1GXRA

Wd40 region of human groucho/tle1
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
337
structure length
335
Chain Sequence
b'DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
molecule tags Transcription
source organism Homo sapiens
publication title Crystal Structure of the C-Terminal Wd40 Repeat Domain of the Human Groucho/Tle1 Transcriptional Corepressor
pubmed doi rcsb
total genus 86
structure length 335
sequence length 337
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1gxrA00
3SVWD 5A2Qg 5H1MA 4GGDA 5TEFA 2IUPA 2W18A 4UI9R 2YMUA 1XIPA 1XHMA 2AQ5A 4K3ID 4K3JB 5FXYA 3JAMg 5IGOA 2P9IC 3PE7A 2Z2NA 3GFCA 4ERZA 3UKRC 4E5ZA 2AGWA 2H6QA 1FWXA 2XU7A 4A2LA 4JSPC 4X63B 3AL9A 5TEEA 3AFCA 3UVOA 2P9PC 5I5JA 4Y7RA 4JSXC 3UVLA 4FAND 4FB1D 1PI6A 4A0AA 3FRXA 3AH8B 4JD2C 2G9AA 4FA9D 1RI6A 4PSXB 2Z2PA 4QRJA 1OLZA 4AEZA 2XYIA 2AGLA 5CYKA 4X60B 5FKQA 1TBGA 4E54A 4ESGA 2J57G 2Q7QA 3DWLC 2H9LA 3HFQA 1NR0A 3JRPA 4J81A 2AGXA 4U7AA 2PBIB 1NEXB 3PVUB 2IWFA 3IJ1A 4GQBB 4BH6A 4BUJC 1N6EA 1B9XA 4ZOYA 5AMSA 1N6FA 2OK4A 3PXSD 2CNXA 4U1EI 3SFZA 3PVWB 3RN0D 5H14A 3VA6A 3SJLD 4A11A 3EI3A 2YNOA 1QNIA 5EAMA 4J86A 4EWRA 2XL2A 4A0BA 3BWSA 3MZKA 3EI4A 2OVQB 5EMJB 4PNKB 4J0WA 5EMLB 4O3TB 1TYQC 3EI1A 3L4MD 5CXBB 2P9NC 1S4UX 2IURA 4X61B 3EI1B 5EMMB 5CXCB 5EAPA 3JB9L 3BG0A 2P9KC 4L3GD 5FLXg 1GP2B 3IIWA 4PC0A 4I79A 4BL0A 4LG8A 3E0CA 4ZOVA 2I3TA 3DM0A 4XYIA 3SXTD 5AFU3 2AH0A 4CY5A 1VYHC 4CI3A 2J55H 4OWRA 3V9FA 5I5MA 3I8EA 2PM9B 4NSXA 4J84A 3F3GA 3JZNA 1PEVA 3I89A 4FA1D 2XL3A 3DSMA 3OL2B 2B5LA 3C9CA 3N0DA 4JXMA 3OKTA 3C5MA 2YNNA 4YVDA 1A0RB 1PGUA 5FKRA 5IT9g 3ULEC 5EM2A 5GSAA 4JT6C 2HESX 5AJAA 3W15A 1MG3A 1N6DA 2OVRB 1U2VC 4FA5D 3GREA 3I7OA 3RRMC 3EI2A 2H13A 5I5IA 2HXCA 3MZLA 1MDAH 4G56B 1U4CA 2YNPA 3DXMC 2IAAA 4ZOZA 2IUQA 4O1QD 1B9YA 5IJ7E 4J78A 2CO0C 3RFHA 3ORVD 5EMKB 2H9NA 2OVPB 2H68A 3V7DB 1L0QA 4QQEA 4J82A 3RN1D 3B7FA 4KFMB 2I0TA 1XKSA 1ERJA 4X3EA 2HJ4A 2QXVA 3UVKA 5SXMA 3MKQA 3KRWB 2EBSA 4PSWB 4J8GA 5FA5B 5FQDA 3CFSB 4GM9A 4ERYA 3SBRA 2B5NA 2HKMA 2P9SC 2H9MA 4A08A 4MK0B 5FKTA 2H9PA 3AL8B 3JZHA 3PXTD 2I3SA 5KDOB 1GOTB 3RSEC 2B4EA 4QL1A 4ES0A 5IGQA 4H5JA 3IJCA 1GXRA 5CXCA 4GMBA 4XYHA 4E54B 2CN2A 3A0FA 3I2NA 4CZVA 3JPXA 4A09B 3NVNA 4FA4D 2PM7B 3CIKB 4CY1A 4Z8LA 4GZ8A 3DXKC 5C2WB 3SBQA 4A2MA 4IA9A 5HQGA 2H47A 2Z2OA 4A0BB 3SN6B 4J79A 4PBZA 2UZYB 4Y5RD 3J81g 3RFGA 5C9ZB 3P4FA 2YBAA 3F3FA 2AGYA 3CFVA 3MKSB 2H6NA 5IC7A 3I7PA 4JSNC 4CZYA 1PBYB 4QT8A 4CI2A 4A7JA 3VH0A 4CI1A 4ERQA 4PBYA 3I7KA 4GQ1A 3AL8A 4J77A 5CYKB 5THAA 3SLED 2HJBA 4GQ2P 5GMKn 3F3PA 5HE0B 3ODTA 3EG6A 3L4OD 3OW8A 4XEIC 4JSVC 2QC5A 3K27A 3OKWA 4J0XA 4ZN4A 3U4YA 3SHFA 2CO0A 5B4WA 4FAVD 3UR4A 4CY2A 4O3UB 5K1CC 3FGBA 2H14A 4PXWA 3FM0A 4LGNA 1JJUB 3C75H 5HYNB 2MTAH 4GGAA 3IKOA 2B5MA 4FWWA 4L1QD 2GNQA 4IMMA 3EWEA 3EI3B 4L9OA 3UKUC 3UVMA 5FKSA 1P22A 5HE1B 2GC7A 1SQJA 4A0AB 3MMYA 5EALA 3I7LA 5CXBA 3SWSD 1JMXB 3SBPA 4GGCA 5H17A 1SQ9A 5HE2B 4O9DA 4GM3A 4ZOXA 2AGZA 3SCYA 1SHYB 3I7NA 3OKYA 4FHLA 4J8BA 3C99A 4J87A 5IJ8E 5JWZA 5TDHB 3N0EA 2BCJB 2YB8B 2P9LC 4CI8A 4JT5C 1Q47A 4AOWA 3K26A 2HYEA 4A09A 3I8CA 1JMZB 3I7HA 3OL2A 5HE3B 3SMRA 1OMWB 3JROA 5TF2A 4O45A 2GC4A 5EARA 4CC9A 4CZXA 3V5WB 2PM6B 2OIZA 5GXIA 3ZWLB 4CY3A 3OTTA 2UZXB 3EMHA 3IJ0A 4D6VA 3NVXA 5C2VB 4A11B 3EU7A 1MG2A 4A08B 3J80g 3RMZD 1GG2B 2I0SA 1JOFA 4D0KA 3EI2B 3MXXA 2O9KA 3OKYB 2PM9A 2H3XA 5GXHA 1R5MA 2CE8A 2HKRA 4L3HD 2OJYA 2P9UC 4R7AB 3PSLA 3KRXB 4GM8A 2AH1A 4N14A 2I0RA 3PSCB 4OZUA 1K8KC 3IIYA 4E5ZB 2TRCB 3PXWD 2CE9A 2OK6A 3EI4B 3VGZA 1K32A 3BG1A 2J56H 4HDJA 2G99A 2IWKA 3UVNA 5EM2B 4LG9A 2BBKH 2CN3A 2IUVA 4H5IA 3RLMD 1YFQA 4J73A 4TZ4A 5K19A 3JZGA 2H6KA 3NVQA
chains in the Genus database with same CATH superfamily
2EIDA 3SVWD 5A2Qg 5H1MA 4GGDA 5TEFA 4DNVA 5E6UA 2IUPA 2W18A 4UI9R 2YMUA 1XIPA 1XHMA 2AQ5A 5E6RA 4K3ID 4DNWA 3FCUA 4K3JB 4WJKA 4AX4A 5FXYA 1H2WA 3JAMg 5IGOA 2P9IC 3PE7A 2Z2NA 3EQ9A 3GFCA 4IRZA 4ERZA 1O6FA 3UKRC 4E5ZA 2AGWA 2H6QA 1FWXA 2XU7A 4A2LA 4AN0A 4JSPC 4X63B 3AL9A 5TEEA 1UOOA 3AFCA 3UVOA 2P9PC 5I5JA 4Y7RA 4JSXC 1K3IA 3UVLA 4FAND 4FB1D 1PI6A 4A0AA 3FRXA 4O2WA 3AH8B 4JD2C 2G9AA 4FA9D 1RI6A 4PSXB 1T2XA 2Z2PA 4QRJA 1OLZA 4AEZA 2XYIA 2AGLA 5CYKA 4X60B 5FKQA 1TBGA 4E54A 4ESGA 2J57G 2Q7QA 3DWLC 2H9LA 3HFQA 1NR0A 3JRPA 4J81A 3K72A 2AGXA 4U7AA 2PBIB 1NEXB 3PVUB 4JHPC 2IWFA 3IJ1A 5C86A 4GQBB 4BH6A 4BUJC 1JTDB 1N6EA 1B9XA 4ZOYA 5AMSA 1N6FA 1H2YA 2OK4A 4UM9A 3PXSD 1UOPA 2CNXA 4U1EI 3SFZA 3PVWB 3RN0D 5H14A 3VA6A 2QZPA 3SJLD 4A11A 3EI3A 2HU5A 1GOFA 3IJEA 5FFGA 2YNOA 1QNIA 5EAMA 1I2MB 4J86A 4EWRA 1UOQA 4WK2A 2XL2A 4A0BA 3BWSA 3MZKA 3EI4A 2OVQB 5EMJB 4PNKB 4J0WA 5EMLB 4O3TB 3GC3B 1TYQC 1H2XA 3EI1A 3L4MD 5CXBB 2P9NC 3ZDXA 3ZE1A 1S4UX 3V4VA 2VDRA 2IURA 2XDWA 4X61B 3ZE2A 3EI1B 5EMMB 5CXCB 5EAPA 1VZ3A 3IURA 3JB9L 3BG0A 2P9KC 1E8NA 4L3GD 4AN1A 2VDLA 4DNUA 5FLXg 1GP2B 3IIWA 4PC0A 4I79A 4BL0A 4LG8A 3E0CA 4ZOVA 2I3TA 3DM0A 4XYIA 3O4GA 3SXTD 5AFU3 2AH0A 5C92A 4CY5A 1VYHC 4CI3A 4Z7OA 2J55H 4OWRA 3V9FA 5I5MA 3I8EA 2PM9B 4NSXA 4RE6A 1E5TA 4J84A 3F3GA 1VE6A 3JZNA 1PEVA 3K71A 3I89A 4FA1D 2XL3A 3DSMA 3OL2B 3V4PA 2B5LA 3C9CA 4WK0A 3N0DA 4JXMA 3OKTA 3C5MA 2YNNA 3QI0A 4YVDA 1A0RB 1PGUA 5FKRA 5IT9g 3ULEC 5EM2A 4D9SA 5GSAA 5M61A 4JT6C 2HESX 5AJAA 1O6GA 3W15A 1MG3A 1N6DA 2OVRB 3OF7A 1U2VC 4FA5D 3GREA 3T3MA 3I7OA 3RRMC 3MVDK 2XE4A 1QFSA 3EI2A 2H13A 5I5IA 2HXCA 3MZLA 1MDAH 1E8MA 4G56B 3DXMC 1U4CA 2YNPA 2IAAA 4ZOZA 2IUQA 2VDKA 4O1QD 1B9YA 5IJ7E 4WK4A 4MMXA 4J78A 2CO0C 3RFHA 3ORVD 5EMKB 2H9NA 2OVPB 1YR2A 2H68A 3V7DB 1L0QA 4QQEA 4J82A 3RN1D 3B7FA 4KFMB 2I0TA 3KCIA 1XKSA 1ERJA 4X3EA 2HJ4A 1VZ2A 2QXVA 3UVKA 4BCDA 4NBMA 5SXMA 4Z7NA 3MKQA 3KRWB 2EBSA 4PSWB 4J8GA 5FA5B 3ZE0A 5FQDA 3CFSB 4GM9A 4ERYA 3SBRA 3O4JA 2B5NA 4O02A 2HKMA 4AMYA 2P9SC 1JV2A 3NIFA 1UTCA 2H9MA 4A08A 4MK0B 5FKTA 2H9PA 3AL8B 3JZHA 3PXTD 2I3SA 5KDOB 1GOTB 3RSEC 3VI3A 5M5VA 2B4EA 4QL1A 4ES0A 5IGQA 4L1MA 4H5JA 3IJCA 1GXRA 4G55A 5CXCA 3IUQA 4GMBA 4XYHA 4E54B 2CN2A 3A0FA 3I2NA 4CZVA 3JPXA 4A09B 3NVNA 4FA4D 2PM7B 3CIKB 4CY1A 4Z8LA 1C9LA 1GOGA 4GZ8A 3DXKC 3IULA 5C2WB 3SBQA 4A2MA 4IA9A 5HQGA 2H47A 2Z2OA 5M5UA 4A0BB 3SN6B 4J79A 4PBZA 2UZYB 2EIBA 3VI4A 1U8CA 4Y5RD 2BKLA 3RFGA 3J81g 5C9ZB 3P4FA 2YBAA 3F3FA 2AGYA 3FCSA 3CFVA 3MKSB 2H6NA 4G1EA 5IC7A 3T3PA 3I7PA 4JSNC 4CZYA 1PBYB 4QT8A 4CI2A 4A7JA 3VH0A 4CI1A 4ERQA 2VDOA 4Z7QA 4RE5A 4PBYA 2VDNA 3IUJA 3I7KA 4GQ1A 5FFOA 3AL8A 2EIEA 4J77A 3O4IA 1BPOA 5CYKB 5THAA 1GOHA 3SLED 2HJBA 4GQ2P 5GMKn 3F3PA 5HE0B 3ODTA 3EG6A 3L4OD 3OW8A 4XEIC 4JSVC 4G1MA 2QC5A 1C9IA 3K27A 3OKWA 4J0XA 4UM8A 4ZN4A 3SHFA 3U4YA 2CO0A 3ZDYA 5B4WA 3MUNA 3UR4A 4FAVD 4CY2A 4O3UB 5K1CC 3FGBA 2H14A 4PXWA 3FM0A 4LGNA 1JJUB 1L5GA 3C75H 5HYNB 2MTAH 4GGAA 1H2ZA 3IKOA 5M5RA 2B5MA 4FWWA 4L1QD 2GNQA 4IMMA 3EWEA 3EI3B 4L9OA 3UKUC 3UVMA 5FKSA 3IUMA 1P22A 3GD1I 5HE1B 4QAMA 2GC7A 4NENA 1SQJA 4A0AB 4BCBA 2QR5A 3MMYA 1A12A 5EALA 3I7LA 1M1XA 5CXBA 3SWSD 1JMXB 3SBPA 3EQ8A 4GGCA 3O4HA 5H17A 1SQ9A 5HE2B 4BP8A 4O9DA 2VDMA 4GM3A 4ZOXA 2AGZA 3SCYA 5M5SA 1SHYB 3I7NA 3OKYA 3EQ7A 4FHLA 3C99A 4J8BA 4MMZA 4J87A 5IJ8E 5JWZA 5TDHB 3N0EA 2BCJB 2YB8B 2P9LC 3IVMA 4CI8A 4JT5C 1Q47A 4AOWA 3K26A 2HYEA 4A09A 3I8CA 5E6SA 1JMZB 3I7HA 3OL2A 5HE3B 3SMRA 4BP9A 1TYEA 1OMWB 3K6SA 3JROA 5TF2A 1QFMA 4O45A 3NIGA 2GC4A 5EARA 4CC9A 4CZXA 3V5WB 2PM6B 2OIZA 2VC2A 4AMZA 5GXIA 3ZWLB 1VE7A 4CY3A 3OTTA 2UZXB 3EMHA 3IJ0A 4D6VA 3NVXA 5M5TA 4BCCA 2VZ1A 5C2VB 3MUOA 2HU8A 4A11B 3EU7A 1MG2A 4NC4A 4A08B 3J80g 3RMZD 4NAAA 1GG2B 2I0SA 1JOFA 4D0KA 3EI2B 2VDPA 3MXXA 2O9KA 3OKYB 2EICA 2PM9A 2H3XA 2JKXA 5GXHA 1R5MA 2CE8A 2VDQA 2HKRA 2WQ8A 2XZGA 4L3HD 3QHYB 2OJYA 3ZDZA 2VZ3A 2P9UC 4R7AB 3PSLA 2HU7A 3DDUA 3KRXB 4GM8A 2AH1A 4N14A 2I0RA 3PSCB 4OZUA 1K8KC 3IIYA 5HDBA 4E5ZB 2TRCB 3PXWD 2CE9A 2OK6A 3EI4B 3VGZA 1K32A 3BG1A 2J56H 4HDJA 2G99A 3NIDA 2IWKA 3UVNA 5EM2B 3IUNA 4LG9A 2BBKH 4JHNA 2CN3A 2IUVA 4H5IA 3RLMD 1YFQA 4J73A 4TZ4A 5K19A 3JZGA 2H6KA 3NVQA 4MMYA
chains in the Genus database with same CATH topology
3SVWD 5A2Qg 5H1MA 4GGDA 5TEFA 2IUPA 2W18A 4UI9R 2YMUA 1XIPA 1XHMA 2AQ5A 4K3ID 4K3JB 5FXYA 3JAMg 5IGOA 2P9IC 3PE7A 2Z2NA 3GFCA 4ERZA 3UKRC 4E5ZA 2AGWA 2H6QA 1FWXA 2XU7A 4A2LA 4JSPC 4X63B 3AL9A 5TEEA 3AFCA 3UVOA 2P9PC 5I5JA 4Y7RA 4JSXC 3UVLA 4FAND 4FB1D 1PI6A 4A0AA 3FRXA 3AH8B 4JD2C 2G9AA 4FA9D 1RI6A 4PSXB 2Z2PA 4QRJA 1OLZA 4AEZA 2XYIA 2AGLA 5CYKA 4X60B 5FKQA 1TBGA 4E54A 4ESGA 2J57G 2Q7QA 3DWLC 2H9LA 3HFQA 1NR0A 3JRPA 4J81A 2AGXA 4U7AA 2PBIB 1NEXB 3PVUB 2IWFA 3IJ1A 4GQBB 4BH6A 4BUJC 1N6EA 1B9XA 4ZOYA 5AMSA 1N6FA 2OK4A 3PXSD 2CNXA 4U1EI 3SFZA 3PVWB 3RN0D 5H14A 3VA6A 3SJLD 4A11A 3EI3A 2YNOA 1QNIA 5EAMA 4J86A 4EWRA 2XL2A 4A0BA 3BWSA 3MZKA 3EI4A 2OVQB 5EMJB 4PNKB 4J0WA 5EMLB 4O3TB 1TYQC 3EI1A 3L4MD 5CXBB 2P9NC 1S4UX 2IURA 4X61B 3EI1B 5EMMB 5CXCB 5EAPA 3JB9L 3BG0A 2P9KC 4L3GD 5FLXg 1GP2B 3IIWA 4PC0A 4I79A 4BL0A 4LG8A 3E0CA 4ZOVA 2I3TA 3DM0A 4XYIA 3SXTD 5AFU3 2AH0A 4CY5A 1VYHC 4CI3A 2J55H 4OWRA 3V9FA 5I5MA 3I8EA 2PM9B 4NSXA 4J84A 3F3GA 3JZNA 1PEVA 3I89A 4FA1D 2XL3A 3DSMA 3OL2B 2B5LA 3C9CA 3N0DA 4JXMA 3OKTA 3C5MA 2YNNA 4YVDA 1A0RB 1PGUA 5FKRA 5IT9g 3ULEC 5EM2A 5GSAA 4JT6C 2HESX 5AJAA 3W15A 1MG3A 1N6DA 2OVRB 1U2VC 4FA5D 3GREA 3I7OA 3RRMC 3EI2A 2H13A 5I5IA 2HXCA 3MZLA 1MDAH 4G56B 1U4CA 2YNPA 3DXMC 2IAAA 4ZOZA 2IUQA 4O1QD 1B9YA 5IJ7E 4J78A 2CO0C 3RFHA 3ORVD 5EMKB 2H9NA 2OVPB 2H68A 3V7DB 1L0QA 4QQEA 4J82A 3RN1D 3B7FA 4KFMB 2I0TA 1XKSA 1ERJA 4X3EA 2HJ4A 2QXVA 3UVKA 5SXMA 3MKQA 3KRWB 2EBSA 4PSWB 4J8GA 5FA5B 5FQDA 3CFSB 4GM9A 4ERYA 3SBRA 2B5NA 2HKMA 2P9SC 2H9MA 4A08A 4MK0B 5FKTA 2H9PA 3AL8B 3JZHA 3PXTD 2I3SA 5KDOB 1GOTB 3RSEC 2B4EA 4QL1A 4ES0A 5IGQA 4H5JA 3IJCA 1GXRA 5CXCA 4GMBA 4XYHA 4E54B 2CN2A 3A0FA 3I2NA 4CZVA 3JPXA 4A09B 3NVNA 4FA4D 2PM7B 3CIKB 4CY1A 4Z8LA 4GZ8A 3DXKC 5C2WB 3SBQA 4A2MA 4IA9A 5HQGA 2H47A 2Z2OA 4A0BB 3SN6B 4J79A 4PBZA 2UZYB 4Y5RD 3J81g 3RFGA 5C9ZB 3P4FA 2YBAA 3F3FA 2AGYA 3CFVA 3MKSB 2H6NA 5IC7A 3I7PA 4JSNC 4CZYA 1PBYB 4QT8A 4CI2A 4A7JA 3VH0A 4CI1A 4ERQA 4PBYA 3I7KA 4GQ1A 3AL8A 4J77A 5CYKB 5THAA 3SLED 2HJBA 4GQ2P 5GMKn 3F3PA 5HE0B 3ODTA 3EG6A 3L4OD 3OW8A 4XEIC 4JSVC 2QC5A 3K27A 3OKWA 4J0XA 4ZN4A 3U4YA 3SHFA 2CO0A 5B4WA 4FAVD 3UR4A 4CY2A 4O3UB 5K1CC 3FGBA 2H14A 4PXWA 3FM0A 4LGNA 1JJUB 3C75H 5HYNB 2MTAH 4GGAA 3IKOA 2B5MA 4FWWA 4L1QD 2GNQA 4IMMA 3EWEA 3EI3B 4L9OA 3UKUC 3UVMA 5FKSA 1P22A 5HE1B 2GC7A 1SQJA 4A0AB 3MMYA 5EALA 3I7LA 5CXBA 3SWSD 1JMXB 3SBPA 4GGCA 5H17A 1SQ9A 5HE2B 4O9DA 4GM3A 4ZOXA 2AGZA 3SCYA 1SHYB 3I7NA 3OKYA 4FHLA 4J8BA 3C99A 4J87A 5IJ8E 5JWZA 5TDHB 3N0EA 2BCJB 2YB8B 2P9LC 4CI8A 4JT5C 1Q47A 4AOWA 3K26A 2HYEA 4A09A 3I8CA 1JMZB 3I7HA 3OL2A 5HE3B 3SMRA 1OMWB 3JROA 5TF2A 4O45A 2GC4A 5EARA 4CC9A 4CZXA 3V5WB 2PM6B 2OIZA 5GXIA 3ZWLB 4CY3A 3OTTA 2UZXB 3EMHA 3IJ0A 4D6VA 3NVXA 5C2VB 4A11B 3EU7A 1MG2A 4A08B 3J80g 3RMZD 1GG2B 2I0SA 1JOFA 4D0KA 3EI2B 3MXXA 2O9KA 3OKYB 2PM9A 2H3XA 5GXHA 1R5MA 2CE8A 2HKRA 4L3HD 2OJYA 2P9UC 4R7AB 3PSLA 3KRXB 4GM8A 2AH1A 4N14A 2I0RA 3PSCB 4OZUA 1K8KC 3IIYA 4E5ZB 2TRCB 3PXWD 2CE9A 2OK6A 3EI4B 3VGZA 1K32A 3BG1A 2J56H 4HDJA 2G99A 2IWKA 3UVNA 5EM2B 4LG9A 2BBKH 2CN3A 2IUVA 4H5IA 3RLMD 1YFQA 4J73A 4TZ4A 5K19A 3JZGA 2H6KA 3NVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVW D;  5A2Q g;  5H1M A;  4GGD A;  5TEF A;  2IUP A;  2W18 A;  4UI9 R;  2YMU A;  1XIP A;  1XHM A;  2AQ5 A;  4K3I D;  4K3J B;  5FXY A;  3JAM g;  5IGO A;  2P9I C;  3PE7 A;  2Z2N A;  3GFC A;  4ERZ A;  3UKR C;  4E5Z A;  2AGW A;  2H6Q A;  1FWX A;  2XU7 A;  4A2L A;  4JSP C;  4X63 B;  3AL9 A;  5TEE A;  3AFC A;  3UVO A;  2P9P C;  5I5J A;  4Y7R A;  4JSX C;  3UVL A;  4FAN D;  4FB1 D;  1PI6 A;  4A0A A;  3FRX A;  3AH8 B;  4JD2 C;  2G9A A;  4FA9 D;  1RI6 A;  4PSX B;  2Z2P A;  4QRJ A;  1OLZ A;  4AEZ A;  2XYI A;  2AGL A;  5CYK A;  4X60 B;  5FKQ A;  1TBG A;  4E54 A;  4ESG A;  2J57 G;  2Q7Q A;  3DWL C;  2H9L A;  3HFQ A;  1NR0 A;  3JRP A;  4J81 A;  2AGX A;  4U7A A;  2PBI B;  1NEX B;  3PVU B;  2IWF A;  3IJ1 A;  4GQB B;  4BH6 A;  4BUJ C;  1N6E A;  1B9X A;  4ZOY A;  5AMS A;  1N6F A;  2OK4 A;  3PXS D;  2CNX A;  4U1E I;  3SFZ A;  3PVW B;  3RN0 D;  5H14 A;  3VA6 A;  3SJL D;  4A11 A;  3EI3 A;  2YNO A;  1QNI A;  5EAM A;  4J86 A;  4EWR A;  2XL2 A;  4A0B A;  3BWS A;  3MZK A;  3EI4 A;  2OVQ B;  5EMJ B;  4PNK B;  4J0W A;  5EML B;  4O3T B;  1TYQ C;  3EI1 A;  3L4M D;  5CXB B;  2P9N C;  1S4U X;  2IUR A;  4X61 B;  3EI1 B;  5EMM B;  5CXC B;  5EAP A;  3JB9 L;  3BG0 A;  2P9K C;  4L3G D;  5FLX g;  1GP2 B;  3IIW A;  4PC0 A;  4I79 A;  4BL0 A;  4LG8 A;  3E0C A;  4ZOV A;  2I3T A;  3DM0 A;  4XYI A;  3SXT D;  5AFU 3;  2AH0 A;  4CY5 A;  1VYH C;  4CI3 A;  2J55 H;  4OWR A;  3V9F A;  5I5M A;  3I8E A;  2PM9 B;  4NSX A;  4J84 A;  3F3G A;  3JZN A;  1PEV A;  3I89 A;  4FA1 D;  2XL3 A;  3DSM A;  3OL2 B;  2B5L A;  3C9C A;  3N0D A;  4JXM A;  3OKT A;  3C5M A;  2YNN A;  4YVD A;  1A0R B;  1PGU A;  5FKR A;  5IT9 g;  3ULE C;  5EM2 A;  5GSA A;  4JT6 C;  2HES X;  5AJA A;  3W15 A;  1MG3 A;  1N6D A;  2OVR B;  1U2V C;  4FA5 D;  3GRE A;  3I7O A;  3RRM C;  3EI2 A;  2H13 A;  5I5I A;  2HXC A;  3MZL A;  1MDA H;  4G56 B;  1U4C A;  2YNP A;  3DXM C;  2IAA A;  4ZOZ A;  2IUQ A;  4O1Q D;  1B9Y A;  5IJ7 E;  4J78 A;  2CO0 C;  3RFH A;  3ORV D;  5EMK B;  2H9N A;  2OVP B;  2H68 A;  3V7D B;  1L0Q A;  4QQE A;  4J82 A;  3RN1 D;  3B7F A;  4KFM B;  2I0T A;  1XKS A;  1ERJ A;  4X3E A;  2HJ4 A;  2QXV A;  3UVK A;  5SXM A;  3MKQ A;  3KRW B;  2EBS A;  4PSW B;  4J8G A;  5FA5 B;  5FQD A;  3CFS B;  4GM9 A;  4ERY A;  3SBR A;  2B5N A;  2HKM A;  2P9S C;  2H9M A;  4A08 A;  4MK0 B;  5FKT A;  2H9P A;  3AL8 B;  3JZH A;  3PXT D;  2I3S A;  5KDO B;  1GOT B;  3RSE C;  2B4E A;  4QL1 A;  4ES0 A;  5IGQ A;  4H5J A;  3IJC A;  1GXR A;  5CXC A;  4GMB A;  4XYH A;  4E54 B;  2CN2 A;  3A0F A;  3I2N A;  4CZV A;  3JPX A;  4A09 B;  3NVN A;  4FA4 D;  2PM7 B;  3CIK B;  4CY1 A;  4Z8L A;  4GZ8 A;  3DXK C;  5C2W B;  3SBQ A;  4A2M A;  4IA9 A;  5HQG A;  2H47 A;  2Z2O A;  4A0B B;  3SN6 B;  4J79 A;  4PBZ A;  2UZY B;  4Y5R D;  3J81 g;  3RFG A;  5C9Z B;  3P4F A;  2YBA A;  3F3F A;  2AGY A;  3CFV A;  3MKS B;  2H6N A;  5IC7 A;  3I7P A;  4JSN C;  4CZY A;  1PBY B;  4QT8 A;  4CI2 A;  4A7J A;  3VH0 A;  4CI1 A;  4ERQ A;  4PBY A;  3I7K A;  4GQ1 A;  3AL8 A;  4J77 A;  5CYK B;  5THA A;  3SLE D;  2HJB A;  4GQ2 P;  5GMK n;  3F3P A;  5HE0 B;  3ODT A;  3EG6 A;  3L4O D;  3OW8 A;  4XEI C;  4JSV C;  2QC5 A;  3K27 A;  3OKW A;  4J0X A;  4ZN4 A;  3U4Y A;  3SHF A;  2CO0 A;  5B4W A;  4FAV D;  3UR4 A;  4CY2 A;  4O3U B;  5K1C C;  3FGB A;  2H14 A;  4PXW A;  3FM0 A;  4LGN A;  1JJU B;  3C75 H;  5HYN B;  2MTA H;  4GGA A;  3IKO A;  2B5M A;  4FWW A;  4L1Q D;  2GNQ A;  4IMM A;  3EWE A;  3EI3 B;  4L9O A;  3UKU C;  3UVM A;  5FKS A;  1P22 A;  5HE1 B;  2GC7 A;  1SQJ A;  4A0A B;  3MMY A;  5EAL A;  3I7L A;  5CXB A;  3SWS D;  1JMX B;  3SBP A;  4GGC A;  5H17 A;  1SQ9 A;  5HE2 B;  4O9D A;  4GM3 A;  4ZOX A;  2AGZ A;  3SCY A;  1SHY B;  3I7N A;  3OKY A;  4FHL A;  4J8B A;  3C99 A;  4J87 A;  5IJ8 E;  5JWZ A;  5TDH B;  3N0E A;  2BCJ B;  2YB8 B;  2P9L C;  4CI8 A;  4JT5 C;  1Q47 A;  4AOW A;  3K26 A;  2HYE A;  4A09 A;  3I8C A;  1JMZ B;  3I7H A;  3OL2 A;  5HE3 B;  3SMR A;  1OMW B;  3JRO A;  5TF2 A;  4O45 A;  2GC4 A;  5EAR A;  4CC9 A;  4CZX A;  3V5W B;  2PM6 B;  2OIZ A;  5GXI A;  3ZWL B;  4CY3 A;  3OTT A;  2UZX B;  3EMH A;  3IJ0 A;  4D6V A;  3NVX A;  5C2V B;  4A11 B;  3EU7 A;  1MG2 A;  4A08 B;  3J80 g;  3RMZ D;  1GG2 B;  2I0S A;  1JOF A;  4D0K A;  3EI2 B;  3MXX A;  2O9K A;  3OKY B;  2PM9 A;  2H3X A;  5GXH A;  1R5M A;  2CE8 A;  2HKR A;  4L3H D;  2OJY A;  2P9U C;  4R7A B;  3PSL A;  3KRX B;  4GM8 A;  2AH1 A;  4N14 A;  2I0R A;  3PSC B;  4OZU A;  1K8K C;  3IIY A;  4E5Z B;  2TRC B;  3PXW D;  2CE9 A;  2OK6 A;  3EI4 B;  3VGZ A;  1K32 A;  3BG1 A;  2J56 H;  4HDJ A;  2G99 A;  2IWK A;  3UVN A;  5EM2 B;  4LG9 A;  2BBK H;  2CN3 A;  2IUV A;  4H5I A;  3RLM D;  1YFQ A;  4J73 A;  4TZ4 A;  5K19 A;  3JZG A;  2H6K A;  3NVQ A; 
#chains in the Genus database with same CATH topology
 2EID A;  3SVW D;  5A2Q g;  5H1M A;  4GGD A;  5TEF A;  4DNV A;  5E6U A;  2IUP A;  2W18 A;  4UI9 R;  2YMU A;  1XIP A;  1XHM A;  2AQ5 A;  5E6R A;  4K3I D;  4DNW A;  3FCU A;  4K3J B;  4WJK A;  4AX4 A;  5FXY A;  1H2W A;  3JAM g;  5IGO A;  2P9I C;  3PE7 A;  2Z2N A;  3EQ9 A;  3GFC A;  4IRZ A;  4ERZ A;  1O6F A;  3UKR C;  4E5Z A;  2AGW A;  2H6Q A;  1FWX A;  2XU7 A;  4A2L A;  4AN0 A;  4JSP C;  4X63 B;  3AL9 A;  5TEE A;  1UOO A;  3AFC A;  3UVO A;  2P9P C;  5I5J A;  4Y7R A;  4JSX C;  1K3I A;  3UVL A;  4FAN D;  4FB1 D;  1PI6 A;  4A0A A;  3FRX A;  4O2W A;  3AH8 B;  4JD2 C;  2G9A A;  4FA9 D;  1RI6 A;  4PSX B;  1T2X A;  2Z2P A;  4QRJ A;  1OLZ A;  4AEZ A;  2XYI A;  2AGL A;  5CYK A;  4X60 B;  5FKQ A;  1TBG A;  4E54 A;  4ESG A;  2J57 G;  2Q7Q A;  3DWL C;  2H9L A;  3HFQ A;  1NR0 A;  3JRP A;  4J81 A;  3K72 A;  2AGX A;  4U7A A;  2PBI B;  1NEX B;  3PVU B;  4JHP C;  2IWF A;  3IJ1 A;  5C86 A;  4GQB B;  4BH6 A;  4BUJ C;  1JTD B;  1N6E A;  1B9X A;  4ZOY A;  5AMS A;  1N6F A;  1H2Y A;  2OK4 A;  4UM9 A;  3PXS D;  1UOP A;  2CNX A;  4U1E I;  3SFZ A;  3PVW B;  3RN0 D;  5H14 A;  3VA6 A;  2QZP A;  3SJL D;  4A11 A;  3EI3 A;  2HU5 A;  1GOF A;  3IJE A;  5FFG A;  2YNO A;  1QNI A;  5EAM A;  1I2M B;  4J86 A;  4EWR A;  1UOQ A;  4WK2 A;  2XL2 A;  4A0B A;  3BWS A;  3MZK A;  3EI4 A;  2OVQ B;  5EMJ B;  4PNK B;  4J0W A;  5EML B;  4O3T B;  3GC3 B;  1TYQ C;  1H2X A;  3EI1 A;  3L4M D;  5CXB B;  2P9N C;  3ZDX A;  3ZE1 A;  1S4U X;  3V4V A;  2VDR A;  2IUR A;  2XDW A;  4X61 B;  3ZE2 A;  3EI1 B;  5EMM B;  5CXC B;  5EAP A;  1VZ3 A;  3IUR A;  3JB9 L;  3BG0 A;  2P9K C;  1E8N A;  4L3G D;  4AN1 A;  2VDL A;  4DNU A;  5FLX g;  1GP2 B;  3IIW A;  4PC0 A;  4I79 A;  4BL0 A;  4LG8 A;  3E0C A;  4ZOV A;  2I3T A;  3DM0 A;  4XYI A;  3O4G A;  3SXT D;  5AFU 3;  2AH0 A;  5C92 A;  4CY5 A;  1VYH C;  4CI3 A;  4Z7O A;  2J55 H;  4OWR A;  3V9F A;  5I5M A;  3I8E A;  2PM9 B;  4NSX A;  4RE6 A;  1E5T A;  4J84 A;  3F3G A;  1VE6 A;  3JZN A;  1PEV A;  3K71 A;  3I89 A;  4FA1 D;  2XL3 A;  3DSM A;  3OL2 B;  3V4P A;  2B5L A;  3C9C A;  4WK0 A;  3N0D A;  4JXM A;  3OKT A;  3C5M A;  2YNN A;  3QI0 A;  4YVD A;  1A0R B;  1PGU A;  5FKR A;  5IT9 g;  3ULE C;  5EM2 A;  4D9S A;  5GSA A;  5M61 A;  4JT6 C;  2HES X;  5AJA A;  1O6G A;  3W15 A;  1MG3 A;  1N6D A;  2OVR B;  3OF7 A;  1U2V C;  4FA5 D;  3GRE A;  3T3M A;  3I7O A;  3RRM C;  3MVD K;  2XE4 A;  1QFS A;  3EI2 A;  2H13 A;  5I5I A;  2HXC A;  3MZL A;  1MDA H;  1E8M A;  4G56 B;  3DXM C;  1U4C A;  2YNP A;  2IAA A;  4ZOZ A;  2IUQ A;  2VDK A;  4O1Q D;  1B9Y A;  5IJ7 E;  4WK4 A;  4MMX A;  4J78 A;  2CO0 C;  3RFH A;  3ORV D;  5EMK B;  2H9N A;  2OVP B;  1YR2 A;  2H68 A;  3V7D B;  1L0Q A;  4QQE A;  4J82 A;  3RN1 D;  3B7F A;  4KFM B;  2I0T A;  3KCI A;  1XKS A;  1ERJ A;  4X3E A;  2HJ4 A;  1VZ2 A;  2QXV A;  3UVK A;  4BCD A;  4NBM A;  5SXM A;  4Z7N A;  3MKQ A;  3KRW B;  2EBS A;  4PSW B;  4J8G A;  5FA5 B;  3ZE0 A;  5FQD A;  3CFS B;  4GM9 A;  4ERY A;  3SBR A;  3O4J A;  2B5N A;  4O02 A;  2HKM A;  4AMY A;  2P9S C;  1JV2 A;  3NIF A;  1UTC A;  2H9M A;  4A08 A;  4MK0 B;  5FKT A;  2H9P A;  3AL8 B;  3JZH A;  3PXT D;  2I3S A;  5KDO B;  1GOT B;  3RSE C;  3VI3 A;  5M5V A;  2B4E A;  4QL1 A;  4ES0 A;  5IGQ A;  4L1M A;  4H5J A;  3IJC A;  1GXR A;  4G55 A;  5CXC A;  3IUQ A;  4GMB A;  4XYH A;  4E54 B;  2CN2 A;  3A0F A;  3I2N A;  4CZV A;  3JPX A;  4A09 B;  3NVN A;  4FA4 D;  2PM7 B;  3CIK B;  4CY1 A;  4Z8L A;  1C9L A;  1GOG A;  4GZ8 A;  3DXK C;  3IUL A;  5C2W B;  3SBQ A;  4A2M A;  4IA9 A;  5HQG A;  2H47 A;  2Z2O A;  5M5U A;  4A0B B;  3SN6 B;  4J79 A;  4PBZ A;  2UZY B;  2EIB A;  3VI4 A;  1U8C A;  4Y5R D;  2BKL A;  3RFG A;  3J81 g;  5C9Z B;  3P4F A;  2YBA A;  3F3F A;  2AGY A;  3FCS A;  3CFV A;  3MKS B;  2H6N A;  4G1E A;  5IC7 A;  3T3P A;  3I7P A;  4JSN C;  4CZY A;  1PBY B;  4QT8 A;  4CI2 A;  4A7J A;  3VH0 A;  4CI1 A;  4ERQ A;  2VDO A;  4Z7Q A;  4RE5 A;  4PBY A;  2VDN A;  3IUJ A;  3I7K A;  4GQ1 A;  5FFO A;  3AL8 A;  2EIE A;  4J77 A;  3O4I A;  1BPO A;  5CYK B;  5THA A;  1GOH A;  3SLE D;  2HJB A;  4GQ2 P;  5GMK n;  3F3P A;  5HE0 B;  3ODT A;  3EG6 A;  3L4O D;  3OW8 A;  4XEI C;  4JSV C;  4G1M A;  2QC5 A;  1C9I A;  3K27 A;  3OKW A;  4J0X A;  4UM8 A;  4ZN4 A;  3SHF A;  3U4Y A;  2CO0 A;  3ZDY A;  5B4W A;  3MUN A;  3UR4 A;  4FAV D;  4CY2 A;  4O3U B;  5K1C C;  3FGB A;  2H14 A;  4PXW A;  3FM0 A;  4LGN A;  1JJU B;  1L5G A;  3C75 H;  5HYN B;  2MTA H;  4GGA A;  1H2Z A;  3IKO A;  5M5R A;  2B5M A;  4FWW A;  4L1Q D;  2GNQ A;  4IMM A;  3EWE A;  3EI3 B;  4L9O A;  3UKU C;  3UVM A;  5FKS A;  3IUM A;  1P22 A;  3GD1 I;  5HE1 B;  4QAM A;  2GC7 A;  4NEN A;  1SQJ A;  4A0A B;  4BCB A;  2QR5 A;  3MMY A;  1A12 A;  5EAL A;  3I7L A;  1M1X A;  5CXB A;  3SWS D;  1JMX B;  3SBP A;  3EQ8 A;  4GGC A;  3O4H A;  5H17 A;  1SQ9 A;  5HE2 B;  4BP8 A;  4O9D A;  2VDM A;  4GM3 A;  4ZOX A;  2AGZ A;  3SCY A;  5M5S A;  1SHY B;  3I7N A;  3OKY A;  3EQ7 A;  4FHL A;  3C99 A;  4J8B A;  4MMZ A;  4J87 A;  5IJ8 E;  5JWZ A;  5TDH B;  3N0E A;  2BCJ B;  2YB8 B;  2P9L C;  3IVM A;  4CI8 A;  4JT5 C;  1Q47 A;  4AOW A;  3K26 A;  2HYE A;  4A09 A;  3I8C A;  5E6S A;  1JMZ B;  3I7H A;  3OL2 A;  5HE3 B;  3SMR A;  4BP9 A;  1TYE A;  1OMW B;  3K6S A;  3JRO A;  5TF2 A;  1QFM A;  4O45 A;  3NIG A;  2GC4 A;  5EAR A;  4CC9 A;  4CZX A;  3V5W B;  2PM6 B;  2OIZ A;  2VC2 A;  4AMZ A;  5GXI A;  3ZWL B;  1VE7 A;  4CY3 A;  3OTT A;  2UZX B;  3EMH A;  3IJ0 A;  4D6V A;  3NVX A;  5M5T A;  4BCC A;  2VZ1 A;  5C2V B;  3MUO A;  2HU8 A;  4A11 B;  3EU7 A;  1MG2 A;  4NC4 A;  4A08 B;  3J80 g;  3RMZ D;  4NAA A;  1GG2 B;  2I0S A;  1JOF A;  4D0K A;  3EI2 B;  2VDP A;  3MXX A;  2O9K A;  3OKY B;  2EIC A;  2PM9 A;  2H3X A;  2JKX A;  5GXH A;  1R5M A;  2CE8 A;  2VDQ A;  2HKR A;  2WQ8 A;  2XZG A;  4L3H D;  3QHY B;  2OJY A;  3ZDZ A;  2VZ3 A;  2P9U C;  4R7A B;  3PSL A;  2HU7 A;  3DDU A;  3KRX B;  4GM8 A;  2AH1 A;  4N14 A;  2I0R A;  3PSC B;  4OZU A;  1K8K C;  3IIY A;  5HDB A;  4E5Z B;  2TRC B;  3PXW D;  2CE9 A;  2OK6 A;  3EI4 B;  3VGZ A;  1K32 A;  3BG1 A;  2J56 H;  4HDJ A;  2G99 A;  3NID A;  2IWK A;  3UVN A;  5EM2 B;  3IUN A;  4LG9 A;  2BBK H;  4JHN A;  2CN3 A;  2IUV A;  4H5I A;  3RLM D;  1YFQ A;  4J73 A;  4TZ4 A;  5K19 A;  3JZG A;  2H6K A;  3NVQ A;  4MMY A; 
#chains in the Genus database with same CATH homology
 3SVW D;  5A2Q g;  5H1M A;  4GGD A;  5TEF A;  2IUP A;  2W18 A;  4UI9 R;  2YMU A;  1XIP A;  1XHM A;  2AQ5 A;  4K3I D;  4K3J B;  5FXY A;  3JAM g;  5IGO A;  2P9I C;  3PE7 A;  2Z2N A;  3GFC A;  4ERZ A;  3UKR C;  4E5Z A;  2AGW A;  2H6Q A;  1FWX A;  2XU7 A;  4A2L A;  4JSP C;  4X63 B;  3AL9 A;  5TEE A;  3AFC A;  3UVO A;  2P9P C;  5I5J A;  4Y7R A;  4JSX C;  3UVL A;  4FAN D;  4FB1 D;  1PI6 A;  4A0A A;  3FRX A;  3AH8 B;  4JD2 C;  2G9A A;  4FA9 D;  1RI6 A;  4PSX B;  2Z2P A;  4QRJ A;  1OLZ A;  4AEZ A;  2XYI A;  2AGL A;  5CYK A;  4X60 B;  5FKQ A;  1TBG A;  4E54 A;  4ESG A;  2J57 G;  2Q7Q A;  3DWL C;  2H9L A;  3HFQ A;  1NR0 A;  3JRP A;  4J81 A;  2AGX A;  4U7A A;  2PBI B;  1NEX B;  3PVU B;  2IWF A;  3IJ1 A;  4GQB B;  4BH6 A;  4BUJ C;  1N6E A;  1B9X A;  4ZOY A;  5AMS A;  1N6F A;  2OK4 A;  3PXS D;  2CNX A;  4U1E I;  3SFZ A;  3PVW B;  3RN0 D;  5H14 A;  3VA6 A;  3SJL D;  4A11 A;  3EI3 A;  2YNO A;  1QNI A;  5EAM A;  4J86 A;  4EWR A;  2XL2 A;  4A0B A;  3BWS A;  3MZK A;  3EI4 A;  2OVQ B;  5EMJ B;  4PNK B;  4J0W A;  5EML B;  4O3T B;  1TYQ C;  3EI1 A;  3L4M D;  5CXB B;  2P9N C;  1S4U X;  2IUR A;  4X61 B;  3EI1 B;  5EMM B;  5CXC B;  5EAP A;  3JB9 L;  3BG0 A;  2P9K C;  4L3G D;  5FLX g;  1GP2 B;  3IIW A;  4PC0 A;  4I79 A;  4BL0 A;  4LG8 A;  3E0C A;  4ZOV A;  2I3T A;  3DM0 A;  4XYI A;  3SXT D;  5AFU 3;  2AH0 A;  4CY5 A;  1VYH C;  4CI3 A;  2J55 H;  4OWR A;  3V9F A;  5I5M A;  3I8E A;  2PM9 B;  4NSX A;  4J84 A;  3F3G A;  3JZN A;  1PEV A;  3I89 A;  4FA1 D;  2XL3 A;  3DSM A;  3OL2 B;  2B5L A;  3C9C A;  3N0D A;  4JXM A;  3OKT A;  3C5M A;  2YNN A;  4YVD A;  1A0R B;  1PGU A;  5FKR A;  5IT9 g;  3ULE C;  5EM2 A;  5GSA A;  4JT6 C;  2HES X;  5AJA A;  3W15 A;  1MG3 A;  1N6D A;  2OVR B;  1U2V C;  4FA5 D;  3GRE A;  3I7O A;  3RRM C;  3EI2 A;  2H13 A;  5I5I A;  2HXC A;  3MZL A;  1MDA H;  4G56 B;  1U4C A;  2YNP A;  3DXM C;  2IAA A;  4ZOZ A;  2IUQ A;  4O1Q D;  1B9Y A;  5IJ7 E;  4J78 A;  2CO0 C;  3RFH A;  3ORV D;  5EMK B;  2H9N A;  2OVP B;  2H68 A;  3V7D B;  1L0Q A;  4QQE A;  4J82 A;  3RN1 D;  3B7F A;  4KFM B;  2I0T A;  1XKS A;  1ERJ A;  4X3E A;  2HJ4 A;  2QXV A;  3UVK A;  5SXM A;  3MKQ A;  3KRW B;  2EBS A;  4PSW B;  4J8G A;  5FA5 B;  5FQD A;  3CFS B;  4GM9 A;  4ERY A;  3SBR A;  2B5N A;  2HKM A;  2P9S C;  2H9M A;  4A08 A;  4MK0 B;  5FKT A;  2H9P A;  3AL8 B;  3JZH A;  3PXT D;  2I3S A;  5KDO B;  1GOT B;  3RSE C;  2B4E A;  4QL1 A;  4ES0 A;  5IGQ A;  4H5J A;  3IJC A;  1GXR A;  5CXC A;  4GMB A;  4XYH A;  4E54 B;  2CN2 A;  3A0F A;  3I2N A;  4CZV A;  3JPX A;  4A09 B;  3NVN A;  4FA4 D;  2PM7 B;  3CIK B;  4CY1 A;  4Z8L A;  4GZ8 A;  3DXK C;  5C2W B;  3SBQ A;  4A2M A;  4IA9 A;  5HQG A;  2H47 A;  2Z2O A;  4A0B B;  3SN6 B;  4J79 A;  4PBZ A;  2UZY B;  4Y5R D;  3J81 g;  3RFG A;  5C9Z B;  3P4F A;  2YBA A;  3F3F A;  2AGY A;  3CFV A;  3MKS B;  2H6N A;  5IC7 A;  3I7P A;  4JSN C;  4CZY A;  1PBY B;  4QT8 A;  4CI2 A;  4A7J A;  3VH0 A;  4CI1 A;  4ERQ A;  4PBY A;  3I7K A;  4GQ1 A;  3AL8 A;  4J77 A;  5CYK B;  5THA A;  3SLE D;  2HJB A;  4GQ2 P;  5GMK n;  3F3P A;  5HE0 B;  3ODT A;  3EG6 A;  3L4O D;  3OW8 A;  4XEI C;  4JSV C;  2QC5 A;  3K27 A;  3OKW A;  4J0X A;  4ZN4 A;  3U4Y A;  3SHF A;  2CO0 A;  5B4W A;  4FAV D;  3UR4 A;  4CY2 A;  4O3U B;  5K1C C;  3FGB A;  2H14 A;  4PXW A;  3FM0 A;  4LGN A;  1JJU B;  3C75 H;  5HYN B;  2MTA H;  4GGA A;  3IKO A;  2B5M A;  4FWW A;  4L1Q D;  2GNQ A;  4IMM A;  3EWE A;  3EI3 B;  4L9O A;  3UKU C;  3UVM A;  5FKS A;  1P22 A;  5HE1 B;  2GC7 A;  1SQJ A;  4A0A B;  3MMY A;  5EAL A;  3I7L A;  5CXB A;  3SWS D;  1JMX B;  3SBP A;  4GGC A;  5H17 A;  1SQ9 A;  5HE2 B;  4O9D A;  4GM3 A;  4ZOX A;  2AGZ A;  3SCY A;  1SHY B;  3I7N A;  3OKY A;  4FHL A;  4J8B A;  3C99 A;  4J87 A;  5IJ8 E;  5JWZ A;  5TDH B;  3N0E A;  2BCJ B;  2YB8 B;  2P9L C;  4CI8 A;  4JT5 C;  1Q47 A;  4AOW A;  3K26 A;  2HYE A;  4A09 A;  3I8C A;  1JMZ B;  3I7H A;  3OL2 A;  5HE3 B;  3SMR A;  1OMW B;  3JRO A;  5TF2 A;  4O45 A;  2GC4 A;  5EAR A;  4CC9 A;  4CZX A;  3V5W B;  2PM6 B;  2OIZ A;  5GXI A;  3ZWL B;  4CY3 A;  3OTT A;  2UZX B;  3EMH A;  3IJ0 A;  4D6V A;  3NVX A;  5C2V B;  4A11 B;  3EU7 A;  1MG2 A;  4A08 B;  3J80 g;  3RMZ D;  1GG2 B;  2I0S A;  1JOF A;  4D0K A;  3EI2 B;  3MXX A;  2O9K A;  3OKY B;  2PM9 A;  2H3X A;  5GXH A;  1R5M A;  2CE8 A;  2HKR A;  4L3H D;  2OJY A;  2P9U C;  4R7A B;  3PSL A;  3KRX B;  4GM8 A;  2AH1 A;  4N14 A;  2I0R A;  3PSC B;  4OZU A;  1K8K C;  3IIY A;  4E5Z B;  2TRC B;  3PXW D;  2CE9 A;  2OK6 A;  3EI4 B;  3VGZ A;  1K32 A;  3BG1 A;  2J56 H;  4HDJ A;  2G99 A;  2IWK A;  3UVN A;  5EM2 B;  4LG9 A;  2BBK H;  2CN3 A;  2IUV A;  4H5I A;  3RLM D;  1YFQ A;  4J73 A;  4TZ4 A;  5K19 A;  3JZG A;  2H6K A;  3NVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...