1GXRA

Wd40 region of human groucho/tle1
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
337
structure length
335
Chain Sequence
DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
publication title Crystal Structure of the C-Terminal Wd40 Repeat Domain of the Human Groucho/Tle1 Transcriptional Corepressor
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 335
sequence length 337
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1gxrA00
1B9YA 3EWEA 3V7DB 5CYKA 2H9PA 3EI4A 5I5JA 3CIKB 4XYIA 2H6QA 2B4EA 2B5LA 3VGZA 1SHYB 4ZOZA 4K3ID 4L9OA 2H6KA 5I5MA 5FQDA 4OWRA 3UVMA 1PBYB 4ES0A 2H6NA 4U7AA 3C99A 3UKRC 3I8EA 4J81A 4J8GA 2AQ5A 2AGWA 2IUQA 5THAA 2AGXA 3PSCB 3FGBA 4LG8A 4AOWA 3SMRA 4FWWA 4ZOYA 2MTAH 4O9DA 4ERYA 3DXKC 2AGZA 4PNKB 5GXIA 4LG9A 3SXTD 3SVWD 4Y5RD 3JRPA 4J78A 1SQJA 3IIYA 3RFHA 5EMLB 5AMSA 3I7OA 4BH6A 4FAVD 5HE1B 3OL2B 4XYHA 3N0EA 3OKYA 2GNQA 3J80g 3SN6B 1P22A 4QL1A 3SWSD 5JWZA 5IJ8E 2BBKH 4FA4D 2P9LC 3J81g 5A2Qg 3EG6A 5EALA 4GQ1A 5CXCB 3MKSB 4NSXA 2H9NA 3NVNA 4CY1A 4ZN4A 2BCJB 3VH0A 5KDOB 1Q47A 5CYKB 4FA9D 2I0RA 3UVKA 5IGQA 3EI4B 4GMBA 2P9NC 4O3UB 1GP2B 4FAND 3OKTA 2UZYB 2HKMA 4L1QD 3PVUB 4CI1A 5HE0B 2XU7A 4CZVA 4IA9A 3I7NA 3SCYA 2YB8B 4JT6C 5IT9g 4IMMA 1K32A 3RFGA 3IJ1A 2YMUA 3EI1A 1B9XA 1PEVA 3KRWB 4UI9R 2HESX 5FKRA 3AL8A 4QQEA 2HJ4A 3EU7A 2QXVA 4EWRA 4TZ4A 5H14A 4J0WA 4QRJA 5K19A 4ERQA 2OK4A 2YNPA 1TYQC 4FA5D 3UVOA 2CN2A 3L4OD 2I0SA 2EBSA 4CI8A 3ORVD 2XL2A 3JB9L 3DM0A 3EMHA 2CO0C 5TEEA 3OKYB 3RLMD 4CY3A 2OIZA 5I5IA 3CFVA 4GM9A 1R5MA 2IWFA 4J0XA 1RI6A 4J82A 3K26A 3PVWB 3IIWA 4PBYA 3JZHA 4A11A 3UVNA 3F3GA 4ZOVA 1N6FA 4L3GD 3RN1D 4JXMA 4J79A 5FKQA 2CN3A 5FXYA 3MMYA 1OMWB 3AL9A 3SFZA 4E5ZA 2W18A 4Z8LA 3SHFA 4J73A 2P9PC 1VYHC 4PBZA 4H5JA 2G9AA 3ODTA 5GMKn 5CXBA 5TEFA 3PSLA 4GGAA 4X3EA 2B5NA 4J84A 4A09A 4U1EI 3I2NA 2H13A 3I7HA 2G99A 3I7LA 4GQBB 2UZXB 2PM9A 3FM0A 1L0QA 5AJAA 2AGLA 3AL8B 3JROA 1XIPA 1GXRA 3AH8B 3FRXA 3RN0D 5EMMB 3C75H 2I3SA 5B4WA 3C5MA 4CC9A 1JJUB 3I7PA 1TBGA 4G56B 3B7FA 3IJ0A 3OTTA 4J86A 3VA6A 2I0TA 2TRCB 3PXWD 4GM3A 2H47A 1JOFA 4ESGA 4KFMB 4O1QD 2QC5A 2HKRA 3RRMC 2H14A 5HYNB 4E54A 4JSPC 4A0AA 2Z2PA 3NVQA 2P9KC 4O3TB 5EARA 2YBAA 3V5WB 2H68A 2PM7B 1XKSA 2Z2OA 1N6EA 4D0KA 4A0BA 4N14A 4X60B 1U2VC 4CI2A 5GSAA 4J87A 4A11B 3EI2A 4X61B 5EM2A 5C2VB 3MZLA 4A08A 3DSMA 3GFCA 2AH0A 1OLZA 3RSEC 4E5ZB 2YNNA 4PSWB 4J8BA 5CXBB 5HQGA 3PE7A 4PXWA 3BG1A 2IUPA 4MK0B 4A09B 3DXMC 3OW8A 2PM9B 4GZ8A 4LGNA 2OVPB 5EAPA 3JZNA 3UVLA 2I3TA 2Z2NA 2IUVA 2IAAA 3MZKA 1GG2B 3ULEC 2J56H 2OK6A 5K1CC 1NR0A 1A0RB 2PBIB 2OVQB 4PSXB 5EMKB 5H17A 2XYIA 3N0DA 2OJYA 5IGOA 3A0FA 1JMZB 5IC7A 4CZYA 1JMXB 3U4YA 3SBRA 2IURA 3PXSD 5GXHA 4ERZA 4FB1D 4J77A 2P9SC 5TDHB 4A2MA 1ERJA 4GQ2P 5EAMA 3ZWLB 4A0AB 4E54B 3L4MD 4JSNC 1PGUA 4H5IA 4CI3A 2B5MA 1K8KC 3AFCA 2J57G 4CY5A 4A0BB 2CE8A 3RMZD 3IKOA 3F3FA 2OVRB 1SQ9A 3IJCA 4ZOXA 2HJBA 1YFQA 3EI3A 3EI1B 1QNIA 5HE2B 3I7KA 4AEZA 3EI2B 4R7AB 4BUJC 3SJLD 5EM2B 2H9MA 4OZUA 4JSVC 2GC4A 3GREA 4A08B 3V9FA 4FA1D 4JD2C 3DWLC 5FKSA 2AGYA 4GGCA 3C9CA 4I79A 4PC0A 2YNOA 1MDAH 2HXCA 4CY2A 1U4CA 4X63B 1NEXB 2IWKA 5FLXg 5TF2A 4HDJA 3MXXA 4JSXC 5IJ7E 1PI6A 2P9IC 3UKUC 5C9ZB 1MG3A 4CZXA 1GOTB 5AFU3 3KRXB 4GM8A 3NVXA 2J55H 4GGDA 5SXMA 4BL0A 3MKQA 2AH1A 3UR4A 4FHLA 1S4UX 4JT5C 3W15A 4Y7RA 2XL3A 1FWXA 2P9UC 2CNXA 3JZGA 3OKWA 5HE3B 2GC7A 3K27A 5H1MA 1N6DA 3CFSB 3HFQA 2H3XA 3BG0A 4A2LA 2CE9A 2PM6B 3JAMg 3SBPA 4XEIC 3E0CA 3OL2A 4O45A 4D6VA 4QT8A 4K3JB 3I8CA 4A7JA 3SBQA 3I89A 3EI3B 3F3PA 3BWSA 1MG2A 3P4FA 5FKTA 5C2WB 2Q7QA 3SLED 4L3HD 2H9LA 2CO0A 2O9KA 5FA5B 2HYEA 3JPXA 5CXCA 1XHMA 5EMJB 3PXTD 4YVDA
chains in the Genus database with same CATH superfamily
1B9YA 3EWEA 3V7DB 5CYKA 2H9PA 3EI4A 5I5JA 4BCCA 3CIKB 4XYIA 2H6QA 2B4EA 2B5LA 3FCSA 3VGZA 1O6FA 1SHYB 4ZOZA 4K3ID 4L9OA 2H6KA 5I5MA 5FQDA 4OWRA 3UVMA 1PBYB 2VDMA 5C86A 4ES0A 2H6NA 4U7AA 3C99A 3UKRC 3I8EA 4J81A 4MMZA 3MVDK 4J8GA 3EQ8A 1T2XA 2AQ5A 2AGWA 2IUQA 5THAA 2AGXA 3PSCB 3FGBA 4LG8A 4G1EA 3SMRA 4AOWA 4FWWA 3NIFA 4ZOYA 2MTAH 4O9DA 4ERYA 3DXKC 2AGZA 4PNKB 5GXIA 4JHNA 4LG9A 3SXTD 3SVWD 4Y5RD 3V4VA 3JRPA 1YR2A 4J78A 4DNVA 1SQJA 3IIYA 3RFHA 5EMLB 5AMSA 3I7OA 3MUNA 4WJKA 4BH6A 1UOQA 4FAVD 5HE1B 3OL2B 4XYHA 4BCDA 3N0EA 3OKYA 2GNQA 3J80g 3SN6B 1P22A 4QL1A 3SWSD 5JWZA 5IJ8E 3O4HA 2BBKH 3QHYB 1QFMA 4FA4D 4D9SA 5M5VA 4WK4A 2P9LC 2VDNA 3J81g 5A2Qg 1TYEA 5M61A 3EG6A 5EALA 4GQ1A 1A12A 5CXCB 3MKSB 4NSXA 2H9NA 3NVNA 4CY1A 4ZN4A 2BCJB 3VH0A 5KDOB 1Q47A 5CYKB 4FA9D 2I0RA 3UVKA 5IGQA 3EI4B 4GMBA 4AN1A 2P9NC 4O3UB 4Z7OA 3EQ7A 1GP2B 4FAND 5E6SA 3OKTA 2UZYB 2HKMA 4L1QD 3PVUB 1I2MB 4CI1A 5HE0B 2XU7A 4BP9A 2JKXA 4CZVA 4IA9A 3I7NA 3SCYA 2YB8B 4JT6C 5IT9g 4IMMA 1K32A 3RFGA 3IJ1A 2YMUA 3EI1A 1B9XA 1VE6A 1PEVA 3KRWB 3K72A 4O2WA 3IUMA 2EIEA 4UI9R 2HESX 4L1MA 3K71A 5FKRA 3AL8A 4QQEA 2HJ4A 3EU7A 2QXVA 4EWRA 4WK0A 4TZ4A 1GOHA 5H14A 4J0WA 4QRJA 5K19A 4ERQA 2OK4A 2YNPA 4NBMA 1TYQC 4FA5D 2BKLA 3UVOA 2CN2A 3L4OD 2I0SA 2EBSA 4CI8A 3ORVD 2XL2A 3JB9L 5M5RA 3DM0A 3EMHA 2CO0C 4AMYA 5TEEA 3OKYB 3IJEA 3RLMD 4CY3A 2OIZA 5I5IA 3CFVA 4GM9A 1R5MA 2IWFA 4J0XA 3ZE1A 1RI6A 4NENA 4UM8A 3K6SA 4J82A 3K26A 3PVWB 3IIWA 4PBYA 3JZHA 4A11A 3ZDZA 1H2XA 3F3GA 4ZOVA 3UVNA 1N6FA 4L3GD 3RN1D 1E8NA 4JXMA 3OF7A 3V4PA 4J79A 5FKQA 2CN3A 5FXYA 3QI0A 3MMYA 1OMWB 3FCUA 3AL9A 3SFZA 4E5ZA 2W18A 4Z8LA 3SHFA 4J73A 2P9PC 1JTDB 2VDRA 1VYHC 4PBZA 4H5JA 2G9AA 3ODTA 5GMKn 5CXBA 5TEFA 1GOFA 1U8CA 3PSLA 3IUJA 4GGAA 4X3EA 4JHPC 2B5NA 4WK2A 3ZDYA 4J84A 4A09A 1M1XA 3I2NA 1VE7A 4U1EI 2H13A 4MMYA 3I7HA 3IUNA 2G99A 3I7LA 4GQBB 2UZXB 2PM9A 4AN0A 3FM0A 3O4IA 1L0QA 5AJAA 2AGLA 3EQ9A 3AL8B 3JROA 1XIPA 1GXRA 3AH8B 3FRXA 3RN0D 5EMMB 3C75H 1C9LA 2I3SA 5B4WA 3C5MA 4CC9A 1JJUB 4MMXA 3I7PA 3MUOA 1TBGA 4G56B 3B7FA 3IJ0A 1GOGA 3OTTA 4J86A 3VA6A 4BCBA 2I0TA 2TRCB 3PXWD 2QZPA 4GM3A 2H47A 1JOFA 4ESGA 4KFMB 4O1QD 2QC5A 3IURA 2HKRA 3RRMC 2H14A 5HYNB 4E54A 4JSPC 4A0AA 2Z2PA 3NVQA 2P9KC 4O3TB 5EARA 2YBAA 3V5WB 2H68A 4DNUA 2PM7B 1XKSA 2Z2OA 1N6EA 4D0KA 1E8MA 4N14A 4A0BA 4X60B 1VZ2A 1U2VC 4CI2A 5GSAA 4J87A 3GC3B 4A11B 3GD1I 5M5SA 1BPOA 3T3MA 2VZ1A 3EI2A 4X61B 5EM2A 3DDUA 4IRZA 5C2VB 2VDQA 1UOPA 2HU5A 3MZLA 4A08A 3DSMA 3GFCA 2AH0A 1OLZA 4G1MA 3RSEC 4YVDA 4E5ZB 3IVMA 2YNNA 2EIDA 5FFGA 4PSWB 4J8BA 5CXBB 5HQGA 3PE7A 3ZDXA 2VC2A 3O4GA 4PXWA 3BG1A 2IUPA 4MK0B 2EICA 3ZE0A 4A09B 3DXMC 3OW8A 2PM9B 4GZ8A 4LGNA 2OVPB 5EAPA 1K3IA 3JZNA 3UVLA 3IUQA 2I3TA 1H2ZA 2Z2NA 2IUVA 2IAAA 3MZKA 1GG2B 1C9IA 3ULEC 2J56H 2OK6A 1UTCA 5K1CC 1NR0A 1A0RB 2PBIB 2OVQB 4PSXB 5EMKB 3VI4A 5H17A 2XYIA 3N0DA 2OJYA 5IGOA 2XZGA 3A0FA 1JMZB 5IC7A 4CZYA 1JMXB 3U4YA 3SBRA 2IURA 3PXSD 5GXHA 4ERZA 4FB1D 4J77A 2P9SC 5TDHB 4A2MA 1ERJA 4GQ2P 4UM9A 5EAMA 3ZWLB 4A0AB 4E54B 3L4MD 2VZ3A 4JSNC 3ZE2A 1PGUA 4H5IA 4CI3A 2B5MA 1K8KC 3AFCA 2J57G 4CY5A 4A0BB 2CE8A 2QR5A 3IKOA 3RMZD 3F3FA 2OVRB 1SQ9A 3IJCA 4ZOXA 2HJBA 1YFQA 4RE6A 3EI3A 3EI1B 1QNIA 5HE2B 3I7KA 4AEZA 3EI2B 2XDWA 4R7AB 4BUJC 3SJLD 5EM2B 2H9MA 4OZUA 4JSVC 2GC4A 3GREA 4A08B 3VI3A 3V9FA 2WQ8A 4FA1D 4JD2C 3DWLC 5FKSA 2AGYA 4GGCA 4Z7QA 3C9CA 3NIDA 4I79A 4PC0A 4AMZA 2YNOA 1MDAH 2HXCA 4CY2A 1H2YA 5E6RA 1U4CA 4X63B 2VDPA 4DNWA 1NEXB 2IWKA 5FLXg 5TF2A 2HU7A 4BP8A 4HDJA 2EIBA 3MXXA 4JSXC 5HDBA 5IJ7E 1PI6A 2P9IC 2VDKA 1UOOA 4QAMA 3UKUC 3IULA 5C9ZB 1MG3A 5FFOA 4NC4A 4CZXA 1GOTB 5AFU3 3KRXB 3O4JA 3T3PA 4GM8A 3NVXA 2J55H 4GGDA 5SXMA 4BL0A 3MKQA 2AH1A 4RE5A 3UR4A 4FHLA 1S4UX 4JT5C 3W15A 4Y7RA 2XL3A 1FWXA 2P9UC 1VZ3A 2CNXA 3JZGA 3OKWA 5HE3B 2GC7A 2HU8A 3K27A 5H1MA 1N6DA 3CFSB 4Z7NA 3HFQA 2H3XA 3BG0A 4NAAA 4A2LA 5C92A 1QFSA 2CE9A 2PM6B 3JAMg 1E5TA 3SBPA 5E6UA 4XEIC 3E0CA 3OL2A 4O45A 4D6VA 4O02A 2VDOA 1JV2A 4QT8A 4K3JB 2VDLA 3I8CA 4AX4A 4A7JA 3SBQA 3I89A 2XE4A 3EI3B 3F3PA 1H2WA 3BWSA 1MG2A 3P4FA 5FKTA 5C2WB 4G55A 2Q7QA 1L5GA 3SLED 3KCIA 4L3HD 2H9LA 2CO0A 2O9KA 5FA5B 5M5UA 5M5TA 2HYEA 3JPXA 5CXCA 1XHMA 5EMJB 3PXTD 1O6GA 3NIGA
chains in the Genus database with same CATH topology
1B9YA 3EWEA 3V7DB 5CYKA 2H9PA 3EI4A 5I5JA 3CIKB 4XYIA 2H6QA 2B4EA 2B5LA 3VGZA 1SHYB 4ZOZA 4K3ID 4L9OA 2H6KA 5I5MA 5FQDA 4OWRA 3UVMA 1PBYB 4ES0A 2H6NA 4U7AA 3C99A 3UKRC 3I8EA 4J81A 4J8GA 2AQ5A 2AGWA 2IUQA 5THAA 2AGXA 3PSCB 3FGBA 4LG8A 4AOWA 3SMRA 4FWWA 4ZOYA 2MTAH 4O9DA 4ERYA 3DXKC 2AGZA 4PNKB 5GXIA 4LG9A 3SXTD 3SVWD 4Y5RD 3JRPA 4J78A 1SQJA 3IIYA 3RFHA 5EMLB 5AMSA 3I7OA 4BH6A 4FAVD 5HE1B 3OL2B 4XYHA 3N0EA 3OKYA 2GNQA 3J80g 3SN6B 1P22A 4QL1A 3SWSD 5JWZA 5IJ8E 2BBKH 4FA4D 2P9LC 3J81g 5A2Qg 3EG6A 5EALA 4GQ1A 5CXCB 3MKSB 4NSXA 2H9NA 3NVNA 4CY1A 4ZN4A 2BCJB 3VH0A 5KDOB 1Q47A 5CYKB 4FA9D 2I0RA 3UVKA 5IGQA 3EI4B 4GMBA 2P9NC 4O3UB 1GP2B 4FAND 3OKTA 2UZYB 2HKMA 4L1QD 3PVUB 4CI1A 5HE0B 2XU7A 4CZVA 4IA9A 3I7NA 3SCYA 2YB8B 4JT6C 5IT9g 4IMMA 1K32A 3RFGA 3IJ1A 2YMUA 3EI1A 1B9XA 1PEVA 3KRWB 4UI9R 2HESX 5FKRA 3AL8A 4QQEA 2HJ4A 3EU7A 2QXVA 4EWRA 4TZ4A 5H14A 4J0WA 4QRJA 5K19A 4ERQA 2OK4A 2YNPA 1TYQC 4FA5D 3UVOA 2CN2A 3L4OD 2I0SA 2EBSA 4CI8A 3ORVD 2XL2A 3JB9L 3DM0A 3EMHA 2CO0C 5TEEA 3OKYB 3RLMD 4CY3A 2OIZA 5I5IA 3CFVA 4GM9A 1R5MA 2IWFA 4J0XA 1RI6A 4J82A 3K26A 3PVWB 3IIWA 4PBYA 3JZHA 4A11A 3UVNA 3F3GA 4ZOVA 1N6FA 4L3GD 3RN1D 4JXMA 4J79A 5FKQA 2CN3A 5FXYA 3MMYA 1OMWB 3AL9A 3SFZA 4E5ZA 2W18A 4Z8LA 3SHFA 4J73A 2P9PC 1VYHC 4PBZA 4H5JA 2G9AA 3ODTA 5GMKn 5CXBA 5TEFA 3PSLA 4GGAA 4X3EA 2B5NA 4J84A 4A09A 4U1EI 3I2NA 2H13A 3I7HA 2G99A 3I7LA 4GQBB 2UZXB 2PM9A 3FM0A 1L0QA 5AJAA 2AGLA 3AL8B 3JROA 1XIPA 1GXRA 3AH8B 3FRXA 3RN0D 5EMMB 3C75H 2I3SA 5B4WA 3C5MA 4CC9A 1JJUB 3I7PA 1TBGA 4G56B 3B7FA 3IJ0A 3OTTA 4J86A 3VA6A 2I0TA 2TRCB 3PXWD 4GM3A 2H47A 1JOFA 4ESGA 4KFMB 4O1QD 2QC5A 2HKRA 3RRMC 2H14A 5HYNB 4E54A 4JSPC 4A0AA 2Z2PA 3NVQA 2P9KC 4O3TB 5EARA 2YBAA 3V5WB 2H68A 2PM7B 1XKSA 2Z2OA 1N6EA 4D0KA 4A0BA 4N14A 4X60B 1U2VC 4CI2A 5GSAA 4J87A 4A11B 3EI2A 4X61B 5EM2A 5C2VB 3MZLA 4A08A 3DSMA 3GFCA 2AH0A 1OLZA 3RSEC 4E5ZB 2YNNA 4PSWB 4J8BA 5CXBB 5HQGA 3PE7A 4PXWA 3BG1A 2IUPA 4MK0B 4A09B 3DXMC 3OW8A 2PM9B 4GZ8A 4LGNA 2OVPB 5EAPA 3JZNA 3UVLA 2I3TA 2Z2NA 2IUVA 2IAAA 3MZKA 1GG2B 3ULEC 2J56H 2OK6A 5K1CC 1NR0A 1A0RB 2PBIB 2OVQB 4PSXB 5EMKB 5H17A 2XYIA 3N0DA 2OJYA 5IGOA 3A0FA 1JMZB 5IC7A 4CZYA 1JMXB 3U4YA 3SBRA 2IURA 3PXSD 5GXHA 4ERZA 4FB1D 4J77A 2P9SC 5TDHB 4A2MA 1ERJA 4GQ2P 5EAMA 3ZWLB 4A0AB 4E54B 3L4MD 4JSNC 1PGUA 4H5IA 4CI3A 2B5MA 1K8KC 3AFCA 2J57G 4CY5A 4A0BB 2CE8A 3RMZD 3IKOA 3F3FA 2OVRB 1SQ9A 3IJCA 4ZOXA 2HJBA 1YFQA 3EI3A 3EI1B 1QNIA 5HE2B 3I7KA 4AEZA 3EI2B 4R7AB 4BUJC 3SJLD 5EM2B 2H9MA 4OZUA 4JSVC 2GC4A 3GREA 4A08B 3V9FA 4FA1D 4JD2C 3DWLC 5FKSA 2AGYA 4GGCA 3C9CA 4I79A 4PC0A 2YNOA 1MDAH 2HXCA 4CY2A 1U4CA 4X63B 1NEXB 2IWKA 5FLXg 5TF2A 4HDJA 3MXXA 4JSXC 5IJ7E 1PI6A 2P9IC 3UKUC 5C9ZB 1MG3A 4CZXA 1GOTB 5AFU3 3KRXB 4GM8A 3NVXA 2J55H 4GGDA 5SXMA 4BL0A 3MKQA 2AH1A 3UR4A 4FHLA 1S4UX 4JT5C 3W15A 4Y7RA 2XL3A 1FWXA 2P9UC 2CNXA 3JZGA 3OKWA 5HE3B 2GC7A 3K27A 5H1MA 1N6DA 3CFSB 3HFQA 2H3XA 3BG0A 4A2LA 2CE9A 2PM6B 3JAMg 3SBPA 4XEIC 3E0CA 3OL2A 4O45A 4D6VA 4QT8A 4K3JB 3I8CA 4A7JA 3SBQA 3I89A 3EI3B 3F3PA 3BWSA 1MG2A 3P4FA 5FKTA 5C2WB 2Q7QA 3SLED 4L3HD 2H9LA 2CO0A 2O9KA 5FA5B 2HYEA 3JPXA 5CXCA 1XHMA 5EMJB 3PXTD 4YVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9Y A;  3EWE A;  3V7D B;  5CYK A;  2H9P A;  3EI4 A;  5I5J A;  3CIK B;  4XYI A;  2H6Q A;  2B4E A;  2B5L A;  3VGZ A;  1SHY B;  4ZOZ A;  4K3I D;  4L9O A;  2H6K A;  5I5M A;  5FQD A;  4OWR A;  3UVM A;  1PBY B;  4ES0 A;  2H6N A;  4U7A A;  3C99 A;  3UKR C;  3I8E A;  4J81 A;  4J8G A;  2AQ5 A;  2AGW A;  2IUQ A;  5THA A;  2AGX A;  3PSC B;  3FGB A;  4LG8 A;  4AOW A;  3SMR A;  4FWW A;  4ZOY A;  2MTA H;  4O9D A;  4ERY A;  3DXK C;  2AGZ A;  4PNK B;  5GXI A;  4LG9 A;  3SXT D;  3SVW D;  4Y5R D;  3JRP A;  4J78 A;  1SQJ A;  3IIY A;  3RFH A;  5EML B;  5AMS A;  3I7O A;  4BH6 A;  4FAV D;  5HE1 B;  3OL2 B;  4XYH A;  3N0E A;  3OKY A;  2GNQ A;  3J80 g;  3SN6 B;  1P22 A;  4QL1 A;  3SWS D;  5JWZ A;  5IJ8 E;  2BBK H;  4FA4 D;  2P9L C;  3J81 g;  5A2Q g;  3EG6 A;  5EAL A;  4GQ1 A;  5CXC B;  3MKS B;  4NSX A;  2H9N A;  3NVN A;  4CY1 A;  4ZN4 A;  2BCJ B;  3VH0 A;  5KDO B;  1Q47 A;  5CYK B;  4FA9 D;  2I0R A;  3UVK A;  5IGQ A;  3EI4 B;  4GMB A;  2P9N C;  4O3U B;  1GP2 B;  4FAN D;  3OKT A;  2UZY B;  2HKM A;  4L1Q D;  3PVU B;  4CI1 A;  5HE0 B;  2XU7 A;  4CZV A;  4IA9 A;  3I7N A;  3SCY A;  2YB8 B;  4JT6 C;  5IT9 g;  4IMM A;  1K32 A;  3RFG A;  3IJ1 A;  2YMU A;  3EI1 A;  1B9X A;  1PEV A;  3KRW B;  4UI9 R;  2HES X;  5FKR A;  3AL8 A;  4QQE A;  2HJ4 A;  3EU7 A;  2QXV A;  4EWR A;  4TZ4 A;  5H14 A;  4J0W A;  4QRJ A;  5K19 A;  4ERQ A;  2OK4 A;  2YNP A;  1TYQ C;  4FA5 D;  3UVO A;  2CN2 A;  3L4O D;  2I0S A;  2EBS A;  4CI8 A;  3ORV D;  2XL2 A;  3JB9 L;  3DM0 A;  3EMH A;  2CO0 C;  5TEE A;  3OKY B;  3RLM D;  4CY3 A;  2OIZ A;  5I5I A;  3CFV A;  4GM9 A;  1R5M A;  2IWF A;  4J0X A;  1RI6 A;  4J82 A;  3K26 A;  3PVW B;  3IIW A;  4PBY A;  3JZH A;  4A11 A;  3UVN A;  3F3G A;  4ZOV A;  1N6F A;  4L3G D;  3RN1 D;  4JXM A;  4J79 A;  5FKQ A;  2CN3 A;  5FXY A;  3MMY A;  1OMW B;  3AL9 A;  3SFZ A;  4E5Z A;  2W18 A;  4Z8L A;  3SHF A;  4J73 A;  2P9P C;  1VYH C;  4PBZ A;  4H5J A;  2G9A A;  3ODT A;  5GMK n;  5CXB A;  5TEF A;  3PSL A;  4GGA A;  4X3E A;  2B5N A;  4J84 A;  4A09 A;  4U1E I;  3I2N A;  2H13 A;  3I7H A;  2G99 A;  3I7L A;  4GQB B;  2UZX B;  2PM9 A;  3FM0 A;  1L0Q A;  5AJA A;  2AGL A;  3AL8 B;  3JRO A;  1XIP A;  1GXR A;  3AH8 B;  3FRX A;  3RN0 D;  5EMM B;  3C75 H;  2I3S A;  5B4W A;  3C5M A;  4CC9 A;  1JJU B;  3I7P A;  1TBG A;  4G56 B;  3B7F A;  3IJ0 A;  3OTT A;  4J86 A;  3VA6 A;  2I0T A;  2TRC B;  3PXW D;  4GM3 A;  2H47 A;  1JOF A;  4ESG A;  4KFM B;  4O1Q D;  2QC5 A;  2HKR A;  3RRM C;  2H14 A;  5HYN B;  4E54 A;  4JSP C;  4A0A A;  2Z2P A;  3NVQ A;  2P9K C;  4O3T B;  5EAR A;  2YBA A;  3V5W B;  2H68 A;  2PM7 B;  1XKS A;  2Z2O A;  1N6E A;  4D0K A;  4A0B A;  4N14 A;  4X60 B;  1U2V C;  4CI2 A;  5GSA A;  4J87 A;  4A11 B;  3EI2 A;  4X61 B;  5EM2 A;  5C2V B;  3MZL A;  4A08 A;  3DSM A;  3GFC A;  2AH0 A;  1OLZ A;  3RSE C;  4E5Z B;  2YNN A;  4PSW B;  4J8B A;  5CXB B;  5HQG A;  3PE7 A;  4PXW A;  3BG1 A;  2IUP A;  4MK0 B;  4A09 B;  3DXM C;  3OW8 A;  2PM9 B;  4GZ8 A;  4LGN A;  2OVP B;  5EAP A;  3JZN A;  3UVL A;  2I3T A;  2Z2N A;  2IUV A;  2IAA A;  3MZK A;  1GG2 B;  3ULE C;  2J56 H;  2OK6 A;  5K1C C;  1NR0 A;  1A0R B;  2PBI B;  2OVQ B;  4PSX B;  5EMK B;  5H17 A;  2XYI A;  3N0D A;  2OJY A;  5IGO A;  3A0F A;  1JMZ B;  5IC7 A;  4CZY A;  1JMX B;  3U4Y A;  3SBR A;  2IUR A;  3PXS D;  5GXH A;  4ERZ A;  4FB1 D;  4J77 A;  2P9S C;  5TDH B;  4A2M A;  1ERJ A;  4GQ2 P;  5EAM A;  3ZWL B;  4A0A B;  4E54 B;  3L4M D;  4JSN C;  1PGU A;  4H5I A;  4CI3 A;  2B5M A;  1K8K C;  3AFC A;  2J57 G;  4CY5 A;  4A0B B;  2CE8 A;  3RMZ D;  3IKO A;  3F3F A;  2OVR B;  1SQ9 A;  3IJC A;  4ZOX A;  2HJB A;  1YFQ A;  3EI3 A;  3EI1 B;  1QNI A;  5HE2 B;  3I7K A;  4AEZ A;  3EI2 B;  4R7A B;  4BUJ C;  3SJL D;  5EM2 B;  2H9M A;  4OZU A;  4JSV C;  2GC4 A;  3GRE A;  4A08 B;  3V9F A;  4FA1 D;  4JD2 C;  3DWL C;  5FKS A;  2AGY A;  4GGC A;  3C9C A;  4I79 A;  4PC0 A;  2YNO A;  1MDA H;  2HXC A;  4CY2 A;  1U4C A;  4X63 B;  1NEX B;  2IWK A;  5FLX g;  5TF2 A;  4HDJ A;  3MXX A;  4JSX C;  5IJ7 E;  1PI6 A;  2P9I C;  3UKU C;  5C9Z B;  1MG3 A;  4CZX A;  1GOT B;  5AFU 3;  3KRX B;  4GM8 A;  3NVX A;  2J55 H;  4GGD A;  5SXM A;  4BL0 A;  3MKQ A;  2AH1 A;  3UR4 A;  4FHL A;  1S4U X;  4JT5 C;  3W15 A;  4Y7R A;  2XL3 A;  1FWX A;  2P9U C;  2CNX A;  3JZG A;  3OKW A;  5HE3 B;  2GC7 A;  3K27 A;  5H1M A;  1N6D A;  3CFS B;  3HFQ A;  2H3X A;  3BG0 A;  4A2L A;  2CE9 A;  2PM6 B;  3JAM g;  3SBP A;  4XEI C;  3E0C A;  3OL2 A;  4O45 A;  4D6V A;  4QT8 A;  4K3J B;  3I8C A;  4A7J A;  3SBQ A;  3I89 A;  3EI3 B;  3F3P A;  3BWS A;  1MG2 A;  3P4F A;  5FKT A;  5C2W B;  2Q7Q A;  3SLE D;  4L3H D;  2H9L A;  2CO0 A;  2O9K A;  5FA5 B;  2HYE A;  3JPX A;  5CXC A;  1XHM A;  5EMJ B;  3PXT D;  4YVD A; 
#chains in the Genus database with same CATH topology
 1B9Y A;  3EWE A;  3V7D B;  5CYK A;  2H9P A;  3EI4 A;  5I5J A;  4BCC A;  3CIK B;  4XYI A;  2H6Q A;  2B4E A;  2B5L A;  3FCS A;  3VGZ A;  1O6F A;  1SHY B;  4ZOZ A;  4K3I D;  4L9O A;  2H6K A;  5I5M A;  5FQD A;  4OWR A;  3UVM A;  1PBY B;  2VDM A;  5C86 A;  4ES0 A;  2H6N A;  4U7A A;  3C99 A;  3UKR C;  3I8E A;  4J81 A;  4MMZ A;  3MVD K;  4J8G A;  3EQ8 A;  1T2X A;  2AQ5 A;  2AGW A;  2IUQ A;  5THA A;  2AGX A;  3PSC B;  3FGB A;  4LG8 A;  4G1E A;  3SMR A;  4AOW A;  4FWW A;  3NIF A;  4ZOY A;  2MTA H;  4O9D A;  4ERY A;  3DXK C;  2AGZ A;  4PNK B;  5GXI A;  4JHN A;  4LG9 A;  3SXT D;  3SVW D;  4Y5R D;  3V4V A;  3JRP A;  1YR2 A;  4J78 A;  4DNV A;  1SQJ A;  3IIY A;  3RFH A;  5EML B;  5AMS A;  3I7O A;  3MUN A;  4WJK A;  4BH6 A;  1UOQ A;  4FAV D;  5HE1 B;  3OL2 B;  4XYH A;  4BCD A;  3N0E A;  3OKY A;  2GNQ A;  3J80 g;  3SN6 B;  1P22 A;  4QL1 A;  3SWS D;  5JWZ A;  5IJ8 E;  3O4H A;  2BBK H;  3QHY B;  1QFM A;  4FA4 D;  4D9S A;  5M5V A;  4WK4 A;  2P9L C;  2VDN A;  3J81 g;  5A2Q g;  1TYE A;  5M61 A;  3EG6 A;  5EAL A;  4GQ1 A;  1A12 A;  5CXC B;  3MKS B;  4NSX A;  2H9N A;  3NVN A;  4CY1 A;  4ZN4 A;  2BCJ B;  3VH0 A;  5KDO B;  1Q47 A;  5CYK B;  4FA9 D;  2I0R A;  3UVK A;  5IGQ A;  3EI4 B;  4GMB A;  4AN1 A;  2P9N C;  4O3U B;  4Z7O A;  3EQ7 A;  1GP2 B;  4FAN D;  5E6S A;  3OKT A;  2UZY B;  2HKM A;  4L1Q D;  3PVU B;  1I2M B;  4CI1 A;  5HE0 B;  2XU7 A;  4BP9 A;  2JKX A;  4CZV A;  4IA9 A;  3I7N A;  3SCY A;  2YB8 B;  4JT6 C;  5IT9 g;  4IMM A;  1K32 A;  3RFG A;  3IJ1 A;  2YMU A;  3EI1 A;  1B9X A;  1VE6 A;  1PEV A;  3KRW B;  3K72 A;  4O2W A;  3IUM A;  2EIE A;  4UI9 R;  2HES X;  4L1M A;  3K71 A;  5FKR A;  3AL8 A;  4QQE A;  2HJ4 A;  3EU7 A;  2QXV A;  4EWR A;  4WK0 A;  4TZ4 A;  1GOH A;  5H14 A;  4J0W A;  4QRJ A;  5K19 A;  4ERQ A;  2OK4 A;  2YNP A;  4NBM A;  1TYQ C;  4FA5 D;  2BKL A;  3UVO A;  2CN2 A;  3L4O D;  2I0S A;  2EBS A;  4CI8 A;  3ORV D;  2XL2 A;  3JB9 L;  5M5R A;  3DM0 A;  3EMH A;  2CO0 C;  4AMY A;  5TEE A;  3OKY B;  3IJE A;  3RLM D;  4CY3 A;  2OIZ A;  5I5I A;  3CFV A;  4GM9 A;  1R5M A;  2IWF A;  4J0X A;  3ZE1 A;  1RI6 A;  4NEN A;  4UM8 A;  3K6S A;  4J82 A;  3K26 A;  3PVW B;  3IIW A;  4PBY A;  3JZH A;  4A11 A;  3ZDZ A;  1H2X A;  3F3G A;  4ZOV A;  3UVN A;  1N6F A;  4L3G D;  3RN1 D;  1E8N A;  4JXM A;  3OF7 A;  3V4P A;  4J79 A;  5FKQ A;  2CN3 A;  5FXY A;  3QI0 A;  3MMY A;  1OMW B;  3FCU A;  3AL9 A;  3SFZ A;  4E5Z A;  2W18 A;  4Z8L A;  3SHF A;  4J73 A;  2P9P C;  1JTD B;  2VDR A;  1VYH C;  4PBZ A;  4H5J A;  2G9A A;  3ODT A;  5GMK n;  5CXB A;  5TEF A;  1GOF A;  1U8C A;  3PSL A;  3IUJ A;  4GGA A;  4X3E A;  4JHP C;  2B5N A;  4WK2 A;  3ZDY A;  4J84 A;  4A09 A;  1M1X A;  3I2N A;  1VE7 A;  4U1E I;  2H13 A;  4MMY A;  3I7H A;  3IUN A;  2G99 A;  3I7L A;  4GQB B;  2UZX B;  2PM9 A;  4AN0 A;  3FM0 A;  3O4I A;  1L0Q A;  5AJA A;  2AGL A;  3EQ9 A;  3AL8 B;  3JRO A;  1XIP A;  1GXR A;  3AH8 B;  3FRX A;  3RN0 D;  5EMM B;  3C75 H;  1C9L A;  2I3S A;  5B4W A;  3C5M A;  4CC9 A;  1JJU B;  4MMX A;  3I7P A;  3MUO A;  1TBG A;  4G56 B;  3B7F A;  3IJ0 A;  1GOG A;  3OTT A;  4J86 A;  3VA6 A;  4BCB A;  2I0T A;  2TRC B;  3PXW D;  2QZP A;  4GM3 A;  2H47 A;  1JOF A;  4ESG A;  4KFM B;  4O1Q D;  2QC5 A;  3IUR A;  2HKR A;  3RRM C;  2H14 A;  5HYN B;  4E54 A;  4JSP C;  4A0A A;  2Z2P A;  3NVQ A;  2P9K C;  4O3T B;  5EAR A;  2YBA A;  3V5W B;  2H68 A;  4DNU A;  2PM7 B;  1XKS A;  2Z2O A;  1N6E A;  4D0K A;  1E8M A;  4N14 A;  4A0B A;  4X60 B;  1VZ2 A;  1U2V C;  4CI2 A;  5GSA A;  4J87 A;  3GC3 B;  4A11 B;  3GD1 I;  5M5S A;  1BPO A;  3T3M A;  2VZ1 A;  3EI2 A;  4X61 B;  5EM2 A;  3DDU A;  4IRZ A;  5C2V B;  2VDQ A;  1UOP A;  2HU5 A;  3MZL A;  4A08 A;  3DSM A;  3GFC A;  2AH0 A;  1OLZ A;  4G1M A;  3RSE C;  4YVD A;  4E5Z B;  3IVM A;  2YNN A;  2EID A;  5FFG A;  4PSW B;  4J8B A;  5CXB B;  5HQG A;  3PE7 A;  3ZDX A;  2VC2 A;  3O4G A;  4PXW A;  3BG1 A;  2IUP A;  4MK0 B;  2EIC A;  3ZE0 A;  4A09 B;  3DXM C;  3OW8 A;  2PM9 B;  4GZ8 A;  4LGN A;  2OVP B;  5EAP A;  1K3I A;  3JZN A;  3UVL A;  3IUQ A;  2I3T A;  1H2Z A;  2Z2N A;  2IUV A;  2IAA A;  3MZK A;  1GG2 B;  1C9I A;  3ULE C;  2J56 H;  2OK6 A;  1UTC A;  5K1C C;  1NR0 A;  1A0R B;  2PBI B;  2OVQ B;  4PSX B;  5EMK B;  3VI4 A;  5H17 A;  2XYI A;  3N0D A;  2OJY A;  5IGO A;  2XZG A;  3A0F A;  1JMZ B;  5IC7 A;  4CZY A;  1JMX B;  3U4Y A;  3SBR A;  2IUR A;  3PXS D;  5GXH A;  4ERZ A;  4FB1 D;  4J77 A;  2P9S C;  5TDH B;  4A2M A;  1ERJ A;  4GQ2 P;  4UM9 A;  5EAM A;  3ZWL B;  4A0A B;  4E54 B;  3L4M D;  2VZ3 A;  4JSN C;  3ZE2 A;  1PGU A;  4H5I A;  4CI3 A;  2B5M A;  1K8K C;  3AFC A;  2J57 G;  4CY5 A;  4A0B B;  2CE8 A;  2QR5 A;  3IKO A;  3RMZ D;  3F3F A;  2OVR B;  1SQ9 A;  3IJC A;  4ZOX A;  2HJB A;  1YFQ A;  4RE6 A;  3EI3 A;  3EI1 B;  1QNI A;  5HE2 B;  3I7K A;  4AEZ A;  3EI2 B;  2XDW A;  4R7A B;  4BUJ C;  3SJL D;  5EM2 B;  2H9M A;  4OZU A;  4JSV C;  2GC4 A;  3GRE A;  4A08 B;  3VI3 A;  3V9F A;  2WQ8 A;  4FA1 D;  4JD2 C;  3DWL C;  5FKS A;  2AGY A;  4GGC A;  4Z7Q A;  3C9C A;  3NID A;  4I79 A;  4PC0 A;  4AMZ A;  2YNO A;  1MDA H;  2HXC A;  4CY2 A;  1H2Y A;  5E6R A;  1U4C A;  4X63 B;  2VDP A;  4DNW A;  1NEX B;  2IWK A;  5FLX g;  5TF2 A;  2HU7 A;  4BP8 A;  4HDJ A;  2EIB A;  3MXX A;  4JSX C;  5HDB A;  5IJ7 E;  1PI6 A;  2P9I C;  2VDK A;  1UOO A;  4QAM A;  3UKU C;  3IUL A;  5C9Z B;  1MG3 A;  5FFO A;  4NC4 A;  4CZX A;  1GOT B;  5AFU 3;  3KRX B;  3O4J A;  3T3P A;  4GM8 A;  3NVX A;  2J55 H;  4GGD A;  5SXM A;  4BL0 A;  3MKQ A;  2AH1 A;  4RE5 A;  3UR4 A;  4FHL A;  1S4U X;  4JT5 C;  3W15 A;  4Y7R A;  2XL3 A;  1FWX A;  2P9U C;  1VZ3 A;  2CNX A;  3JZG A;  3OKW A;  5HE3 B;  2GC7 A;  2HU8 A;  3K27 A;  5H1M A;  1N6D A;  3CFS B;  4Z7N A;  3HFQ A;  2H3X A;  3BG0 A;  4NAA A;  4A2L A;  5C92 A;  1QFS A;  2CE9 A;  2PM6 B;  3JAM g;  1E5T A;  3SBP A;  5E6U A;  4XEI C;  3E0C A;  3OL2 A;  4O45 A;  4D6V A;  4O02 A;  2VDO A;  1JV2 A;  4QT8 A;  4K3J B;  2VDL A;  3I8C A;  4AX4 A;  4A7J A;  3SBQ A;  3I89 A;  2XE4 A;  3EI3 B;  3F3P A;  1H2W A;  3BWS A;  1MG2 A;  3P4F A;  5FKT A;  5C2W B;  4G55 A;  2Q7Q A;  1L5G A;  3SLE D;  3KCI A;  4L3H D;  2H9L A;  2CO0 A;  2O9K A;  5FA5 B;  5M5U A;  5M5T A;  2HYE A;  3JPX A;  5CXC A;  1XHM A;  5EMJ B;  3PXT D;  1O6G A;  3NIG A; 
#chains in the Genus database with same CATH homology
 1B9Y A;  3EWE A;  3V7D B;  5CYK A;  2H9P A;  3EI4 A;  5I5J A;  3CIK B;  4XYI A;  2H6Q A;  2B4E A;  2B5L A;  3VGZ A;  1SHY B;  4ZOZ A;  4K3I D;  4L9O A;  2H6K A;  5I5M A;  5FQD A;  4OWR A;  3UVM A;  1PBY B;  4ES0 A;  2H6N A;  4U7A A;  3C99 A;  3UKR C;  3I8E A;  4J81 A;  4J8G A;  2AQ5 A;  2AGW A;  2IUQ A;  5THA A;  2AGX A;  3PSC B;  3FGB A;  4LG8 A;  4AOW A;  3SMR A;  4FWW A;  4ZOY A;  2MTA H;  4O9D A;  4ERY A;  3DXK C;  2AGZ A;  4PNK B;  5GXI A;  4LG9 A;  3SXT D;  3SVW D;  4Y5R D;  3JRP A;  4J78 A;  1SQJ A;  3IIY A;  3RFH A;  5EML B;  5AMS A;  3I7O A;  4BH6 A;  4FAV D;  5HE1 B;  3OL2 B;  4XYH A;  3N0E A;  3OKY A;  2GNQ A;  3J80 g;  3SN6 B;  1P22 A;  4QL1 A;  3SWS D;  5JWZ A;  5IJ8 E;  2BBK H;  4FA4 D;  2P9L C;  3J81 g;  5A2Q g;  3EG6 A;  5EAL A;  4GQ1 A;  5CXC B;  3MKS B;  4NSX A;  2H9N A;  3NVN A;  4CY1 A;  4ZN4 A;  2BCJ B;  3VH0 A;  5KDO B;  1Q47 A;  5CYK B;  4FA9 D;  2I0R A;  3UVK A;  5IGQ A;  3EI4 B;  4GMB A;  2P9N C;  4O3U B;  1GP2 B;  4FAN D;  3OKT A;  2UZY B;  2HKM A;  4L1Q D;  3PVU B;  4CI1 A;  5HE0 B;  2XU7 A;  4CZV A;  4IA9 A;  3I7N A;  3SCY A;  2YB8 B;  4JT6 C;  5IT9 g;  4IMM A;  1K32 A;  3RFG A;  3IJ1 A;  2YMU A;  3EI1 A;  1B9X A;  1PEV A;  3KRW B;  4UI9 R;  2HES X;  5FKR A;  3AL8 A;  4QQE A;  2HJ4 A;  3EU7 A;  2QXV A;  4EWR A;  4TZ4 A;  5H14 A;  4J0W A;  4QRJ A;  5K19 A;  4ERQ A;  2OK4 A;  2YNP A;  1TYQ C;  4FA5 D;  3UVO A;  2CN2 A;  3L4O D;  2I0S A;  2EBS A;  4CI8 A;  3ORV D;  2XL2 A;  3JB9 L;  3DM0 A;  3EMH A;  2CO0 C;  5TEE A;  3OKY B;  3RLM D;  4CY3 A;  2OIZ A;  5I5I A;  3CFV A;  4GM9 A;  1R5M A;  2IWF A;  4J0X A;  1RI6 A;  4J82 A;  3K26 A;  3PVW B;  3IIW A;  4PBY A;  3JZH A;  4A11 A;  3UVN A;  3F3G A;  4ZOV A;  1N6F A;  4L3G D;  3RN1 D;  4JXM A;  4J79 A;  5FKQ A;  2CN3 A;  5FXY A;  3MMY A;  1OMW B;  3AL9 A;  3SFZ A;  4E5Z A;  2W18 A;  4Z8L A;  3SHF A;  4J73 A;  2P9P C;  1VYH C;  4PBZ A;  4H5J A;  2G9A A;  3ODT A;  5GMK n;  5CXB A;  5TEF A;  3PSL A;  4GGA A;  4X3E A;  2B5N A;  4J84 A;  4A09 A;  4U1E I;  3I2N A;  2H13 A;  3I7H A;  2G99 A;  3I7L A;  4GQB B;  2UZX B;  2PM9 A;  3FM0 A;  1L0Q A;  5AJA A;  2AGL A;  3AL8 B;  3JRO A;  1XIP A;  1GXR A;  3AH8 B;  3FRX A;  3RN0 D;  5EMM B;  3C75 H;  2I3S A;  5B4W A;  3C5M A;  4CC9 A;  1JJU B;  3I7P A;  1TBG A;  4G56 B;  3B7F A;  3IJ0 A;  3OTT A;  4J86 A;  3VA6 A;  2I0T A;  2TRC B;  3PXW D;  4GM3 A;  2H47 A;  1JOF A;  4ESG A;  4KFM B;  4O1Q D;  2QC5 A;  2HKR A;  3RRM C;  2H14 A;  5HYN B;  4E54 A;  4JSP C;  4A0A A;  2Z2P A;  3NVQ A;  2P9K C;  4O3T B;  5EAR A;  2YBA A;  3V5W B;  2H68 A;  2PM7 B;  1XKS A;  2Z2O A;  1N6E A;  4D0K A;  4A0B A;  4N14 A;  4X60 B;  1U2V C;  4CI2 A;  5GSA A;  4J87 A;  4A11 B;  3EI2 A;  4X61 B;  5EM2 A;  5C2V B;  3MZL A;  4A08 A;  3DSM A;  3GFC A;  2AH0 A;  1OLZ A;  3RSE C;  4E5Z B;  2YNN A;  4PSW B;  4J8B A;  5CXB B;  5HQG A;  3PE7 A;  4PXW A;  3BG1 A;  2IUP A;  4MK0 B;  4A09 B;  3DXM C;  3OW8 A;  2PM9 B;  4GZ8 A;  4LGN A;  2OVP B;  5EAP A;  3JZN A;  3UVL A;  2I3T A;  2Z2N A;  2IUV A;  2IAA A;  3MZK A;  1GG2 B;  3ULE C;  2J56 H;  2OK6 A;  5K1C C;  1NR0 A;  1A0R B;  2PBI B;  2OVQ B;  4PSX B;  5EMK B;  5H17 A;  2XYI A;  3N0D A;  2OJY A;  5IGO A;  3A0F A;  1JMZ B;  5IC7 A;  4CZY A;  1JMX B;  3U4Y A;  3SBR A;  2IUR A;  3PXS D;  5GXH A;  4ERZ A;  4FB1 D;  4J77 A;  2P9S C;  5TDH B;  4A2M A;  1ERJ A;  4GQ2 P;  5EAM A;  3ZWL B;  4A0A B;  4E54 B;  3L4M D;  4JSN C;  1PGU A;  4H5I A;  4CI3 A;  2B5M A;  1K8K C;  3AFC A;  2J57 G;  4CY5 A;  4A0B B;  2CE8 A;  3RMZ D;  3IKO A;  3F3F A;  2OVR B;  1SQ9 A;  3IJC A;  4ZOX A;  2HJB A;  1YFQ A;  3EI3 A;  3EI1 B;  1QNI A;  5HE2 B;  3I7K A;  4AEZ A;  3EI2 B;  4R7A B;  4BUJ C;  3SJL D;  5EM2 B;  2H9M A;  4OZU A;  4JSV C;  2GC4 A;  3GRE A;  4A08 B;  3V9F A;  4FA1 D;  4JD2 C;  3DWL C;  5FKS A;  2AGY A;  4GGC A;  3C9C A;  4I79 A;  4PC0 A;  2YNO A;  1MDA H;  2HXC A;  4CY2 A;  1U4C A;  4X63 B;  1NEX B;  2IWK A;  5FLX g;  5TF2 A;  4HDJ A;  3MXX A;  4JSX C;  5IJ7 E;  1PI6 A;  2P9I C;  3UKU C;  5C9Z B;  1MG3 A;  4CZX A;  1GOT B;  5AFU 3;  3KRX B;  4GM8 A;  3NVX A;  2J55 H;  4GGD A;  5SXM A;  4BL0 A;  3MKQ A;  2AH1 A;  3UR4 A;  4FHL A;  1S4U X;  4JT5 C;  3W15 A;  4Y7R A;  2XL3 A;  1FWX A;  2P9U C;  2CNX A;  3JZG A;  3OKW A;  5HE3 B;  2GC7 A;  3K27 A;  5H1M A;  1N6D A;  3CFS B;  3HFQ A;  2H3X A;  3BG0 A;  4A2L A;  2CE9 A;  2PM6 B;  3JAM g;  3SBP A;  4XEI C;  3E0C A;  3OL2 A;  4O45 A;  4D6V A;  4QT8 A;  4K3J B;  3I8C A;  4A7J A;  3SBQ A;  3I89 A;  3EI3 B;  3F3P A;  3BWS A;  1MG2 A;  3P4F A;  5FKT A;  5C2W B;  2Q7Q A;  3SLE D;  4L3H D;  2H9L A;  2CO0 A;  2O9K A;  5FA5 B;  2HYE A;  3JPX A;  5CXC A;  1XHM A;  5EMJ B;  3PXT D;  4YVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...