1GXRA

Wd40 region of human groucho/tle1
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
337
structure length
335
Chain Sequence
DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
publication title Crystal Structure of the C-Terminal Wd40 Repeat Domain of the Human Groucho/Tle1 Transcriptional Corepressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 86
structure length 335
sequence length 337
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1gxrA00
2I3SA 2PM9B 4D6VA 2YBAA 3IJ1A 2AGYA 4L9OA 3N0EA 5IGQA 4ERYA 4J87A 4PSWB 4LG8A 2H9PA 3E0CA 5HQGA 5HYNB 1GXRA 2XL3A 3JZGA 1K8KC 2IAAA 3PXTD 5TEFA 5H17A 4O3UB 4FA9D 4PC0A 4QT8A 3BG0A 4N14A 2HESX 4MK0B 4FB1D 1TYQC 4QL1A 3JZHA 1SHYB 4A2MA 4CZVA 4CY5A 2G99A 5CYKB 4E54B 2YNPA 4A2LA 4PXWA 2GNQA 1B9YA 4GGDA 4GM9A 4J84A 3RRMC 5CXBB 3MZKA 2CE9A 3A0FA 3K27A 3UVNA 2IUPA 5I5IA 4Y5RD 2P9IC 2Q7QA 3EG6A 1L0QA 2OK4A 3EI2B 2J57G 5IJ8E 4CZXA 4XYIA 5HE0B 3KRXB 2CN3A 4PSXB 3L4MD 1JMZB 5GMKn 1R5MA 4LG9A 3VH0A 3V7DB 3DM0A 3PSLA 4JSNC 2IWKA 2HKRA 2P9LC 5I5MA 4I79A 4FHLA 4JT5C 2H6KA 3SJLD 3KRWB 5EAPA 5C2VB 4E5ZA 1GP2B 1RI6A 3JROA 4O1QD 2CO0A 2BBKH 4X3EA 3OL2B 4BH6A 2IURA 4KFMB 1SQ9A 4PNKB 4D0KA 2I0TA 2AGWA 4ZOYA 1FWXA 4X60B 1ERJA 3I8CA 2QC5A 1MG3A 3RN0D 2CNXA 1TBGA 2XYIA 3DSMA 4FA1D 1P22A 2H68A 3MKSB 2B5LA 2YNNA 1XIPA 4NSXA 4GM3A 3J81g 4J8BA 5I5JA 5HE3B 3J80g 3F3GA 5CXCB 3EI3B 2P9UC 3IIYA 4XYHA 3V5WB 3CFSB 1U4CA 2H9NA 4GMBA 3I89A 3C75H 2Z2PA 5SXMA 5IC7A 4EWRA 4ERZA 3VA6A 3IKOA 3RMZD 4K3JB 4OWRA 5FLXg 1U2VC 3I7OA 1XHMA 3AH8B 4J79A 4K3ID 3NVNA 3SN6B 4U7AA 3OW8A 5FXYA 1Q47A 4J73A 2AQ5A 4A0BB 3JB9L 2EBSA 2P9SC 2TRCB 4A0AA 3SBPA 1JMXB 3W15A 2AGLA 2IUVA 2IWFA 3UKRC 3V9FA 3AL9A 3DXKC 3C99A 1VYHC 3EI4A 5EM2A 3NVQA 4CY2A 2HXCA 4FA5D 3CIKB 2HJBA 2Z2NA 4ZN4A 4A11A 3UVLA 3OTTA 4GGCA 4O3TB 4FWWA 2HYEA 3L4OD 3C5MA 3BWSA 2H47A 5EMMB 5HE1B 2PM6B 4QRJA 3I8EA 5FQDA 1A0RB 3SBQA 3SWSD 5IJ7E 3EU7A 1PBYB 1JOFA 4AEZA 4ZOXA 4GGAA 2YB8B 4H5IA 4PBZA 3PVUB 4FAND 4CI8A 3I7HA 3F3PA 3GFCA 3SHFA 4J78A 5B4WA 4A09A 3EI1A 4GZ8A 2GC4A 2CE8A 2H9LA 4CC9A 3RN1D 3PSCB 4UI9R 2HJ4A 4H5JA 2UZXB 5GXIA 5FA5B 2J55H 3HFQA 1N6EA 4G56B 5FKSA 3SFZA 1PI6A 2AGXA 4TZ4A 3ULEC 3OKYA 4IA9A 4L3HD 4OZUA 2B5NA 5H1MA 3UR4A 2I3TA 4FAVD 3MMYA 4A08B 3ODTA 4AOWA 3JAMg 3OKWA 3I2NA 3BG1A 2B4EA 1S4UX 3NVXA 4XEIC 3JPXA 5CXCA 4E5ZB 2G9AA 3AL8B 3JZNA 2H6QA 5JWZA 2OK6A 4GQBB 3IIWA 4PBYA 1QNIA 2PM9A 4GQ1A 4BL0A 2W18A 5TDHB 4ESGA 3K26A 2OIZA 3FGBA 4IMMA 3RLMD 4J77A 3JRPA 4LGNA 3I7KA 5GSAA 4O45A 2YNOA 5IT9g 4JT6C 3F3FA 5K19A 2YMUA 3RFHA 2MTAH 4GQ2P 4Y7RA 3UVKA 5CYKA 4J0WA 4E54A 4JSVC 2OVRB 3CFVA 2HKMA 2CO0C 5HE2B 4X63B 2H9MA 3MXXA 5CXBA 2P9KC 3OKTA 4JD2C 5EARA 5EAMA 2H13A 3DWLC 4J0XA 2PBIB 3IJ0A 3SBRA 5EMKB 2OVQB 3PXSD 2QXVA 1JJUB 2XL2A 3EI2A 4X61B 5FKRA 1YFQA 4A0AB 3ZWLB 4CY3A 4ZOZA 3UVOA 3AFCA 2PM7B 1N6FA 1OLZA 1SQJA 3EI4B 4L1QD 5EM2B 3P4FA 1B9XA 4R7AB 2AGZA 3EWEA 1N6DA 5THAA 5AFU3 1MDAH 3PVWB 3VGZA 4A11B 3EMHA 3FM0A 3IJCA 5EALA 5IGOA 3ORVD 2CN2A 5TEEA 1MG2A 5K1CC 4CY1A 4ERQA 4J82A 1PEVA 5A2Qg 1GOTB 3OL2A 5EMJB 4JXMA 4HDJA 3B7FA 4A08A 3MKQA 4Z8LA 2BCJB 4O9DA 4U1EI 1OMWB 4JSXC 5GXHA 3SMRA 1GG2B 1K32A 3SXTD 2H14A 2P9PC 4A09B 1NR0A 3EI1B 3SVWD 1PGUA 4ES0A 4GM8A 4CI3A 3UKUC 3AL8A 2H3XA 3RFGA 3EI3A 3I7LA 3I7PA 2H6NA 3SLED 4CI1A 4ZOVA 2AH1A 4YVDA 2AH0A 2UZYB 4J81A 5EMLB 4A7JA 2OVPB 2GC7A 3N0DA 4CI2A 5H14A 4JSPC 4QQEA 3MZLA 5FKTA 4FA4D 4CZYA 2B5MA 2IUQA 4BUJC 4L3GD 5C9ZB 2J56H 3OKYB 5KDOB 3C9CA 3I7NA 3PE7A 2I0SA 2Z2OA 3SCYA 1NEXB 3UVMA 2I0RA 5AJAA 5AMSA 5TF2A 3PXWD 3GREA 5C2WB 4A0BA 1XKSA 3DXMC 4J86A 4J8GA 5FKQA 2P9NC 2OJYA 3FRXA 3RSEC 2O9KA 2XU7A 3U4YA
chains in the Genus database with same CATH superfamily
2I3SA 2PM9B 4D6VA 2YBAA 3IJ1A 2AGYA 4NC4A 1A12A 4L9OA 3N0EA 5IGQA 3EQ8A 5M5UA 4ERYA 4J87A 4NAAA 4PSWB 1UOQA 4LG8A 2H9PA 3E0CA 4RE6A 5HQGA 1GXRA 2XL3A 5HYNB 3JZGA 2QZPA 1K8KC 2IAAA 3PXTD 2XE4A 5H17A 5TEFA 4O3UB 4FA9D 4PC0A 4BP8A 4QT8A 3BG0A 4N14A 4MMZA 3IULA 2HESX 4MK0B 4FB1D 1TYQC 4QL1A 3JZHA 1SHYB 4A2MA 4CZVA 4CY5A 4AMYA 2VDLA 2G99A 4L1MA 5CYKB 2VDPA 2YNPA 4A2LA 4E54B 4PXWA 2GNQA 2EIBA 1B9YA 4Z7QA 4GGDA 4GM9A 4J84A 3RRMC 4WK2A 5CXBB 1T2XA 1I2MB 1O6GA 3MZKA 3ZDXA 2CE9A 3A0FA 1U8CA 3K27A 3UVNA 2IUPA 5I5IA 3QI0A 2EIDA 4Y5RD 2P9IC 4BCBA 2Q7QA 3EG6A 1L0QA 2OK4A 3EI2B 3IUNA 2J57G 2EICA 3VI4A 5IJ8E 4CZXA 4XYIA 5HE0B 3KRXB 2CN3A 4PSXB 3L4MD 1JMZB 5GMKn 1R5MA 4LG9A 4IRZA 3VH0A 3V7DB 3DM0A 3PSLA 4JSNC 2IWKA 2HKRA 2P9LC 3ZE0A 5I5MA 4I79A 1GOFA 2VDKA 4FHLA 4JT5C 3V4PA 2H6KA 3SJLD 3KRWB 5EAPA 5C2VB 4E5ZA 1GP2B 1RI6A 2JKXA 3JROA 5M5TA 4O1QD 2CO0A 2BBKH 2HU7A 4X3EA 3OL2B 4BH6A 2IURA 4KFMB 5E6RA 1SQ9A 4WJKA 4PNKB 1H2XA 4D0KA 1YR2A 2I0TA 4JHPC 2AGWA 4ZOYA 1FWXA 3FCUA 4X60B 1E8NA 1ERJA 3I8CA 2QC5A 1MG3A 3RN0D 1VZ3A 2CNXA 1TBGA 2XYIA 3DSMA 3O4HA 4FA1D 5M5RA 1P22A 2H68A 3MKSB 2B5LA 2VDNA 2YNNA 1XIPA 4NSXA 3O4IA 5FFGA 4GM3A 3J81g 4J8BA 5I5JA 5HE3B 3J80g 3F3GA 5CXCB 3EI3B 2P9UC 3IIYA 4QAMA 4NBMA 4XYHA 3V5WB 3CFSB 3GC3B 3IVMA 1U4CA 2H9NA 4GMBA 3I89A 3C75H 2Z2PA 5SXMA 5IC7A 4EWRA 4UM8A 4ERZA 1C9LA 3VA6A 3IKOA 3RMZD 4K3JB 4OWRA 1L5GA 5FLXg 1U2VC 3I7OA 1XHMA 3AH8B 4UM9A 5M5VA 4J79A 4K3ID 3NVNA 5C92A 3SN6B 4U7AA 3OW8A 5FXYA 1Q47A 4J73A 3DDUA 2AQ5A 4A0BB 4BCDA 3JB9L 2EBSA 2P9SC 2TRCB 4NENA 1GOGA 4A0AA 3SBPA 1JMXB 3W15A 2AGLA 2IUVA 2IWFA 3UKRC 3V9FA 3AL9A 3DXKC 3C99A 1VYHC 3EI4A 5EM2A 3NVQA 5FFOA 4CY2A 2HXCA 4FA5D 3CIKB 2HJBA 2Z2NA 4ZN4A 4A11A 3UVLA 2VZ1A 3OTTA 3MVDK 4GGCA 4O3TB 1BPOA 4FWWA 2HYEA 1VE6A 3C5MA 3L4OD 3BWSA 2H47A 5EMMB 1C9IA 5HE1B 2PM6B 4QRJA 3I8EA 5FQDA 1A0RB 4Z7OA 3SBQA 4BP9A 3SWSD 5IJ7E 1VZ2A 3EU7A 1UOOA 5C86A 1PBYB 1JOFA 1GOHA 4AEZA 4ZOXA 4GGAA 2YB8B 4H5IA 4PBZA 3PVUB 4FAND 4CI8A 3I7HA 3F3PA 3NIDA 3GFCA 3SHFA 4J78A 5B4WA 4A09A 3EI1A 2H9LA 2GC4A 2CE8A 4GZ8A 4CC9A 4DNWA 3RN1D 3PSCB 3QHYB 4UI9R 3NIFA 2HJ4A 4H5JA 2UZXB 3IUJA 4O2WA 5GXIA 2VDRA 5FA5B 2J55H 2HU8A 3HFQA 1N6EA 4G56B 3T3MA 5FKSA 3SFZA 1PI6A 2AGXA 2VC2A 4TZ4A 4MMXA 3ULEC 4D9SA 3ZE2A 3EQ9A 2VDOA 4AX4A 1QFSA 3OKYA 4IA9A 4L3HD 4OZUA 2B5NA 5H1MA 3UR4A 2I3TA 4FAVD 3MMYA 4A08B 3ODTA 4AOWA 2VZ3A 4MMYA 3OKWA 3JAMg 1E8MA 4WK0A 3I2NA 3BG1A 5HDBA 4O02A 2B4EA 1S4UX 3NVXA 1K3IA 4XEIC 2QR5A 3JPXA 5CXCA 4E5ZB 2G9AA 3AL8B 3JZNA 2H6QA 5M61A 5JWZA 2OK6A 4GQBB 3IIWA 4PBYA 1QNIA 2HU5A 1UTCA 2PM9A 4GQ1A 4BL0A 3FCSA 2W18A 3ZE1A 5TDHB 4ESGA 1TYEA 3K26A 2OIZA 4G1EA 3FGBA 4IMMA 3RLMD 4J77A 3JRPA 4LGNA 3I7KA 3KCIA 5E6UA 5GSAA 4O45A 2YNOA 5IT9g 1H2WA 3IJEA 4JT6C 3F3FA 5K19A 2YMUA 3MUOA 3RFHA 2MTAH 4GQ2P 4Y7RA 3UVKA 5CYKA 1H2ZA 4J0WA 4E54A 3GD1I 2XZGA 4JSVC 3K6SA 2OVRB 3CFVA 2HKMA 2CO0C 5HE2B 4X63B 2H9MA 3V4VA 2XDWA 3MXXA 5CXBA 2P9KC 3OKTA 4RE5A 4JD2C 5EARA 5EAMA 1UOPA 2H13A 3DWLC 3K72A 4J0XA 1E5TA 2PBIB 3IJ0A 3SBRA 5EMKB 5M5SA 2OVQB 3PXSD 2QXVA 1JJUB 2XL2A 3EI2A 4X61B 2BKLA 5FKRA 1YFQA 4A0AB 3ZWLB 4CY3A 4WK4A 1H2YA 4ZOZA 3UVOA 3AFCA 2PM7B 1N6FA 1OLZA 1SQJA 4Z7NA 4AMZA 3EI4B 4L1QD 5EM2B 3O4JA 4G55A 3P4FA 1B9XA 4R7AB 2AGZA 3EWEA 1N6DA 5THAA 4BCCA 5AFU3 1MDAH 3PVWB 3VGZA 4A11B 1JTDB 1QFMA 3EMHA 3FM0A 3IJCA 5EALA 5IGOA 3K71A 3NIGA 3EQ7A 3ORVD 2CN2A 5TEEA 1MG2A 5K1CC 1M1XA 4CY1A 4ERQA 4J82A 1PEVA 5A2Qg 1GOTB 3OL2A 3ZDYA 5EMJB 3IUMA 4JXMA 2WQ8A 4HDJA 3O4GA 3B7FA 4JHNA 4AN0A 3T3PA 3IURA 3MUNA 4A08A 3MKQA 4Z8LA 1O6FA 2BCJB 3OF7A 4O9DA 4U1EI 1OMWB 4JSXC 5GXHA 3SMRA 2VDQA 1GG2B 1K32A 3SXTD 2H14A 2P9PC 4A09B 1NR0A 3EI1B 3SVWD 1PGUA 4ES0A 4GM8A 4DNUA 4CI3A 3UKUC 1VE7A 3AL8A 2H3XA 4AN1A 3RFGA 3EI3A 3I7LA 3I7PA 2H6NA 3SLED 4CI1A 4ZOVA 2AH1A 4YVDA 2AH0A 2UZYB 4J81A 5EMLB 4A7JA 2OVPB 2GC7A 3N0DA 4CI2A 5H14A 4JSPC 4QQEA 3MZLA 5FKTA 4FA4D 4CZYA 2B5MA 4DNVA 2IUQA 4BUJC 4L3GD 5C9ZB 2J56H 3OKYB 5KDOB 3C9CA 3I7NA 3PE7A 2I0SA 2VDMA 2Z2OA 3SCYA 1NEXB 3UVMA 2I0RA 5AJAA 3IUQA 5AMSA 5TF2A 3PXWD 3GREA 5C2WB 4A0BA 1JV2A 3VI3A 1XKSA 3DXMC 4G1MA 4J86A 3ZDZA 4J8GA 5FKQA 2P9NC 2OJYA 5E6SA 3FRXA 3RSEC 2EIEA 2O9KA 2XU7A 3U4YA
chains in the Genus database with same CATH topology
2I3SA 2PM9B 4D6VA 2YBAA 3IJ1A 2AGYA 4L9OA 3N0EA 5IGQA 4ERYA 4J87A 4PSWB 4LG8A 2H9PA 3E0CA 5HQGA 5HYNB 1GXRA 2XL3A 3JZGA 1K8KC 2IAAA 3PXTD 5TEFA 5H17A 4O3UB 4FA9D 4PC0A 4QT8A 3BG0A 4N14A 2HESX 4MK0B 4FB1D 1TYQC 4QL1A 3JZHA 1SHYB 4A2MA 4CZVA 4CY5A 2G99A 5CYKB 4E54B 2YNPA 4A2LA 4PXWA 2GNQA 1B9YA 4GGDA 4GM9A 4J84A 3RRMC 5CXBB 3MZKA 2CE9A 3A0FA 3K27A 3UVNA 2IUPA 5I5IA 4Y5RD 2P9IC 2Q7QA 3EG6A 1L0QA 2OK4A 3EI2B 2J57G 5IJ8E 4CZXA 4XYIA 5HE0B 3KRXB 2CN3A 4PSXB 3L4MD 1JMZB 5GMKn 1R5MA 4LG9A 3VH0A 3V7DB 3DM0A 3PSLA 4JSNC 2IWKA 2HKRA 2P9LC 5I5MA 4I79A 4FHLA 4JT5C 2H6KA 3SJLD 3KRWB 5EAPA 5C2VB 4E5ZA 1GP2B 1RI6A 3JROA 4O1QD 2CO0A 2BBKH 4X3EA 3OL2B 4BH6A 2IURA 4KFMB 1SQ9A 4PNKB 4D0KA 2I0TA 2AGWA 4ZOYA 1FWXA 4X60B 1ERJA 3I8CA 2QC5A 1MG3A 3RN0D 2CNXA 1TBGA 2XYIA 3DSMA 4FA1D 1P22A 2H68A 3MKSB 2B5LA 2YNNA 1XIPA 4NSXA 4GM3A 3J81g 4J8BA 5I5JA 5HE3B 3J80g 3F3GA 5CXCB 3EI3B 2P9UC 3IIYA 4XYHA 3V5WB 3CFSB 1U4CA 2H9NA 4GMBA 3I89A 3C75H 2Z2PA 5SXMA 5IC7A 4EWRA 4ERZA 3VA6A 3IKOA 3RMZD 4K3JB 4OWRA 5FLXg 1U2VC 3I7OA 1XHMA 3AH8B 4J79A 4K3ID 3NVNA 3SN6B 4U7AA 3OW8A 5FXYA 1Q47A 4J73A 2AQ5A 4A0BB 3JB9L 2EBSA 2P9SC 2TRCB 4A0AA 3SBPA 1JMXB 3W15A 2AGLA 2IUVA 2IWFA 3UKRC 3V9FA 3AL9A 3DXKC 3C99A 1VYHC 3EI4A 5EM2A 3NVQA 4CY2A 2HXCA 4FA5D 3CIKB 2HJBA 2Z2NA 4ZN4A 4A11A 3UVLA 3OTTA 4GGCA 4O3TB 4FWWA 2HYEA 3L4OD 3C5MA 3BWSA 2H47A 5EMMB 5HE1B 2PM6B 4QRJA 3I8EA 5FQDA 1A0RB 3SBQA 3SWSD 5IJ7E 3EU7A 1PBYB 1JOFA 4AEZA 4ZOXA 4GGAA 2YB8B 4H5IA 4PBZA 3PVUB 4FAND 4CI8A 3I7HA 3F3PA 3GFCA 3SHFA 4J78A 5B4WA 4A09A 3EI1A 4GZ8A 2GC4A 2CE8A 2H9LA 4CC9A 3RN1D 3PSCB 4UI9R 2HJ4A 4H5JA 2UZXB 5GXIA 5FA5B 2J55H 3HFQA 1N6EA 4G56B 5FKSA 3SFZA 1PI6A 2AGXA 4TZ4A 3ULEC 3OKYA 4IA9A 4L3HD 4OZUA 2B5NA 5H1MA 3UR4A 2I3TA 4FAVD 3MMYA 4A08B 3ODTA 4AOWA 3JAMg 3OKWA 3I2NA 3BG1A 2B4EA 1S4UX 3NVXA 4XEIC 3JPXA 5CXCA 4E5ZB 2G9AA 3AL8B 3JZNA 2H6QA 5JWZA 2OK6A 4GQBB 3IIWA 4PBYA 1QNIA 2PM9A 4GQ1A 4BL0A 2W18A 5TDHB 4ESGA 3K26A 2OIZA 3FGBA 4IMMA 3RLMD 4J77A 3JRPA 4LGNA 3I7KA 5GSAA 4O45A 2YNOA 5IT9g 4JT6C 3F3FA 5K19A 2YMUA 3RFHA 2MTAH 4GQ2P 4Y7RA 3UVKA 5CYKA 4J0WA 4E54A 4JSVC 2OVRB 3CFVA 2HKMA 2CO0C 5HE2B 4X63B 2H9MA 3MXXA 5CXBA 2P9KC 3OKTA 4JD2C 5EARA 5EAMA 2H13A 3DWLC 4J0XA 2PBIB 3IJ0A 3SBRA 5EMKB 2OVQB 3PXSD 2QXVA 1JJUB 2XL2A 3EI2A 4X61B 5FKRA 1YFQA 4A0AB 3ZWLB 4CY3A 4ZOZA 3UVOA 3AFCA 2PM7B 1N6FA 1OLZA 1SQJA 3EI4B 4L1QD 5EM2B 3P4FA 1B9XA 4R7AB 2AGZA 3EWEA 1N6DA 5THAA 5AFU3 1MDAH 3PVWB 3VGZA 4A11B 3EMHA 3FM0A 3IJCA 5EALA 5IGOA 3ORVD 2CN2A 5TEEA 1MG2A 5K1CC 4CY1A 4ERQA 4J82A 1PEVA 5A2Qg 1GOTB 3OL2A 5EMJB 4JXMA 4HDJA 3B7FA 4A08A 3MKQA 4Z8LA 2BCJB 4O9DA 4U1EI 1OMWB 4JSXC 5GXHA 3SMRA 1GG2B 1K32A 3SXTD 2H14A 2P9PC 4A09B 1NR0A 3EI1B 3SVWD 1PGUA 4ES0A 4GM8A 4CI3A 3UKUC 3AL8A 2H3XA 3RFGA 3EI3A 3I7LA 3I7PA 2H6NA 3SLED 4CI1A 4ZOVA 2AH1A 4YVDA 2AH0A 2UZYB 4J81A 5EMLB 4A7JA 2OVPB 2GC7A 3N0DA 4CI2A 5H14A 4JSPC 4QQEA 3MZLA 5FKTA 4FA4D 4CZYA 2B5MA 2IUQA 4BUJC 4L3GD 5C9ZB 2J56H 3OKYB 5KDOB 3C9CA 3I7NA 3PE7A 2I0SA 2Z2OA 3SCYA 1NEXB 3UVMA 2I0RA 5AJAA 5AMSA 5TF2A 3PXWD 3GREA 5C2WB 4A0BA 1XKSA 3DXMC 4J86A 4J8GA 5FKQA 2P9NC 2OJYA 3FRXA 3RSEC 2O9KA 2XU7A 3U4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I3S A;  2PM9 B;  4D6V A;  2YBA A;  3IJ1 A;  2AGY A;  4L9O A;  3N0E A;  5IGQ A;  4ERY A;  4J87 A;  4PSW B;  4LG8 A;  2H9P A;  3E0C A;  5HQG A;  5HYN B;  1GXR A;  2XL3 A;  3JZG A;  1K8K C;  2IAA A;  3PXT D;  5TEF A;  5H17 A;  4O3U B;  4FA9 D;  4PC0 A;  4QT8 A;  3BG0 A;  4N14 A;  2HES X;  4MK0 B;  4FB1 D;  1TYQ C;  4QL1 A;  3JZH A;  1SHY B;  4A2M A;  4CZV A;  4CY5 A;  2G99 A;  5CYK B;  4E54 B;  2YNP A;  4A2L A;  4PXW A;  2GNQ A;  1B9Y A;  4GGD A;  4GM9 A;  4J84 A;  3RRM C;  5CXB B;  3MZK A;  2CE9 A;  3A0F A;  3K27 A;  3UVN A;  2IUP A;  5I5I A;  4Y5R D;  2P9I C;  2Q7Q A;  3EG6 A;  1L0Q A;  2OK4 A;  3EI2 B;  2J57 G;  5IJ8 E;  4CZX A;  4XYI A;  5HE0 B;  3KRX B;  2CN3 A;  4PSX B;  3L4M D;  1JMZ B;  5GMK n;  1R5M A;  4LG9 A;  3VH0 A;  3V7D B;  3DM0 A;  3PSL A;  4JSN C;  2IWK A;  2HKR A;  2P9L C;  5I5M A;  4I79 A;  4FHL A;  4JT5 C;  2H6K A;  3SJL D;  3KRW B;  5EAP A;  5C2V B;  4E5Z A;  1GP2 B;  1RI6 A;  3JRO A;  4O1Q D;  2CO0 A;  2BBK H;  4X3E A;  3OL2 B;  4BH6 A;  2IUR A;  4KFM B;  1SQ9 A;  4PNK B;  4D0K A;  2I0T A;  2AGW A;  4ZOY A;  1FWX A;  4X60 B;  1ERJ A;  3I8C A;  2QC5 A;  1MG3 A;  3RN0 D;  2CNX A;  1TBG A;  2XYI A;  3DSM A;  4FA1 D;  1P22 A;  2H68 A;  3MKS B;  2B5L A;  2YNN A;  1XIP A;  4NSX A;  4GM3 A;  3J81 g;  4J8B A;  5I5J A;  5HE3 B;  3J80 g;  3F3G A;  5CXC B;  3EI3 B;  2P9U C;  3IIY A;  4XYH A;  3V5W B;  3CFS B;  1U4C A;  2H9N A;  4GMB A;  3I89 A;  3C75 H;  2Z2P A;  5SXM A;  5IC7 A;  4EWR A;  4ERZ A;  3VA6 A;  3IKO A;  3RMZ D;  4K3J B;  4OWR A;  5FLX g;  1U2V C;  3I7O A;  1XHM A;  3AH8 B;  4J79 A;  4K3I D;  3NVN A;  3SN6 B;  4U7A A;  3OW8 A;  5FXY A;  1Q47 A;  4J73 A;  2AQ5 A;  4A0B B;  3JB9 L;  2EBS A;  2P9S C;  2TRC B;  4A0A A;  3SBP A;  1JMX B;  3W15 A;  2AGL A;  2IUV A;  2IWF A;  3UKR C;  3V9F A;  3AL9 A;  3DXK C;  3C99 A;  1VYH C;  3EI4 A;  5EM2 A;  3NVQ A;  4CY2 A;  2HXC A;  4FA5 D;  3CIK B;  2HJB A;  2Z2N A;  4ZN4 A;  4A11 A;  3UVL A;  3OTT A;  4GGC A;  4O3T B;  4FWW A;  2HYE A;  3L4O D;  3C5M A;  3BWS A;  2H47 A;  5EMM B;  5HE1 B;  2PM6 B;  4QRJ A;  3I8E A;  5FQD A;  1A0R B;  3SBQ A;  3SWS D;  5IJ7 E;  3EU7 A;  1PBY B;  1JOF A;  4AEZ A;  4ZOX A;  4GGA A;  2YB8 B;  4H5I A;  4PBZ A;  3PVU B;  4FAN D;  4CI8 A;  3I7H A;  3F3P A;  3GFC A;  3SHF A;  4J78 A;  5B4W A;  4A09 A;  3EI1 A;  4GZ8 A;  2GC4 A;  2CE8 A;  2H9L A;  4CC9 A;  3RN1 D;  3PSC B;  4UI9 R;  2HJ4 A;  4H5J A;  2UZX B;  5GXI A;  5FA5 B;  2J55 H;  3HFQ A;  1N6E A;  4G56 B;  5FKS A;  3SFZ A;  1PI6 A;  2AGX A;  4TZ4 A;  3ULE C;  3OKY A;  4IA9 A;  4L3H D;  4OZU A;  2B5N A;  5H1M A;  3UR4 A;  2I3T A;  4FAV D;  3MMY A;  4A08 B;  3ODT A;  4AOW A;  3JAM g;  3OKW A;  3I2N A;  3BG1 A;  2B4E A;  1S4U X;  3NVX A;  4XEI C;  3JPX A;  5CXC A;  4E5Z B;  2G9A A;  3AL8 B;  3JZN A;  2H6Q A;  5JWZ A;  2OK6 A;  4GQB B;  3IIW A;  4PBY A;  1QNI A;  2PM9 A;  4GQ1 A;  4BL0 A;  2W18 A;  5TDH B;  4ESG A;  3K26 A;  2OIZ A;  3FGB A;  4IMM A;  3RLM D;  4J77 A;  3JRP A;  4LGN A;  3I7K A;  5GSA A;  4O45 A;  2YNO A;  5IT9 g;  4JT6 C;  3F3F A;  5K19 A;  2YMU A;  3RFH A;  2MTA H;  4GQ2 P;  4Y7R A;  3UVK A;  5CYK A;  4J0W A;  4E54 A;  4JSV C;  2OVR B;  3CFV A;  2HKM A;  2CO0 C;  5HE2 B;  4X63 B;  2H9M A;  3MXX A;  5CXB A;  2P9K C;  3OKT A;  4JD2 C;  5EAR A;  5EAM A;  2H13 A;  3DWL C;  4J0X A;  2PBI B;  3IJ0 A;  3SBR A;  5EMK B;  2OVQ B;  3PXS D;  2QXV A;  1JJU B;  2XL2 A;  3EI2 A;  4X61 B;  5FKR A;  1YFQ A;  4A0A B;  3ZWL B;  4CY3 A;  4ZOZ A;  3UVO A;  3AFC A;  2PM7 B;  1N6F A;  1OLZ A;  1SQJ A;  3EI4 B;  4L1Q D;  5EM2 B;  3P4F A;  1B9X A;  4R7A B;  2AGZ A;  3EWE A;  1N6D A;  5THA A;  5AFU 3;  1MDA H;  3PVW B;  3VGZ A;  4A11 B;  3EMH A;  3FM0 A;  3IJC A;  5EAL A;  5IGO A;  3ORV D;  2CN2 A;  5TEE A;  1MG2 A;  5K1C C;  4CY1 A;  4ERQ A;  4J82 A;  1PEV A;  5A2Q g;  1GOT B;  3OL2 A;  5EMJ B;  4JXM A;  4HDJ A;  3B7F A;  4A08 A;  3MKQ A;  4Z8L A;  2BCJ B;  4O9D A;  4U1E I;  1OMW B;  4JSX C;  5GXH A;  3SMR A;  1GG2 B;  1K32 A;  3SXT D;  2H14 A;  2P9P C;  4A09 B;  1NR0 A;  3EI1 B;  3SVW D;  1PGU A;  4ES0 A;  4GM8 A;  4CI3 A;  3UKU C;  3AL8 A;  2H3X A;  3RFG A;  3EI3 A;  3I7L A;  3I7P A;  2H6N A;  3SLE D;  4CI1 A;  4ZOV A;  2AH1 A;  4YVD A;  2AH0 A;  2UZY B;  4J81 A;  5EML B;  4A7J A;  2OVP B;  2GC7 A;  3N0D A;  4CI2 A;  5H14 A;  4JSP C;  4QQE A;  3MZL A;  5FKT A;  4FA4 D;  4CZY A;  2B5M A;  2IUQ A;  4BUJ C;  4L3G D;  5C9Z B;  2J56 H;  3OKY B;  5KDO B;  3C9C A;  3I7N A;  3PE7 A;  2I0S A;  2Z2O A;  3SCY A;  1NEX B;  3UVM A;  2I0R A;  5AJA A;  5AMS A;  5TF2 A;  3PXW D;  3GRE A;  5C2W B;  4A0B A;  1XKS A;  3DXM C;  4J86 A;  4J8G A;  5FKQ A;  2P9N C;  2OJY A;  3FRX A;  3RSE C;  2O9K A;  2XU7 A;  3U4Y A; 
#chains in the Genus database with same CATH topology
 2I3S A;  2PM9 B;  4D6V A;  2YBA A;  3IJ1 A;  2AGY A;  4NC4 A;  1A12 A;  4L9O A;  3N0E A;  5IGQ A;  3EQ8 A;  5M5U A;  4ERY A;  4J87 A;  4NAA A;  4PSW B;  1UOQ A;  4LG8 A;  2H9P A;  3E0C A;  4RE6 A;  5HQG A;  1GXR A;  2XL3 A;  5HYN B;  3JZG A;  2QZP A;  1K8K C;  2IAA A;  3PXT D;  2XE4 A;  5H17 A;  5TEF A;  4O3U B;  4FA9 D;  4PC0 A;  4BP8 A;  4QT8 A;  3BG0 A;  4N14 A;  4MMZ A;  3IUL A;  2HES X;  4MK0 B;  4FB1 D;  1TYQ C;  4QL1 A;  3JZH A;  1SHY B;  4A2M A;  4CZV A;  4CY5 A;  4AMY A;  2VDL A;  2G99 A;  4L1M A;  5CYK B;  2VDP A;  2YNP A;  4A2L A;  4E54 B;  4PXW A;  2GNQ A;  2EIB A;  1B9Y A;  4Z7Q A;  4GGD A;  4GM9 A;  4J84 A;  3RRM C;  4WK2 A;  5CXB B;  1T2X A;  1I2M B;  1O6G A;  3MZK A;  3ZDX A;  2CE9 A;  3A0F A;  1U8C A;  3K27 A;  3UVN A;  2IUP A;  5I5I A;  3QI0 A;  2EID A;  4Y5R D;  2P9I C;  4BCB A;  2Q7Q A;  3EG6 A;  1L0Q A;  2OK4 A;  3EI2 B;  3IUN A;  2J57 G;  2EIC A;  3VI4 A;  5IJ8 E;  4CZX A;  4XYI A;  5HE0 B;  3KRX B;  2CN3 A;  4PSX B;  3L4M D;  1JMZ B;  5GMK n;  1R5M A;  4LG9 A;  4IRZ A;  3VH0 A;  3V7D B;  3DM0 A;  3PSL A;  4JSN C;  2IWK A;  2HKR A;  2P9L C;  3ZE0 A;  5I5M A;  4I79 A;  1GOF A;  2VDK A;  4FHL A;  4JT5 C;  3V4P A;  2H6K A;  3SJL D;  3KRW B;  5EAP A;  5C2V B;  4E5Z A;  1GP2 B;  1RI6 A;  2JKX A;  3JRO A;  5M5T A;  4O1Q D;  2CO0 A;  2BBK H;  2HU7 A;  4X3E A;  3OL2 B;  4BH6 A;  2IUR A;  4KFM B;  5E6R A;  1SQ9 A;  4WJK A;  4PNK B;  1H2X A;  4D0K A;  1YR2 A;  2I0T A;  4JHP C;  2AGW A;  4ZOY A;  1FWX A;  3FCU A;  4X60 B;  1E8N A;  1ERJ A;  3I8C A;  2QC5 A;  1MG3 A;  3RN0 D;  1VZ3 A;  2CNX A;  1TBG A;  2XYI A;  3DSM A;  3O4H A;  4FA1 D;  5M5R A;  1P22 A;  2H68 A;  3MKS B;  2B5L A;  2VDN A;  2YNN A;  1XIP A;  4NSX A;  3O4I A;  5FFG A;  4GM3 A;  3J81 g;  4J8B A;  5I5J A;  5HE3 B;  3J80 g;  3F3G A;  5CXC B;  3EI3 B;  2P9U C;  3IIY A;  4QAM A;  4NBM A;  4XYH A;  3V5W B;  3CFS B;  3GC3 B;  3IVM A;  1U4C A;  2H9N A;  4GMB A;  3I89 A;  3C75 H;  2Z2P A;  5SXM A;  5IC7 A;  4EWR A;  4UM8 A;  4ERZ A;  1C9L A;  3VA6 A;  3IKO A;  3RMZ D;  4K3J B;  4OWR A;  1L5G A;  5FLX g;  1U2V C;  3I7O A;  1XHM A;  3AH8 B;  4UM9 A;  5M5V A;  4J79 A;  4K3I D;  3NVN A;  5C92 A;  3SN6 B;  4U7A A;  3OW8 A;  5FXY A;  1Q47 A;  4J73 A;  3DDU A;  2AQ5 A;  4A0B B;  4BCD A;  3JB9 L;  2EBS A;  2P9S C;  2TRC B;  4NEN A;  1GOG A;  4A0A A;  3SBP A;  1JMX B;  3W15 A;  2AGL A;  2IUV A;  2IWF A;  3UKR C;  3V9F A;  3AL9 A;  3DXK C;  3C99 A;  1VYH C;  3EI4 A;  5EM2 A;  3NVQ A;  5FFO A;  4CY2 A;  2HXC A;  4FA5 D;  3CIK B;  2HJB A;  2Z2N A;  4ZN4 A;  4A11 A;  3UVL A;  2VZ1 A;  3OTT A;  3MVD K;  4GGC A;  4O3T B;  1BPO A;  4FWW A;  2HYE A;  1VE6 A;  3C5M A;  3L4O D;  3BWS A;  2H47 A;  5EMM B;  1C9I A;  5HE1 B;  2PM6 B;  4QRJ A;  3I8E A;  5FQD A;  1A0R B;  4Z7O A;  3SBQ A;  4BP9 A;  3SWS D;  5IJ7 E;  1VZ2 A;  3EU7 A;  1UOO A;  5C86 A;  1PBY B;  1JOF A;  1GOH A;  4AEZ A;  4ZOX A;  4GGA A;  2YB8 B;  4H5I A;  4PBZ A;  3PVU B;  4FAN D;  4CI8 A;  3I7H A;  3F3P A;  3NID A;  3GFC A;  3SHF A;  4J78 A;  5B4W A;  4A09 A;  3EI1 A;  2H9L A;  2GC4 A;  2CE8 A;  4GZ8 A;  4CC9 A;  4DNW A;  3RN1 D;  3PSC B;  3QHY B;  4UI9 R;  3NIF A;  2HJ4 A;  4H5J A;  2UZX B;  3IUJ A;  4O2W A;  5GXI A;  2VDR A;  5FA5 B;  2J55 H;  2HU8 A;  3HFQ A;  1N6E A;  4G56 B;  3T3M A;  5FKS A;  3SFZ A;  1PI6 A;  2AGX A;  2VC2 A;  4TZ4 A;  4MMX A;  3ULE C;  4D9S A;  3ZE2 A;  3EQ9 A;  2VDO A;  4AX4 A;  1QFS A;  3OKY A;  4IA9 A;  4L3H D;  4OZU A;  2B5N A;  5H1M A;  3UR4 A;  2I3T A;  4FAV D;  3MMY A;  4A08 B;  3ODT A;  4AOW A;  2VZ3 A;  4MMY A;  3OKW A;  3JAM g;  1E8M A;  4WK0 A;  3I2N A;  3BG1 A;  5HDB A;  4O02 A;  2B4E A;  1S4U X;  3NVX A;  1K3I A;  4XEI C;  2QR5 A;  3JPX A;  5CXC A;  4E5Z B;  2G9A A;  3AL8 B;  3JZN A;  2H6Q A;  5M61 A;  5JWZ A;  2OK6 A;  4GQB B;  3IIW A;  4PBY A;  1QNI A;  2HU5 A;  1UTC A;  2PM9 A;  4GQ1 A;  4BL0 A;  3FCS A;  2W18 A;  3ZE1 A;  5TDH B;  4ESG A;  1TYE A;  3K26 A;  2OIZ A;  4G1E A;  3FGB A;  4IMM A;  3RLM D;  4J77 A;  3JRP A;  4LGN A;  3I7K A;  3KCI A;  5E6U A;  5GSA A;  4O45 A;  2YNO A;  5IT9 g;  1H2W A;  3IJE A;  4JT6 C;  3F3F A;  5K19 A;  2YMU A;  3MUO A;  3RFH A;  2MTA H;  4GQ2 P;  4Y7R A;  3UVK A;  5CYK A;  1H2Z A;  4J0W A;  4E54 A;  3GD1 I;  2XZG A;  4JSV C;  3K6S A;  2OVR B;  3CFV A;  2HKM A;  2CO0 C;  5HE2 B;  4X63 B;  2H9M A;  3V4V A;  2XDW A;  3MXX A;  5CXB A;  2P9K C;  3OKT A;  4RE5 A;  4JD2 C;  5EAR A;  5EAM A;  1UOP A;  2H13 A;  3DWL C;  3K72 A;  4J0X A;  1E5T A;  2PBI B;  3IJ0 A;  3SBR A;  5EMK B;  5M5S A;  2OVQ B;  3PXS D;  2QXV A;  1JJU B;  2XL2 A;  3EI2 A;  4X61 B;  2BKL A;  5FKR A;  1YFQ A;  4A0A B;  3ZWL B;  4CY3 A;  4WK4 A;  1H2Y A;  4ZOZ A;  3UVO A;  3AFC A;  2PM7 B;  1N6F A;  1OLZ A;  1SQJ A;  4Z7N A;  4AMZ A;  3EI4 B;  4L1Q D;  5EM2 B;  3O4J A;  4G55 A;  3P4F A;  1B9X A;  4R7A B;  2AGZ A;  3EWE A;  1N6D A;  5THA A;  4BCC A;  5AFU 3;  1MDA H;  3PVW B;  3VGZ A;  4A11 B;  1JTD B;  1QFM A;  3EMH A;  3FM0 A;  3IJC A;  5EAL A;  5IGO A;  3K71 A;  3NIG A;  3EQ7 A;  3ORV D;  2CN2 A;  5TEE A;  1MG2 A;  5K1C C;  1M1X A;  4CY1 A;  4ERQ A;  4J82 A;  1PEV A;  5A2Q g;  1GOT B;  3OL2 A;  3ZDY A;  5EMJ B;  3IUM A;  4JXM A;  2WQ8 A;  4HDJ A;  3O4G A;  3B7F A;  4JHN A;  4AN0 A;  3T3P A;  3IUR A;  3MUN A;  4A08 A;  3MKQ A;  4Z8L A;  1O6F A;  2BCJ B;  3OF7 A;  4O9D A;  4U1E I;  1OMW B;  4JSX C;  5GXH A;  3SMR A;  2VDQ A;  1GG2 B;  1K32 A;  3SXT D;  2H14 A;  2P9P C;  4A09 B;  1NR0 A;  3EI1 B;  3SVW D;  1PGU A;  4ES0 A;  4GM8 A;  4DNU A;  4CI3 A;  3UKU C;  1VE7 A;  3AL8 A;  2H3X A;  4AN1 A;  3RFG A;  3EI3 A;  3I7L A;  3I7P A;  2H6N A;  3SLE D;  4CI1 A;  4ZOV A;  2AH1 A;  4YVD A;  2AH0 A;  2UZY B;  4J81 A;  5EML B;  4A7J A;  2OVP B;  2GC7 A;  3N0D A;  4CI2 A;  5H14 A;  4JSP C;  4QQE A;  3MZL A;  5FKT A;  4FA4 D;  4CZY A;  2B5M A;  4DNV A;  2IUQ A;  4BUJ C;  4L3G D;  5C9Z B;  2J56 H;  3OKY B;  5KDO B;  3C9C A;  3I7N A;  3PE7 A;  2I0S A;  2VDM A;  2Z2O A;  3SCY A;  1NEX B;  3UVM A;  2I0R A;  5AJA A;  3IUQ A;  5AMS A;  5TF2 A;  3PXW D;  3GRE A;  5C2W B;  4A0B A;  1JV2 A;  3VI3 A;  1XKS A;  3DXM C;  4G1M A;  4J86 A;  3ZDZ A;  4J8G A;  5FKQ A;  2P9N C;  2OJY A;  5E6S A;  3FRX A;  3RSE C;  2EIE A;  2O9K A;  2XU7 A;  3U4Y A; 
#chains in the Genus database with same CATH homology
 2I3S A;  2PM9 B;  4D6V A;  2YBA A;  3IJ1 A;  2AGY A;  4L9O A;  3N0E A;  5IGQ A;  4ERY A;  4J87 A;  4PSW B;  4LG8 A;  2H9P A;  3E0C A;  5HQG A;  5HYN B;  1GXR A;  2XL3 A;  3JZG A;  1K8K C;  2IAA A;  3PXT D;  5TEF A;  5H17 A;  4O3U B;  4FA9 D;  4PC0 A;  4QT8 A;  3BG0 A;  4N14 A;  2HES X;  4MK0 B;  4FB1 D;  1TYQ C;  4QL1 A;  3JZH A;  1SHY B;  4A2M A;  4CZV A;  4CY5 A;  2G99 A;  5CYK B;  4E54 B;  2YNP A;  4A2L A;  4PXW A;  2GNQ A;  1B9Y A;  4GGD A;  4GM9 A;  4J84 A;  3RRM C;  5CXB B;  3MZK A;  2CE9 A;  3A0F A;  3K27 A;  3UVN A;  2IUP A;  5I5I A;  4Y5R D;  2P9I C;  2Q7Q A;  3EG6 A;  1L0Q A;  2OK4 A;  3EI2 B;  2J57 G;  5IJ8 E;  4CZX A;  4XYI A;  5HE0 B;  3KRX B;  2CN3 A;  4PSX B;  3L4M D;  1JMZ B;  5GMK n;  1R5M A;  4LG9 A;  3VH0 A;  3V7D B;  3DM0 A;  3PSL A;  4JSN C;  2IWK A;  2HKR A;  2P9L C;  5I5M A;  4I79 A;  4FHL A;  4JT5 C;  2H6K A;  3SJL D;  3KRW B;  5EAP A;  5C2V B;  4E5Z A;  1GP2 B;  1RI6 A;  3JRO A;  4O1Q D;  2CO0 A;  2BBK H;  4X3E A;  3OL2 B;  4BH6 A;  2IUR A;  4KFM B;  1SQ9 A;  4PNK B;  4D0K A;  2I0T A;  2AGW A;  4ZOY A;  1FWX A;  4X60 B;  1ERJ A;  3I8C A;  2QC5 A;  1MG3 A;  3RN0 D;  2CNX A;  1TBG A;  2XYI A;  3DSM A;  4FA1 D;  1P22 A;  2H68 A;  3MKS B;  2B5L A;  2YNN A;  1XIP A;  4NSX A;  4GM3 A;  3J81 g;  4J8B A;  5I5J A;  5HE3 B;  3J80 g;  3F3G A;  5CXC B;  3EI3 B;  2P9U C;  3IIY A;  4XYH A;  3V5W B;  3CFS B;  1U4C A;  2H9N A;  4GMB A;  3I89 A;  3C75 H;  2Z2P A;  5SXM A;  5IC7 A;  4EWR A;  4ERZ A;  3VA6 A;  3IKO A;  3RMZ D;  4K3J B;  4OWR A;  5FLX g;  1U2V C;  3I7O A;  1XHM A;  3AH8 B;  4J79 A;  4K3I D;  3NVN A;  3SN6 B;  4U7A A;  3OW8 A;  5FXY A;  1Q47 A;  4J73 A;  2AQ5 A;  4A0B B;  3JB9 L;  2EBS A;  2P9S C;  2TRC B;  4A0A A;  3SBP A;  1JMX B;  3W15 A;  2AGL A;  2IUV A;  2IWF A;  3UKR C;  3V9F A;  3AL9 A;  3DXK C;  3C99 A;  1VYH C;  3EI4 A;  5EM2 A;  3NVQ A;  4CY2 A;  2HXC A;  4FA5 D;  3CIK B;  2HJB A;  2Z2N A;  4ZN4 A;  4A11 A;  3UVL A;  3OTT A;  4GGC A;  4O3T B;  4FWW A;  2HYE A;  3L4O D;  3C5M A;  3BWS A;  2H47 A;  5EMM B;  5HE1 B;  2PM6 B;  4QRJ A;  3I8E A;  5FQD A;  1A0R B;  3SBQ A;  3SWS D;  5IJ7 E;  3EU7 A;  1PBY B;  1JOF A;  4AEZ A;  4ZOX A;  4GGA A;  2YB8 B;  4H5I A;  4PBZ A;  3PVU B;  4FAN D;  4CI8 A;  3I7H A;  3F3P A;  3GFC A;  3SHF A;  4J78 A;  5B4W A;  4A09 A;  3EI1 A;  4GZ8 A;  2GC4 A;  2CE8 A;  2H9L A;  4CC9 A;  3RN1 D;  3PSC B;  4UI9 R;  2HJ4 A;  4H5J A;  2UZX B;  5GXI A;  5FA5 B;  2J55 H;  3HFQ A;  1N6E A;  4G56 B;  5FKS A;  3SFZ A;  1PI6 A;  2AGX A;  4TZ4 A;  3ULE C;  3OKY A;  4IA9 A;  4L3H D;  4OZU A;  2B5N A;  5H1M A;  3UR4 A;  2I3T A;  4FAV D;  3MMY A;  4A08 B;  3ODT A;  4AOW A;  3JAM g;  3OKW A;  3I2N A;  3BG1 A;  2B4E A;  1S4U X;  3NVX A;  4XEI C;  3JPX A;  5CXC A;  4E5Z B;  2G9A A;  3AL8 B;  3JZN A;  2H6Q A;  5JWZ A;  2OK6 A;  4GQB B;  3IIW A;  4PBY A;  1QNI A;  2PM9 A;  4GQ1 A;  4BL0 A;  2W18 A;  5TDH B;  4ESG A;  3K26 A;  2OIZ A;  3FGB A;  4IMM A;  3RLM D;  4J77 A;  3JRP A;  4LGN A;  3I7K A;  5GSA A;  4O45 A;  2YNO A;  5IT9 g;  4JT6 C;  3F3F A;  5K19 A;  2YMU A;  3RFH A;  2MTA H;  4GQ2 P;  4Y7R A;  3UVK A;  5CYK A;  4J0W A;  4E54 A;  4JSV C;  2OVR B;  3CFV A;  2HKM A;  2CO0 C;  5HE2 B;  4X63 B;  2H9M A;  3MXX A;  5CXB A;  2P9K C;  3OKT A;  4JD2 C;  5EAR A;  5EAM A;  2H13 A;  3DWL C;  4J0X A;  2PBI B;  3IJ0 A;  3SBR A;  5EMK B;  2OVQ B;  3PXS D;  2QXV A;  1JJU B;  2XL2 A;  3EI2 A;  4X61 B;  5FKR A;  1YFQ A;  4A0A B;  3ZWL B;  4CY3 A;  4ZOZ A;  3UVO A;  3AFC A;  2PM7 B;  1N6F A;  1OLZ A;  1SQJ A;  3EI4 B;  4L1Q D;  5EM2 B;  3P4F A;  1B9X A;  4R7A B;  2AGZ A;  3EWE A;  1N6D A;  5THA A;  5AFU 3;  1MDA H;  3PVW B;  3VGZ A;  4A11 B;  3EMH A;  3FM0 A;  3IJC A;  5EAL A;  5IGO A;  3ORV D;  2CN2 A;  5TEE A;  1MG2 A;  5K1C C;  4CY1 A;  4ERQ A;  4J82 A;  1PEV A;  5A2Q g;  1GOT B;  3OL2 A;  5EMJ B;  4JXM A;  4HDJ A;  3B7F A;  4A08 A;  3MKQ A;  4Z8L A;  2BCJ B;  4O9D A;  4U1E I;  1OMW B;  4JSX C;  5GXH A;  3SMR A;  1GG2 B;  1K32 A;  3SXT D;  2H14 A;  2P9P C;  4A09 B;  1NR0 A;  3EI1 B;  3SVW D;  1PGU A;  4ES0 A;  4GM8 A;  4CI3 A;  3UKU C;  3AL8 A;  2H3X A;  3RFG A;  3EI3 A;  3I7L A;  3I7P A;  2H6N A;  3SLE D;  4CI1 A;  4ZOV A;  2AH1 A;  4YVD A;  2AH0 A;  2UZY B;  4J81 A;  5EML B;  4A7J A;  2OVP B;  2GC7 A;  3N0D A;  4CI2 A;  5H14 A;  4JSP C;  4QQE A;  3MZL A;  5FKT A;  4FA4 D;  4CZY A;  2B5M A;  2IUQ A;  4BUJ C;  4L3G D;  5C9Z B;  2J56 H;  3OKY B;  5KDO B;  3C9C A;  3I7N A;  3PE7 A;  2I0S A;  2Z2O A;  3SCY A;  1NEX B;  3UVM A;  2I0R A;  5AJA A;  5AMS A;  5TF2 A;  3PXW D;  3GRE A;  5C2W B;  4A0B A;  1XKS A;  3DXM C;  4J86 A;  4J8G A;  5FKQ A;  2P9N C;  2OJY A;  3FRX A;  3RSE C;  2O9K A;  2XU7 A;  3U4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...