 1T4KB 1AHWB 4U0QB 3NUKA 3WSQH 5HHMB 3WLBA 2O5YL 2I9LB 3GMPB 2Y24A 1SYVB 3NIFF 4L8SA 3OB0K 2PTVA 2AK4A 1A6UL 3TC9A 2ZWSA 2JJUA 1ZHBB 3SYPA 2HB0A 4F9PC 1IC1A 3BD4A 2G9KA 4G8AC 3LQZB 2R2HA 2R0ZH 1KIQA 1LO3L 4QLRA 3RWGB 3C60D 3HRZA 2JKLA 2GHZA 3NA4A 1UH4A 1B90A 4XP9L 1CFNA 2H3XC 4A2HA 4F8TA 3QO1B 1OTSC 4IK6A 1GS7A 4HW6A 3SE8H 2D31A 1AHWC 4UV7H 4MHHI 2VDKA 3FO1B 2LTQC 1XZWA 3HB3B 4N0CD 1WAAA 3V0VA 4NFDA 3GSWA 2JFCA 4P9MH 5D71L 2Z31B 3DVIA 3HG1D 4R97B 4WNQB 3MLUL 4I0PB 4PUBH 5D6DC 4HWEH 2ZJSL 4JN1H 4Z7VB 4OKDA 5ETUA 2PR4H 2VLLB 2YQ2A 2Q20A 5DYOB 3DO7B 4F8LA 4ODTL 5T33H 4KU1A 4FQXA 1E30A 2ZG2A 4XXCA 1WEJH 4HWBA 5EO0A 3V10A 4PGEA 2IAMD 4GRLB 1C16A 2ENJA 2DPKA 3KW7A 4HFUH 1XGUA 3RWHB 3L6FA 5EC1B 2V5MA 4LLUB 3QSKB 2DB8A 4L1HA 1V10A 5AFAA 3LN4A 2NUTB 1OAYL 1S6NA 3OSKA 1A6VL 1PFCA 1MCIA 2B1OA 3HKZA 5CAYB 1DL7H 1ZHLB 1OAXL 4JGMA 5G55A 4C4UA 3WJMA 2W0PA 1G7MA 4JFFA 3NZUA 1VZHA 1P2CB 4JG0H 4KI5D 3WXVH 3ZDXA 1ZLWK 3L1EA 3QIUB 4UMGA 3OHXB 1WZ1H 1CGTA 3QHTC 5IBLC 4TF4A 3OKDA 4FWWA 3PWPA 3P54A 3T6VA 3ULUE 2G5RA 4WDIB 1WIPA 5KS9B 2PM9B 5IJKC 2D7PA 3BGMB 5AW4B 2IQAB 5I18H 2G99A 1OTUD 1FE8H 1Q0YH 1MQKH 1ODAA 4LMQI 3QEUA 5CJOL 5DA0B 2BCJB 2BP3A 2BZ7A 3VFSA 1U2VC 1S7XB 4DZ8A 2FJFB 4PGDA 2OTWA 3MBEB 4CY5A 1A7PL 2J1YA 2XNAA 4KKAC 1NMAL 4OCWL 5IG7B 1N8ZA 4F7CB 4QAMB 1Q1PA 4PJ9A 2P44B 1XCXA 1XH0A 4OLVL 5ITBL 1ERNA 4KDTA 4QOKA 4BZ2A 5KVEE 1OK0A 2GUOA 3EYOB 2HCZX 1I8LC 4FG2A 4OI9A 1ZEAL 4X4MA 5HHOD 2NX5D 4JO3L 4NQCD 1AD9B 4WHTB 4HG4K 3MBEC 3P9LB 3V4PL 1TPXC 4A7GA 4QRPE 4HA1A 1BHGA 3NFSH 2R59A 3X1FA 3QRGL 4AZ8B 4QHLB 1Q0XH 4GAYA 4L3CB 3MFFB 3S35X 4UZSA 4CAGA 2AV1A 3AXLB 3H56A 5FWQA 5ICXB 5EMMB 2HU5A 4LCIH 1JWSA 1I82A 1GH7A 5DQJA 4OKVB 3ZOAA 4I1RA 3QIWC 1RZ7L 4Y7RA 4KMLB 2DV6A 1EXUA 3JB9L 1ZTXE 2W0FA 3QDJD 4QRSB 1AY1H 1U8JA 2H6UA 3O6ML 1GIGH 3TFBA 3FCGA 4J23A 2EDYA 3NEXA 4M9OA 2D0FA 1F11B 3FC8A 2VT0A 1QSEA 2J1KA 2C4XA 1OTSD 5T5NF 3VD1A 1LO2L 2HESX 4P9HH 1JGUH 2CM5A 3QEQD 2F19L 3MDJA 4HUVB 2H0PA 3UTSA 2EECA 1ZT7B 2UY6A 1ODUA 4KGLA 2BIOA 1OW0A 3OLEA 3DHJA 5DA4A 3CFKA 2UZIH 1VADB 3ULUC 3HVDA 3CDGB 2EZ0D 5DUPH 3F7YA 3QH3A 1JHKL 4WSKA 1IKFH 4XOEA 1CTOA 4LLWB 1RZGA 3ZHLA 4TVPL 3VI3A 3L4OD 1RUPH 1V7MH 4JSXC 1J8KA 2NY6C 3IU4H 1WD8A 2XA8L 4WUKL 1CE1L 2WSKA 5T5NG 4XN9A 4GEJA 3EO0B 2NYKA 4QRPB 4RFOL 2XDWA 3MXWL 4F7MB 1NGXB 1JV2A 1USZA 1ETB1 2BSBA 2PP7A 2QZQA 4JS7A 5JXAH 3EI1B 3AGVA 1KUMA 1A5FL 3CPLB 4I1PA 3P2DA 4HWBL 5B38A 1GHFL 2GFBB 4PRPA 1KULA 2AAVA 3HHSB 4Y4FB 4B3EA 1S2EA 4CSZA 4MCZA 2A99A 3VD0A 2E7LC 2Z7UA 3AB0C 4UTCA 3BP5B 5L9DH 2H26B 5EWIH 3SD2A 2E9BA 4PGCA 3ARBA 3SJVE 5DQDH 3QG6A 3FU6A 5ESVB 1A1OA 5IBLD 5LAXB 4MK0B 3N91A 4WU7B 4XPFL 5JO5B 4ZXBC 5I8OL 1I3GL 2JKJA 1DQLL 2IDQA 3CD4A 4KQ0A 2AHIA 1XR9B 5E51A 1LO5B 3I3BA 3L7EA 4WU5B 1EZUA 2CDEA 5AOIA 2NLJB 5EFIA 2Q8AH 3W0WE 1A7NL 3Q9QA 1ZE3H 2RB8A 3CSYA 5KJRH 3GMMB 1YN7B 1YJDH 2APVA 3VRLE 4KKAD 4FJ6A 3NZ8A 3M88A 3NTCL 4ORGB 4W81A 5DT1L 3DUSA 3WFZA 4KKQA 5D1QC 1N12A 1GOFA 3DM0A 1JXGA 4H13C 4ACTA 3D2UB 1N6QL 2I07A 3N41F 3WNMA 1DFBL 4NNPL 1BYPA 3TO2B 1RERA 4JSVC 4K3DL 2CE9A 3EG9B 3PUCA 4PR5B 3BPCB 2YNNA 3UGEA 5TF1L 3O2DH 5K39B 2WTRB 2AQNA 1BPOA 2H3NB 4BQ9A 5CJXC 4BZ2L 5IW1B 5AW2B 3RVVD 5C0AA 5F6IB 3L08A 3PYCA 1EAPB 1T2QH 2PYFB 4HQQH 3ARPA 4EI5C 3SFZA 2FEEL 4QRTB 4MCNA 3SJVB 5DD5L 1UATA 2FX9L 3HNVL 4D0DB 4GUPB 3VGHA 3WENA 5HD8C 4ZTEA 5FXYA 3GXMA 2W0LA 1AI1H 2H8PA 1MRDH 2LLLA 3NRFA 5DD1L 3TBBA 2VC2B 1MQ8A 5F93C 1RULH 2IMMA 4S0SD 5CKAA 4WI8A 4N14A 3B3IA 1S7WB 3TURA 3OKYB 4HAGA 2BY0A 3EGDB 3I6GB 4A0BB 2WCSA 3HE6B 4Y1AD 3GMRB 4JX0A 4JHWH 1PCSA 5J56B 5F0MB 3ZT7A 1SUJA 4PNKB 2UZPA 2AXGA 4ZOVA 3GHBL 1MCLA 5AZUA 2E6PA 4EBQL 4L2LA 1W0YT 5C6TH 4QL1A 4PJ8C 4HSCX 2DD8L 3TA3B 1CF1A 1WZAA 2FIKA 1PZ3A 3QJHB 3MOBH 4JHAH 3U1QA 2EXYC 3ULUD 1LQBC 4OFQA 3KLHD 4WVRA 3O6KL 4XNXL 3BAEH 3SY6A 1GOTB 4CY3A 5IHUL 4MMXC 2VTFA 5ELIA 4X4XA 1G5AA 3MREB 5EUKB 1JGDA 1PIGA 5E8PA 4YQXL 1F90H 2VKWA 4LASL 1BZEA 3W9DA 2X6VA 1IKNA 1AZNA 2NY6D 1J87A 5D93B 4MTMA 1SJHA 3NABH 1INEH 3KNBA 4OTXL 1BX2B 2WTPA 3QQ9C 5E23A 5K93A 3V4VH 3GUTB 1UCTA 5EM2B 1J0YA 1WLHA 1R3KA 1E8XA 2MQ3A 4FCAA 2P45B 4NZTL 4UT9A 3MGTA 2B08A 3VFNA 2SODB 4M7ZB 2WGXA 3TO4C 1JMZA 1GOHA 2XTSA 4YGVA 4DTGL 5KBMA 4EDWH 2B5LA 1IO4C 3A6CL 2VDQA 3LH2L 5D93C 2XN9A 4F7TB 4XTRC 3VTAA 1VGEH 3MCYA 4OBRA 4M03A 2I5YL 4G1EA 4JPKH 2G2RA 5L4FA 3B2VL 2WKGA 5HJGA 1FO0B 1QNIA 4ZXBD 1JFQL 5F96H 3UZVA 6FABH 4FXTA 4XN5A 3UYRH 1ZLVH 3ZT5A 5M7QA 2GUYA 1VZ3A 4LCYA 3ZKXC 1E4XL 2A6IA 2RR3A 2X70B 2VXVL 1KLFA 1TEYA 3DX6B 3B6SA 4NBYB 4J2XA 3N50A 4HIHA 1UCBL 2D4DA 2J2ZA 3MRCB 2PYED 1P7BA 5D1QD 2BY1A 2G0KA 3QNZA 1M7IB 1KPRA 2IVFC 4B9IA 3KPMB 3KPNB 3UL4A 5A2Qg 1KBKA 4F8NA 3F7PC 4PB0L 3OPUA 3NIGB 1M9WA 3MU3A 4HX1A 4IIQB 3T4YA 3U46A 2HRLA 5A7EA 3FRPB 4XO5A 2OMTB 3QHZL 1JF1B 3EKCA 4ATTA 4TUOA 4BWWA 3DSNA 4YDLB 1HHIB 4QCIB 1L4IA 5IVXA 4BGDA 3X3GL 5IVOA 1WAPA 2A6KB 4WK4B 3MCKA 3SDYL 3VFPA 3J81g 3BAWA 1ZPLA 5HYJA 5GXIA 5C0IA 2UWEE 4JRXE 2ZTBA 5HVHC 3MX0B 3CN2A 5HGAA 3UPAA 1OAUL 4CADB 5SX5H 1KTLB 4EI5D 2C4FT 2BSSA 2VLKB 3WUWB 4EZJA 1LP9A 1SLWA 4YN3A 1PI6A 5THAA 1FNLA 3FUFA 4W1TA 2EO1A 5C0FA 2EDXA 4N1HB 3RWFA 2FJHB 3VWJA 2Y69B 3EYUH 4KQ3H 5LB1A 5LCVH 3H54A 1U92A 3KHOA 1A12A 4H40A 3TS8A 1Q9WA 2FQGA 4LCWB 5FA4A 4JFEA 2NY4B 4NXSA 4TRPL 4BJLA 4GKNB 2VN4A 5C97A 1PYWA 1GMIA 1NL0H 5EIVA 5TD4A 3VGAC 4DPCX 4I77H 4NYLA 3VFWA 3KH3A 5EIIB 1XD0A 3QFJD 1KIRA 5IQNA 4HF5H 4YZWA 3V9FA 3WGVB 3AS1A 3WS6A 4PJ8D 3KPQB 4BFIA 2EYSA 3L3IB 2E75C 2Q1EA 2O4EA 32C2A 3GRWA 4WFFD 2EXYD 1G94A 3O3AA 3JPXA 2F7RA 2LOEA 3L8QA 1S7SA 1MHEA 1UT2A 5CJ5A 2HXAA 3MKKA 3IU3A 1LK2A 1JZ3A 1QLRB 2XWBB 1JHTB 1LL1A 5BRQA 5B4WA 1PJ9A 1EEYB 3KPLA 3BVDB 3EDJA 2HX8A 1DUZB 1K4DA 1S7QB 2NUPB 2R0WL 3I6KB 4GYBA 4OM1H 4ZD3L 2JK5A 2GY7B 4TTDC 3QQ9D 3OJVC 5EF3A 1IC4H 1N6FA 2MTPA 4ZPTA 4HIXL 4PV1C 3RVWC 3AS0A 1KXTB 2ITFA 4UM9D 3IN0A 4FERA 4POZC 4QXTA 4WO4D 4HEME 3TO4D 3VG9B 4E9RA 1JN6A 4X7TA 2DBLH 4IK7A 4BXSV 1ZGLP 3RX5A 2EIDA 3RYMA 3A24A 2OMVB 4QXVA 1AKJB 1A9VA 4NKDB 4UT9L 2YGOA 3K2IA 1KEGL 4GW5B 4X8CA 1R33A 3SO3C 3D06A 1VZGA 5KN5B 5FYJH 2JB5H 1J48A 2Z4QB 2NY2C 2VDQL 3FBQA 4L4TA 4DNWA 5DJCA 2WYZA 3GXIA 1EHKB 3S3JA 5I6KA 4JFPB 5IUSA 1AQHA 2AV7B 4M3HA 4PTUB 1JVOA 3MV7E 1BLNB 2DQIH 4FDWA 2Z8RA 2LW3A 1KTDB 3PXSD 4J3BA 2BNRA 2HJ4A 1S7TB 3D39B 2QGBA 2A0LC 2W8CA 3HPLA 1VHPA 3AG4B 1ANUA 2PP9A 1QOKA 3V4UL 1OB0A 2ZX9A 5EIQA 3JT2A 3ZE0F 3II3A 5T1LB 3HG3A 1A2YA 3MO1B 1H5BB 1BVZA 4L3GD 4HPYL 3GMOA 1R6VA 5ISZA 1NPUA 4MJ6A 2J55A 5E4OA 1HESA 5E2JA 2AEQH 3PP3K 4YXHH 1P22A 5F7WC 1FG2B 1JS4A 1YEJH 4M93C 1Z9LA 3PQYB 5KSAA 3APFA 2D7MA 5DMJB 2DJSA 2AJSH 4OUUB 4TQPA 2KDYA 3E1F1 5I8EA 3SDAA 1BXVA 1VZIA 3QZOA 4HJ1A 3QI0A 3TT1L 5A2BA 4O9DA 3KEDA 4I85A 2IWKA 2OK6A 4RA0C 1E9OA 2GW5A 4X80H 4LL1A 2GIMA 3SKNB 4OM0H 3IJYB 2CO7B 1MIEL 1MVUB 3LZFH 2OMYA 4AEHL 2DM3A 1QFOA 2OP4H 1R3IH 4HU8A 1ACXA 3JZ7A 3AITA 4QHKJ 5JW3H 5D55A 3MV7B 4G7VL 5HGGS 5I16B 4P5MA 4KY1H 1MI5A 3ZDWA 3BEVB 3DIFB 1E9PA 1AJ7H 1KCVH 4K23H 3IUMA 4Z7WB 3L54A 1G1OA 1QWUA 1VFAA 3HI1A 3KLAB 4FNPA 5TE6L 4ACPA 1LK3H 2C3HA 4I9WE 4ERQA 1LE5B 5F2FA 4JPSA 5TFSH 5KBNC 1HI6B 4HUMB 2K4WA 3S8FB 4NLHA 4FA5D 4IRJB 3C6EA 2A38A 3RBGA 3ZE1A 2DYSB 4GQZA 4P3DA 4Y5YC 5FGSA 3DMMA 3NJXA 3VXRE 3KPSD 1N6EA 2FNWA 3EOTH 3WLWC 4KDWA 3HN3A 2EUZA 3CK0L 4A6YA 3GRWL 1MUJA 2A74C 1HJCA 5EH1A 2DQDH 3ULUH 3BH9B 4C58B 1F3DH 3BZFB 5FKRA 1RZQA 2B20A 2NXYC 2PCFA 1S5IH 3MV8A 4LLVB 4YAQB 4PJ7E 3V5KA 3RWEA 2QVFB 3HPJB 4TTDD 2BHFA 4GNKB 3D0VB 5ANHA 5LGYA 2VWEE 3RVWD 3T1FB 1TTBA 3AUVA 3NSXA 5GIRB 2ZF8A 1LEGB 4FA8A 25C8H 1TJXA 3O3DA 2F5BH 2WK2A 5IB5A 4YDJB 1IQDA 1NDGB 3SY0B 4H8WC 5JW4Q 4JVWA 2NNAA 3ZIMA 3HNTL 4KKLD 4B95C 4I89A 1WVZA 4ABVA 2DQCH 3FNKA 3I2CL 3LEVL 5BV7C 3PFQA 4JRXD 2NY2D 4LU5H 3G9VA 2A3TA 3THML 4KXAA 2HG5A 1CDJA 4G5ZH 4PG2A 5BRZD 4R7DA 2X89D 5KYXA 3FAXA 4FXGA 3IDXL 4PLJD 3BKML 3DX0A 4UDTA 2VDOB 3BUQA 5AENA 3QEGL 2G75B 2A0LD 2WTOA 5F9OL 2WY3B 3U1PA 3VXRB 5GPRA 1AGBB 4YSTA 3VD2A 1NBZB 2BNUB 2HFFA 1FFOB 3MACL 4NOBA 5CD5C 4PREA 4NQXA 2Z8WC 2AJXH 3DO4A 3B56A 3Q06A 5IMMB 3T2NH 4PGJA 5DSCA 5B1JC 2K3TA 3L95A 5A6IA 3NK3A 1FBIH 4MGXA 1U3HA 1S9KC 3ZJAA 1ZTXH 4PJ7B 3DVGA 3A6OA 4HWZA 2ZXCA 5EC2A 4WI3A 5LAPA 2AEOA 2PW1B 3JVGA 4E36A 1IBGH 5D70H 1FDLL 1USQA 3JV6B 2Y06L 4QO1A 4ATWA 5JORB 1O6SA 4APXB 4O58L 3BUBA 1CTNA 1SXSA 5ALBL 1WBXB 1HKLL 3SBWA 2CLRB 3QW9A 4DN3L 2E0PA 3ZDYF 4XC3L 3GXUB 1ZANL 2R2BA 4GY4A 4NZRL 3B1TA 2YSSA 2YMXH 3P3TA 3UBGA 3PE7A 4O3UB 3M8OH 3N0PB 1PD6A 5EUOF 2Z93A 4GW4B 1GCFA 4L05A 5DHVB 2VKXA 3C6SB 4FA7B 3GSQA 2EDBA 4PSPA 4U2ZA 4FXKB 3D50A 4FLSA 1HU8A 4WHCA 3UG5A 1CU4H 3O45B 4UIMA 4XMUA 4FA6A 1XIWC 5CP7B 2PCPB 2IGLA 3OX8A 1OB1B 4E9YA 4HKXB 2EDJA 4P3WA 5DC2A 3GJFA 2PPEA 4PWIA 1A3QA 2V2TA 3C09C 1GY1A 3BZ4B 3IKOA 2PWEA 5C7XL 4HALA 3V8CA 2Y36H 5DVKA 1IV8A 4PJGE 5J1AA 1P7HL 4WFHE 2DJUA 1V27A 2YUVA 4LGSB 1FL5B 4P2RE 2VMCA 2N3JA 4YR6A 3W39B 5AOKA 1IE5A 1D9KD 1KF9B 1RSFA 2GG1A 1D7FA 1L0QA 3IXAB 4LK4A 4GS7C 3WLWD 3ILPB 4JRFA 2C7UB 1MAMH 4TUKH 1CL7H 2VQTA 4LF3A 4WW2A 3W57A 2VC2H 4MJIB 5HDQH 2YD4A 4UQDA 3G6AA 2NXYD 4PU2A 1FAIH 4U1HB 4A6YL 3KS0H 4JDTL 5E2WL 3S5LA 4L3FA 2IUQA 5ICZB 3QDMD 1RJZB 2DQGH 3BX7C 4MKMA 3L5WB 1ZS2A 1N0LB 1JPST 5I30H 4YHOH 2Y1VA 3NCWA 1A3LH 4HP5A 4NC0B 4CJ0A 1IGTA 5KZCD 1A02N 3L45A 2BIIA 5FKPB 2QQQA 2R69A 2VAAB 4KZ0A 1DJZA 5ID1A 5I17A 1AD0B 3IDYC 3BFWA 3DYOA 4D0BB 3N43B 3P11H 1MDAH 4YUEH 5DVMA 2LR4A 5EAPA 3VH8B 4N2IA 3FTGB 4XX5A 3CFDA 4NCC1 5AD0A 3R7RA 1OGAE 2R23A 4YDZA 2AZAA 1KFGA 1K5WA 1P5VA 1DFXA 2TAAA 2H0EA 4G6KL 2IPKB 4EOWH 1ZT4B 4NP4H 2VLRB 4DVBA 4FQHA 1PBYA 2JQMA 2X4SB 5DS8B 1LDPH 2EDNA 3ARFB 3QZWG 5J6SA 2XWZA 2Y7SA 3ESNA 2XN2A 3MUZ1 2XTJB 1KGUA 3TV3L 1IILE 1Q72H 1QFMA 1MFEL 4Z0BL 3DDUA 2C3GA 5KBKA 5BW7C 1SHYB 1X4ZA 4NAJA 3BVVA 5FB8B 5CD5D 3WNNA 3AS3A 2VDNA 4IRZH 2XPZA 2CCLA 1SOSA 5DUJA 3ZZ1A 2BS8A 2DH2A 3UTOA 4L9DA 2V9RA 4JFTA 4F8OA 2H5UA 1IM9D 1GC1L 5CWSA 1UUSA 2ERJC 3GS0A 3CFJA 1NCOA 4U1SA 1QPPA 4RA3A 1RK1B 5K9JL 5EARA 2UZYA 3FT4B 4KOCA 3LEXA 1FO0H 5EU6B 4E42A 4MXQC 4HULB 4OCLC 3WFCH 2J1XA 3SZKC 4AMKL 5C09E 2L0DA 2X2JA 1VFUA 2VRQA 3PLYA 2RTTA 2XG4B 4NO3A 4Z0XB 5JPMC 2A1WL 1XBDA 4XZUA 2GSGB 2XKNB 4R90H 3BAXA 5HYSG 5G5DB 2WNWA 1OGAB 5IQ7L 2HFEA 4L4VB 5H8DA 4X8JA 4OCNC 3QQXA 3K6SA 5SWZA 3Q8AA 5AKRA 4PEEA 1G9NL 1S4IA 3GFUA 3NAAH 3V8OA 3MLTA 4RIRA 1XIWD 1PX8A 1R0AL 5H1MA 3HMWH 3T77B 1HXYA 4Z7UA 1SVBA 4H1LG 3WNIA 2IOIA 4CI8A 1I1AD 1MNNA 4J87A 3FUEA 2RJMA 3SYOA 4A1RA 4ONGL 4XPAL 2VZUA 3QXDA 2HKFH 1N5YL 3E8VA 4U4IA 4U3CA 2E9GA 2JELL 4QRUA 4QHUB 4TSCL 4LLAA 3FT2A 2DMKA 2X4UB 1XGRA 1SEQL 3FQNA 5EOQH 2BMKA 2YQ3A 1HVXA 4M3JA 4MASA 4S1RL 5IBTH 1MW1A 3FSVA 2BIMA 1M05B 15C8L 2R0LL 2Y72A 5CJBA 1WCBA 5HJ3A 2X4QB 2XXCB 5GGVH 2QPEB 3KWWB 3MRJB 4TQIA 3KD4A 5F72S 2NTFB 5D2LE 1JPSH 1OKEA 3L3DB 2CDGB 3HC0B 4V33A 1RJYB 4L8BB 4HETA 5DK0A 3JBG7 3UCRA 3GI8L 3LIUA 1MDTA 2WLIA 3QZWA 4N9GA 3BPNC 2H6KA 2DLFH 1AOHA 2EC9T 4E0RA 5IW3A 2XFXA 3MV9D 4JO1L 3VWKB 2DIEA 3RVTC 4Z77A 4NGHL 1SXCA 1R75A 3S3CB 4GT0A 2A4EA 4PRDB 4C57C 1JDAA 3L7FB 5TPWH 2A6JB 4ELMA 2EILB 5AFU3 4KKCC 3S0PA 1SDDB 3L4VA 1HK6A 3HRPA 1PSKL 3QZNA 1KTRL 2R69L 3MLYH 4QI3A 4XNUH 2HJFB 3TJEH 3PHOB 4KXDA 4X6EB 4HKZB 2AZUA 4GINA 2Q86A 1B2YA 1PPIA 3MXXA 3O4LE 4PJAF 4KRPD 1GGTA 4C83B 1XF4B 4L1QD 1GGCL 4CU7A 1N3NB 1X5ZA 2WQSA 3FOLB 3AM8C 4QXGH 4EAEA 1YQVL 2YPKA 3GPEA 4MX7B 3U30C 3DWLC 5D2LB 2BJMH 1G1KA 2WZ0A 3NCJH 3QXWA 1ORSB 2APXA 3ZSTA 1NC4D 4I18A 3P3YA 3HC3H 4KVNL 4MHHG 1I8MB 5FGCB 3OLIA 3FQRB 1CG9B 4DUWA 1CGYA 5K9KB 4EKJA 1DBBL 3QYNA 5D1ZC 2OI9C 3BP4A 4H1LA 5D4QA 2TRYA 2QQKL 3ETTA 4MXQD 1OLLA 3I02B 1MHCB 1CDBA 1NWPA 4F58H 2RCSL 3H9ZA 2FAUA 4Y5VA 1H15B 2JTDA 4P2AA 4AKQA 5ADPH 1KJMA 3Q05A 4H26A 2DTMH 3I7OA 3TJPA 1YZZA 4P8QA 1MIML 2GTZB 4BZ1A 2YA2A 4RWHA 1ET8A 2W60B 2F8IA 2NW3B 4OIBA 2NR6C 2X4TB 5DMKB 3RI5F 2G0LA 3IMBA 3S3DB 3MLSL 1W2KT 1H3VA 3X1EA 2ADFH 1GGIL 1K6QH 2CRIA 4PJEF 5HPMA 1QFUL 1DR9A 2BY2A 2HRPL 3LPFA 3MGAA 1O9VA 5E1HB 3ZDZE 4AH2B 3I8EA 4PMFA 2CIKA 4GG8A 3BZEA 3S96B 4XPBH 3AH8B 1LGVA 3TH4T 4MJ4A 3PY9A 3O41B 4YBLC 1VE6A 1J18A 5D7IE 3QI9A 3H42L 4FABH 2R1YB 4XVSL 2GCYB 4HXAL 4U1LA 1BA9A 1UHVA 1XCQB 2GB2A 1F58L 3FOMB 5FW8A 3VFVB 1BQHG 3FCSA 4UAHA 4FQCL 5JHDE 1NGYA 3JV4B 4PJHB 1ADWA 2YD0A 1DDTA 4K8RH 4NSKB 2CM6A 2H45A 2A9MH 3L3HB 2ZOWA 4Y89A 3U36A 4IBUA 1T2JA 1K2DA 1CLOL 3LXBA 5D7LA 1E4JA 1AIFA 4AGPA 5LJYH 1FFTB 1PG7H 1T83C 2HU8A 2WAQA 2V0AA 1RU9L 4YWGL 2OSWA 1GYVA 5DQ9B 4F2MB 5I1JL 3ZT6A 3CVDA 3PABA 4LRNL 3WEXB 5AZEL 4A67A 1EHNA 5EU4B 1VACA 1L3WA 4G7SB 2IH9A 1CFQB 2H9NA 1U4EA 2JI2A 1FVDA 4L3HD 1F6LL 5I1KL 4PRAB 1K85A 5I6OA 4CMMA 2EVIA 4XCNA 4CZXA 1C5BL 5IFAH 3H55A 3HUJB 2VLME 3BDYH 3BP6A 5ESAA 1EJOH 4KKCD 1HZHL 4GRWE 5TDNB 1MG2A 3FGBA 1UKQA 1A9EB 1PU0A 1XO8A 4H8WH 4XH2A 5EZOL 1UVQA 5D7IB 4YHYB 1C9IA 4PJAA 2YAEA 5CJ8A 4J3OF 3IDNA 4HCIA 4IOFC 5BV7H 3C6LC 3ZMNA 1H19A 4EN3B 5KAQF 2YQGA 2IH3B 2AH0A 2E27L 2W65B 3A67L 3W37A 2XPGB 4XAWH 2FUTA 4CC4A 1DBKL 2F6AA 4ZPVB 4AV0A 5JHDB 4JT6C 1S7RB 2MOGA 3UMTA 4Q6IA 1XBRA 4UQIM 4FS0A 3IUJA 4F57H 5BVJB 3TNMB 2K4AA 2VXSH 4EI0A 2ZXBA 4LLQA 2E59A 3VXUD 2P8PB 2FYYB 3UTPD 2VXQH 5E6IB 1WFTA 4HZAA 4F3FA 4AEIH 5KAQG 2VNCA 2EDEA 1V7NL 5L2KA 5ACLA 3WG7B 1I7RA 5EO9A 4D9RE 3CSGA 5D1ZD 4E41B 1ED3B 1NIEA 1HHHA 3BO8A 4JRYE 2KLTA 2C9QA 1DBJH 2YEVB 5D7JC 1Z5LB 1C12A 3GMNB 3BWSA 4U3SB 4XWGL 4MS8C 2VDOH 3BVNB 5T1KA 5H4YA 5FM5O 5C0BE 5AG9A 1HXMA 3UADA 3E9UA 3NFPB 1L9MA 1B9KA 5E99H 2L4OA 4XODA 1BQHA 1UZ6F 4OIAA 5HE2B 3Q8EA 4BSJA 3SBQA 2NR6D 4R26H 3UJTL 4ADGA 3UR4A 4BZ1L 1P1ZB 5KWYC 1LLAA 3KYMA 1C08A 4Y5XA 5I74B 5ACZA 1TTRA 3VJ6A 1EX0A 1IC7L 4HIIB 5AVUB 5FDWA 3UIZA 4W6YB 3FCTB 3POCA 4OGXL 4Z5RA 5TDOB 1SQ9A 1D6VL 2QXVA 4JJ5A 2XE4A 1FNGB 3H9SD 1TYQC 3ARQA 4GKSB 4LQFL 2FO1A 3W82A 3IVKB 3T09A 2Q7QA 3HAEH 4NC4A 4ZFGH 1OK8A 1AQMA 1FG9C 3GS7A 2FBJH 5C9ZB 1B0WA 4XO8A 1XH1A 4MCYA 3FTWA 5F7YC 2AQ1A 5GGTA 4YVUA 3I50H 1L9SA 4JPWL 2AABL 2OSXA 3QHFL 4UQEA 5CEXB 5DHVH 3G5VB 2KYIA 1IAKB 2J88L 3P2BA 4FTVA 3O4LD 3V6ZA 5C3TA 3VXNA 4IEFB 4GKZB 2PXYA 3B2XA 3AROA 4QRRA 4TMPA 5F7AA 1TVHB 3WJLC 5E24E 4MBRA 3OKEB 4L1DA 4LL4A 1M42A 2G4GA 4UQ2B 1JZFA 1T7VA 2D7TL 1OZTG 1RZFH 1MJJB 1FLTX 1GVIA 3QBTB 2NYZA 1HE8A 1QBBA 3DUUA 2IFFL 5A2JH 3U0WH 2ODHA 5C9JA 2ADGA 1W6WA 3RN0D 5ANME 3QR2A 1QFWM 1A7RL 3KYNB 4NB7A 5B8CA 4DNLA 5KYNA 4AIZA 1MOEA 2AXHA 2AJUL 3TF7C 4NKMA 2V7HB 3JWNE 3GKWH 3PAZA 3MA7A 4NUJA 3QXTA 2AXWA 3U2SA 1QBLH 3TIEA 5DVNA 4NNYB 5EU7E 2R1WB 5DJ6A 2IJ0C 1U58B 2AK4E 5CBAA 4IOFD 1UWEL 3C6LD 2BK8A 2FJSA 2LV4A 5FIEA 4L9LC 2W94A 5HHXH 3EOAB 1MFBH 2HX9A 2AK1L 2IMNA 3B5HA 3L4WA 1CLZH 3MRHA 1T1ZB 2Y1YA 2ID5A 4XE0A 3UERA 1F2QA 4LSTL 5E2VL 4GG6B 2X41A 3RDTD 4UTAH 4YHMH 1SN0A 4ZW8A 4A11B 2CKNA 3EO9L 1S9YA 1EZSA 4RDQF 4JL2A 4MNGA 3V0DA 4QPEA 3Q2NA 3RG1C 1QUNA 1HZKA 2IO5A 5HYNB 2WXJA 3VNZA 3CN1A 5KSBF 1NLBH 2X2HA 1HN1A 2Y3NA 3PHAA 4TVPE 4V1DA 4W9DC 4NENA 4P4RB 4BRVA 4U6XB 5KSAB 2FX7L 1MAJA 3NESA 1QFWL 3NJGA 3WS3B 1HXKA 3IULA 3H7LA 3ELQA 4N4YB 3V4PB 1MLBB 1OGSA 4K94H 3D9AH 4LSQL 2DQFA 1A6TB 4GM9A 4MNQA 4P46B 3FB8B 3QDGB 1TTCA 1XF1A 3RFHA 4HT1L 1D3CA 3BYTA 1QSVA 1FPTL 3QA3B 1WG3A 3OLGA 5D72H 1EEZB 1AO7A 1R5IA 5ACMA 3PJLA 3UDWA 5IR1A 4A09A 3NJIA 4DPAX 5GS0L 4ZO6A 3VQ1C 3AXIA 1F97A 4PYHA 1PLGL 2ALAA 3K27A 2QKIA 4I87A 3WLBB 3E9TA 4S0TD 2HT4C 2WWKO 4Y16C 4FQIL 2AK4B 5JW4M 3QDAA 2DOCA 5IVZA 4AIXA 1IE4A 4P46C 4MAYD 3SVWD 2R2HB 1OO2A 3CDZA 4TUJA 3HRZB 4JFFE 3KE0A 4HJGA 3T71A 1CFNB 7PCYA 1YYLH 4BQBA 1JNJA 3JWNC 3PWPE 4XBGA 1NOAA 3K4DA 4HKJA 1A1NA 2D31B 3DGCR 5JIIA 1F41A 1ZLUH 1TO5A 3B9KA 3IWUA 2HJLA 4PAZA 5EU7C 4L8SC 3V0VB 3SGDI 3GSWB 2VITA 2O5XH 3GHEL 2JCCF 1HWWA 4D7PA 1EQWA 2B7DT 2XZAL 1UWXK 3GXDA 3U1SL 3HRZC 43CAA 1DHKA 4WWID 2GJ6E 3AL9A 1A6PA 1NAKL 2R4RH 5ETUB 5FO2A 4JHZA 4UI2A 5GGTL 2F54E 3F6LA 3MR9A 4KMQA 2JIXA 4IMKA 1OAQH 4PGEB 1RL1A 4M6OH 5EO0B 2FQFA 5AVSB 3IJ8A 2X38A 1C16B 4QOKE 1WJ3A 3EQ8A 1XGUB 4LVHB 1FYTE 3L6FB 3JWOC 1HYSC 2BS71 4CU6A 3NSFA 2OCJA 1FRGL 4F7EA 1IAOB 3LN4B 1NBCA 3F01A 4FN0A 3SN6B 4GSDL 1J0KA 4I0KA 4LSUL 2XQBH 2XWJA 4JRYD 3WJMB 1G7MB 4JFFB 1LWHA 3ZDXB 4J6RL 4TLKA 4FQXC 4M5ZH 3CNKA 5F89A 2WXPA 3OKDB 5C0BD 3PWPB 1NFAA 3INOA 4X7EC 4BFNA 3V5WB 2EH7L 3K6IA 5HHPB 3VMOA 4HJEA 3L5XH 5CCGE 3QUYC 3MRPA 2EIZA 2PW2A 4E9SA 5I8KL 4HDIA 4ODSL 3DX2A 3VFSB 3WTWA 2EDRA 4DZ8B 1CGUA 4PGDB 2OTWB 1CICA 4HH8A 4NI6A 3ME0A 1U8LA 5KG9B 2A77L 4XMPL 3P02A 5JPNC 3F00A 4PJ9B 4CL7A 1UEYA 4N20A 5MP6H 3U9UB 3H2QA 4ALAL 1AFVH 2F1AA 3A3YB 3MLWH 1GS6X 4WFEE 4X6BA 2P5WE 3IIYA 5D5MA 4JKMA 1YNLL 3TBTA 3GBMH 5E4EB 4QOKB 2ICWJ 4LHUG 1DJIA 3RNQA 3VI3E 4H25A 2W91A 5J6HA 3MUHL 3CZGA 2Q8BL 4F15C 3HZMA 1G9HA 4FC3E 3ILDA 5GZNA 2BFVL 1PZUB 1AXSA 4XPTH 3UBXI 2A9CA 3QIBC 4A04A 3ETBF 1U30A 3EFFB 4FZEH 4WV1B 1A6WH 1OE2A 1PZ5A 3RAJH 3D85A 4GAYB 1ZHKA 3FU8A 1VCAA 1AKPA 3N9GH 2AV1B 4UOW1 1AC0A 2HT4D 4KHXL 3UCQA 4KC3B 3DJZA 3WFHA 3LMJL 4Y16D 1XEDA 2B9BA 1TJIH 4KDTC 1JWSB 3S3PA 2D2CC 1TQCC 2EKSA 5DQJB 2JKIS 1RUML 1UYWL 2CRZA 3UC0H 4KK8C 1AACA 2V9TA 3V7DB 5I5IA 2W0FB 1KN2L 4BFFA 2EUWA 3S4SB 2P9KC 3VFGL 2ARJQ 3VFTA 4QRQA 5M95B 2BX5A 1QSEB 3B7UX 1YFQA 3EFOA 2A9NL 3MBXH 3JUZA 3UZQA 3UTSB 1ZA3A 2UY6B 4QHNA 5IB3A 2XWCA 4OGYH 1I8IB 3EJSA 5D2NA 4YL4A 3WELA 3CFKB 1FLRH 4Y0GA 1LMKA 2JE8A 2GC4C 3QXUA 5GRJH 3SPHA 3TZVC 3F7YB 3QH3B 2BP8A 1AQDA 1RZGB 3RVUD 3SPVA 1FIEA 2OVPB 1HOCB 3QE5A 3VI3B 2PYEB 4HCRL 1NMCC 2VDPA 4Y19A 3AY4A 1OARH 4KHTH 2PLTA 2UX7A 3II1A 4LCUB 4LPUA 5BO0D 5IFJA 5BXFA 4AENA 4JK0D 2WWMD 4GKLA 2B4EA 2I0RA 1JV2B 2IPTH 1BQLH 4DKTA 2DIBA 1ZJBA 1SVCP 5B38B 1HL5A 4PRPB 1NFDA 5FUOH 4IRSC 5FF6B 4X0NA 5EZJA 4MCZB 3E8UL 1AR1C 5C0AE 5M5TA 4ONFH 2A2QT 4TSAL 5AW0B 4ZT1A 3Q2CA 2XL3A 5HE0B 2OYPA 3MXVL 5J11C 2YZ1A 3BKCH 5D96C 3QG6B 2O93L 1WWWX 3VXSE 1MCOH 3QORB 4W4NA 2IGTA 3HW7A 1CLYH 2VR5A 2A73B 3BGFC 3I9IA 4LHUA 3UBHA 1WT5A 3EJUA 5DI8A 4ZMQA 5B7MA 1WFOA 4O4YH 3U7WH 1T03L 2B39A 3BVWA 2WWKT 1YDPA 3SKJL 4Q0XH 3QUYD 4MA1C 2Q3XA 2MH4A 2CDEB 2WKOA 4MD0A 4OCYH 5EFIB 1AP2A 2DW5A 4J3UA 4MKTA 4DNVA 3CSYB 2XOTA 1RH8A 1YY8B 3WIAA 1CFVL 2NY3C 3I74A 1DANU 2RFXB 3NZ8B 1J0HA 3ARBC 1LO4H 4YHKL 5JHLH 4PB9H 4XCFL 2QLVB 2E4TA 4P2QE 3FW6A 4YK4B 3E0CA 3IEAA 4U6YA 1NAMA 3BC9A 5FYKD 4FQ2L 4X2UA 2X88A 3IJ1A 2I07B 3Q1SL 4DGVL 2XETA 1UZGA 4XNQA 2XYBA 2MQCA 1ES0B 2MEJB 4UMSA 1QFPA 2XKSA 2CAKA 1AGEA 4FFZH 1CD8A 5AL8A 5AVVB 3VG0L 2YS4A 3EUUA 1PF3A 4Y1TA 4CILA 3B7YA 2GJ6D 2YKLL 3VDAA 1RUQH 3FN3A 5FCUH 2E86A 2ZZUT 2QHRH 2VXUH 3EDEA 3QIBD 4M8QA 2EIJB 1XGQA 1DUYB 1YYMH 2VXTH 4MZIA 2F54D 3T5WA 3KDPB 1HWHB 2EDFA 1PIFA 1F4XL 2BDNL 2IC2A 3IWVA 2Z0UA 5CO1A 4DF9A 5A6LA 2H8PB 2ZPKH 4N6RA 3U7YL 2V7NA 4XPGH 1W80A 4PRBA 5DO2D 1ZV5A 1FYTD 2ZYRA 3OR6A 4ILDA 3ESVF 2R56H 1KENH 2CSPA 4KK8D 1JXDA 3B3IB 3WD5H 1KELH 1UJTA 5DS2A 4X61B 1JWUA 3BQUC 5C0GA 5CLWA 3TVMA 3B7TA 5C86A 3PDGA 2AXGB 4HCFA 4AOFA 4NZUL 4CVXB 1U0QA 1U93A 4OCSL 3MNDA 1XGPA 3SE4C 1G87A 2H1PL 2BCKA 4OJYA 1E2WA 1CFTA 5IK3B 1YEIL 2FIKB 3IGAA 4UIKL 4WSGA 5J1SC 3VD3A 1DSFL 3MVDK 2BW4A 4GRWH 4YDKH 2JJSC 4IQHA 3TZVD 4YJZL 5ADOL 1SMOA 4NBXB 1FL6A 2I85A 5CZVH 4E2OA 1BD2A 1JYVA 2ZUUA 4X4XB 4X6DF 2DWEB 3OBAA 1JGDB 2DQUL 3M7FB 4OZHF 4KZCA 5C0DA 5E8PB 3WHXA 2R8SL 2X9YA 4XP9H 3W9DB 4X50A 2ADJA 3S98A 1KGCD 3ZQ9A 2RA1A 3WEMA 3O8XC 1T04A 2HVKA 3KNBB 5FHBH 4Q8BA 2GITA 4JB9H 2OR7A 3M6DA 1Y07A 2VDPL 3ASOB 4BP8A 3QVAA 1Q1JL 5IVXE 2N59A 4WFED 1AZZC 1YY9D 3NEEA 2P5WD 1QVOA 3MGTB 3VFNB 3RB5A 1JMZB 4C56A 4IRSD 1N0XL 3MRQB 3PU7A 1H6FA 4YGVB 2EIMB 5HYJE 1K8IA 2GT9A 4GAFB 1AR1D 2V8LA 2XN9B 1L6PA 2IPUK 5JR1H 2EJ1A 2EE3A 3RHWK 1G7HA 4NIYE 3ISWA 1U8QA 3SOBL 5CN1A 3VX1A 1D5IH 2G2RB 2GNQA 2NYYC 2X12A 4XBPA 1HIML 3IKCA 3UZVB 4RGNE 2FHCA 3D18A 5KVDL 1FL3A 2NY0B 5IQ9B 4FULA 3L9BA 1D2OA 4F80A 2R39A 4LCYB 4YDMA 1IX2A 2IADB 4JFEE 1BG9A 2A6IB 4X5PA 2PF6A 3NJVA 1A6VH 2VM9A 2YAMA 1KLFB 3B6SB 1OAXH 2NY3D 4MSWA 1SF3A 5IQMA 1J9TA 2YBGA 4PW9A 3LS5L 4X4ZA 4AMWA 4F33B 3L5JA 5F3FA 1CD0A 2PPDA 3M1OA 1L9RA 3QNZB 2FBOJ 3N1QC 1KPRB 4IJ3C 4QTHA 4L37B 2E4FA 3MLVL 2YK1L 1VEOA 2ZUVA 4HX1B 1PD0A 3LAFA 3U46B 2CPUA 4GMTL 4TUOB 3DSNB 1BFVL 2NW2A 1UB6A 1M7XA 2SEBA 4N26A 5IVXB 5CJOH 1NAML 2F8XC 3DV4A 3HN8A 4P57A 3MCKB 3VFPB 3SE6A 1A7PH 2VR6A 2EEFA 3DO3A 1XSOA 4OB5L 5C0IB 4XNMA 4OCWH 4ODHL 1JWMA 3T4AB 5HGAB 3D8MA 3J7HA 1HCZA 5E00A 1RI6A 2EEXA 2JKXA 3GLZA 5JUEH 2YC1A 1HHJA 2BSSB 4MAUL 1LP9B 1Z66A 3POHA 2PO6A 3ZHDA 5C0FB 3PP4H 3RWFB 3VWJB 2CN3A 5CEYA 1DQJA 1NUDA 5HVFB 2APBA 4RGNB 1EPFA 3SKMA 2DN7A 1KJ2L 1Q9WB 3JQOB 1XHHA 1Q90A 3BPOB 4JO3H 1UZ8B 4OQTL 4Z7OF 4JY4A 5FA4B 1ZIBA 3AUWB 3NIDF 3BQUD 3OKOA 4ZTPL 1PYWB 3RGHA 2Y7NA 1SZNA 1GZHA 3ZTJG 3VFWB 2B4CL 1EO5A 1KIRB 4GGDA 1SN5A 3IE9A 2O1AA 2YEQA 3GSOA 1XD1A 3D3VA 2K8MA 3APCA 3VXSD 4HOXA 1MLCA 1I9RH 2EYSB 4G59C 4OZHA 5HTSA 5FYKU 4KOBA 3JWNH 2BNRE 1U8MA 4PRID 3O3AB 4DAGH 2Y7MA 1MHEB 1RZ7H 3KWUA 4ZAKC 5C0CA 1SUHA 4HS6A 3BDXA 4OD2A 3IU3B 3O6MH 1II4E 4KZDH 5I6LA 1HILA 2YD6A 5G4NA 5SWSA 4ZOAA 5E1QA 4HBQA 3CZEA 1AQ8A 3VB9A 1LO2H 3O8XD 3QDHA 5J4MA 4G55A 3AC0A 3KPLB 2FSDA 1S46A 2JK5B 4K7PX 4P2QD 2VDKH 4QLWA 1G9ML 4UQCA 3EGSA 4ANKA 4ZW6A 1QASA 5FLXg 1B6DA 5DRZA 4H8QA 1FVEA 1JN6B 1F4WH 4TVPH 4B97A 5A3IC 2D7NA 2FEJA 4G3YH 3JWOH 4W9EC 2X28A 5AG8A 3ARGD 4JGUA 1ZV2A 4AJ0A 1B0IA 2XA8H 3HBZA 3DARA 1CE1H 1VCBC 4QXUL 3BH8A 4RFOH 4Z7VF 4L4TB 3P0VL 3WN5A 1T6WA 4PD4K 5DWPA 3AQZA 5DJCB 3IGLA 1Z2KA 4YFDB 2C3WA 4M3KB 2DAVA 3B9VA 3OGOE 4M6ML 3QXAA 4O9HL 3GJEA 1A5FH 4OZIB 3FQXA 3ZTDC 5DC9B 4HWBH 2H47A 1GHFH 1WV7T 1Z6JT 4PYGA 2BNRB 2IH1A 1MI5E 1AZCA 5D7HA 3IURA 1QX1A 4WTZA 2HKHL 4XB7A 4J28A 2VOTA 3AS2A 3L16A 4HZ1A 1AXTL 5AW9B 3RMZD 4OCRH 1A2YB 3DOSA 3FH8A 1RZJL 4PRHD 2N01B 3WKPA 4IBTA 4XCCH 3ZYIA 2KZWA 4I88A 3GMOB 4ETQA 3QJTB 4XPFH 5ISZB 4MJ6B 1I3GH 1DQLH 3BRGC 1D9KB 2AQSA 5EEVA 1H3PL 2CJUH 4NRYA 3T2PA 3AMKA 5ABZA 4X99A 1WFJA 3VFUA 5I2IB 1OD9A 2MNUA 1UOLA 1M1XB 2ZUWA 5DK3A 5CD3A 1WDAA 1A7NH 3ECUA 4Y5RD 4JZOA 5JW4R 5I8EB 3VGGA 5KS9F 1KXQA 3ABZA 2EDQA 3WO4C 2HRHA 3C5XA 5FFOA 1S78D 4BM7A 2BLFA 3MV8E 1RHFA 2FO8A 3NTCH 5CCJA 4ONHA 4KNSA 4BCXA 3RRMC 3ZL4L 5GSAA 2C9SA 2XRAL 4GAGH 2Z2NA 5I71C 2CBPA 2KLRA 2OMYB 1J1XL 2HPTA 5KVFL 1CDYA 1G0DA 2VCOA 1YUKB 4NNPH 5AB1A 4K3DH 2PM6B 4D0CA 2IG2L 5C7ZA 4NWUL 4NIKB 4UT6A 3SDAC 4BELD 1WSST 3L3GA 2AFNA 3BPLC 3E2HC 1E9PB 4BZ2H 2I24N 4JY5L 4U6HA 3MRKA 1VFAB 2XX1A 3HI1B 4KX9A 4YVDA 3KGRA 4AGLA 1HAWA 1DVUA 1ZCRA 1I7UA 5DD5H 3HNVH 2DKUA 1PW3A 1XSJA 4YHNA 1VJSA 2AXFA 1KPUB 1NCIA 4HPOL 3ZE1B 4YSOA 2IWFA 3GMPA 1SQJA 4P3DB 5DD1H 3ZE0E 4U1GB 3WAKA 4UM8A 3DMMB 1ZHBA 2WXHA 4AX4A 2YZ8A 1CK0L 1LNUA 4JDEA 3LQZA 4ZAKD 4E9QA 4HUUA 4A6YB 1DLHB 1MFDH 1OE1A 3MRBA 3RJQB 3EWEA 3ZHKA 1TQWA 1G9EA 1YEFL 4POYA 1D5BB 2YD9A 3LHAA 4ZUWB 1HDMA 1E8NA 2ATKA 2ALWA 2PCFB 3KW8A 3JRPA 3JROA 3M17A 1OAKL 2HTKD 3MV8B 4NBMA 2PPAA 4EBQH 3VGZA 3V5KB 3RWEB 3CZUB 1JI1A 2HMID 4ZMLA 2DD8H 4JFDA 2AI0H 3FO1A 5EA0L 3L4MD 2VRKA 5A16A 4XCYA 4ABQA 3S8GB 2CE8A 5IVNA 3PE9A 4TOYL 1SQMA 1ZMYA 3RIAK 4BE5A 2Z31A 5IHUH 3O3DB 1QSFA 5IB5B 4PJ5D 1IQDB 4YQXH 4A0AA 4LASH 4PJCA 1H8NA 2NNAB 1IFHL 4P5TA 5CSBA 1GG2B 2L8AA 1ZSHA 1JOIA 1FFRA 3T2QA 5BUAA 3T2OA 1S3RA 4WY7H 1HEZB 3X12A 2M1KA 4OTXH 2GJRA 2HG5B 5C2VB 2ZWLT 4G71B 3SPGA 4R7DB 3V52H 2FB4L 5KYXB 2CH8A 1UD8A 1CZ8L 1FZKA 1PG7W 1XTLA 2K6YA 3NVQA 4FXGB 4N5EC 1L9QA 4NZTH 5EC1A 2XVKA 2WZPA 1NFKA 4UDTB