1GXRA

Wd40 region of human groucho/tle1
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
337
structure length
335
Chain Sequence
DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the C-Terminal Wd40 Repeat Domain of the Human Groucho/Tle1 Transcriptional Corepressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
total genus 86
structure length 335
sequence length 337
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1gxrA00
3I7KA 2PM9B 4PXWA 3I8CA 3JAMg 4Y5RD 3NVXA 5EARA 5B4WA 5EAMA 3GFCA 1OMWB 4ERYA 2OVRB 3N0EA 5HE0B 3J81g 3V7DB 5EMLB 3EI4A 3SHFA 4E54B 2B5NA 3ZWLB 5H1MA 1K8KC 3BWSA 1JMZB 1JJUB 1NEXB 3OTTA 3OL2B 3MKQA 3DM0A 3SMRA 4A0BA 3NVQA 2CO0A 5SXMA 2YBAA 1OLZA 2UZXB 5H17A 2OVQB 5C9ZB 3NVNA 4A11B 3EMHA 5CXCB 2OVPB 3EU7A 2P9LC 3GREA 3C5MA 3OKYB 4X60B 1P22A 3RLMD 3SLED 5EMMB 5FA5B 5TEEA 3CFSB 4LG9A 3A0FA 4D0KA 2YMUA 4CY2A 2AGWA 4PBYA 2IURA 1S4UX 3RRMC 2AGZA 4ZOXA 4ES0A 3UVLA 5HE3B 4E54A 4GM8A 4CI3A 4EWRA 4FAVD 3OL2A 3V9FA 2I3SA 2J56H 2MTAH 2Z2OA 4K3JB 4KFMB 1GXRA 5JWZA 3L4OD 1MG2A 5TDHB 4I79A 3K26A 2B5LA 1NR0A 4CI8A 4GM3A 2UZYB 3I8EA 4JT6C 4OZUA 4L3GD 3JRPA 3C9CA 3UR4A 4TZ4A 4GQ2P 5CYKA 5C2VB 3KRXB 4FB1D 2P9NC 4QQEA 4CZVA 1XIPA 4A2MA 3RN0D 4ZOZA 3SBQA 1XKSA 2H47A 4PSXB 4FAND 3E0CA 5FKSA 2CN3A 3IJ1A 3OKYA 1GP2B 4XYIA 2P9PC 3DWLC 5AMSA 5H14A 2BBKH 3ULEC 3UVMA 3DXMC 3PSLA 2H6KA 4X61B 4FA5D 3ODTA 4A11A 4J8BA 1JMXB 4O9DA 3VH0A 4J82A 3VA6A 4JD2C 4J8GA 2H6QA 2H9LA 1YFQA 3SN6B 3RMZD 5A2Qg 4D6VA 5EMJB 2EBSA 4QL1A 3IKOA 4AOWA 2AH1A 4GZ8A 2XU7A 3EI4B 2CN2A 4A08A 2B4EA 3P4FA 1SHYB 3IJ0A 3UKRC 4GQBB 4CI2A 2G99A 3FM0A 3I7PA 2GNQA 2Q7QA 3OW8A 2IWFA 1TBGA 5K1CC 3UKUC 4FWWA 4CZYA 1MG3A 4ESGA 1XHMA 4NSXA 4GMBA 3JROA 5I5JA 4BH6A 3MMYA 1TYQC 3SCYA 3RSEC 2W18A 4X63B 4E5ZA 3FGBA 1N6FA 1U2VC 2IUQA 1N6DA 1A0RB 4LG8A 3PSCB 3SBRA 2AGXA 4CZXA 4A0BB 3UVKA 2PM7B 2OK4A 3PVUB 3CFVA 4CC9A 1R5MA 5IGQA 2AQ5A 1N6EA 3SVWD 3MXXA 5EAPA 4CY3A 2YNNA 2J57G 3AL9A 3I7LA 3U4YA 2HKMA 3I7OA 4CY5A 2QXVA 2IUVA 5IGOA 4A7JA 3EI3B 3L4MD 5EALA 3PE7A 2CE8A 1RI6A 5GXIA 4MK0B 3J80g 4J81A 4N14A 2HKRA 3IIWA 2TRCB 2QC5A 3JPXA 3EI1A 2HJBA 4J79A 1SQ9A 5FXYA 2AH0A 2Z2NA 4QT8A 2I0SA 5CXBA 1SQJA 3AL8A 4O3TB 4J86A 3PXWD 2P9KC 5EM2B 4GM9A 4FA4D 3RFGA 5THAA 3N0DA 4JSPC 4GGDA 5FKRA 4J0WA 3DSMA 5K19A 3UVNA 2HYEA 5IC7A 2XYIA 4JSNC 3CIKB 4J73A 3W15A 2CNXA 4O3UB 3EI2A 2P9UC 4A08B 3EI2B 2PBIB 4J84A 4YVDA 3DXKC 4K3ID 3JZHA 4A09B 1PBYB 4A0AA 2HESX 1MDAH 3C99A 4CI1A 4A2LA 5GSAA 4R7AB 2IWKA 5IJ7E 3UVOA 3VGZA 4PBZA 4PC0A 4A09A 3I7HA 5I5MA 3PVWB 5FKTA 2YB8B 2J55H 2PM6B 1B9YA 3HFQA 2I3TA 3PXTD 4JSXC 2AGLA 5FLXg 3FRXA 2H68A 2O9KA 5HYNB 2CO0C 5EM2A 3MZLA 5HQGA 1PEVA 2Z2PA 4CY1A 5CXBB 2H9MA 3B7FA 3IIYA 4Z8LA 1PI6A 3I2NA 2B5MA 1B9XA 1GG2B 4ERQA 4FHLA 4U7AA 1ERJA 3BG1A 4LGNA 2HXCA 3I7NA 5IT9g 4PSWB 3OKTA 4BUJC 5EMKB 2G9AA 5HE2B 3BG0A 3AH8B 3F3GA 4HDJA 4JT5C 5FQDA 2H6NA 5AJAA 4L9OA 4PNKB 3K27A 3JZGA 3EI3A 3EWEA 2PM9A 3C75H 2BCJB 4GGCA 4Y7RA 3ORVD 3SJLD 1K32A 2H9NA 2HJ4A 4G56B 3EG6A 3SFZA 2GC4A 4J0XA 4QRJA 5HE1B 4U1EI 4XEIC 1U4CA 5GMKn 5GXHA 3F3FA 4H5JA 1L0QA 4E5ZB 2OK6A 4JXMA 3MZKA 5KDOB 4L1QD 3EI1B 4AEZA 4BL0A 2H14A 4O45A 2I0TA 3MKSB 5FKQA 2YNOA 4ZOYA 1PGUA 3I89A 4XYHA 1JOFA 4J87A 2XL2A 2H9PA 2H13A 4ZOVA 2IAAA 5IJ8E 4JSVC 4OWRA 4O1QD 2H3XA 2XL3A 4J78A 5TEFA 4J77A 3V5WB 2OJYA 3AL8B 4H5IA 4FA9D 2CE9A 4GQ1A 4ERZA 1Q47A 4GGAA 5CXCA 3SWSD 5CYKB 2P9IC 3PXSD 4ZN4A 4IA9A 2I0RA 3JZNA 5C2WB 3OKWA 5I5IA 2AGYA 1VYHC 2GC7A 2P9SC 3F3PA 5AFU3 5TF2A 3RN1D 3RFHA 1GOTB 2OIZA 2IUPA 1QNIA 4A0AB 1FWXA 2YNPA 3IJCA 3JB9L 4FA1D 3SXTD 4L3HD 4IMMA 3SBPA 4X3EA 3AFCA 4UI9R 3KRWB
chains in the Genus database with same CATH superfamily
3I7KA 2PM9B 4PXWA 3I8CA 3JAMg 1VZ2A 2EICA 4Y5RD 5M61A 3NVXA 5EARA 5B4WA 4JHPC 4WK4A 5EAMA 3GFCA 4BCDA 1OMWB 4ERYA 2OVRB 3N0EA 5HE0B 3J81g 3V7DB 1H2WA 5EMLB 3EI4A 3SHFA 4E54B 2B5NA 4DNWA 3ZWLB 5H1MA 1K8KC 3BWSA 1JMZB 1JJUB 1NEXB 2XDWA 3OTTA 3OL2B 3MKQA 3DM0A 3IVMA 3SMRA 4A0BA 1U8CA 3NVQA 5M5VA 3ZE0A 2CO0A 5SXMA 2YBAA 4QAMA 1OLZA 2UZXB 5H17A 2OVQB 5C9ZB 1UTCA 2QR5A 1GOGA 1I2MB 1O6FA 1GOFA 3MUOA 3NVNA 2VDNA 4A11B 3EMHA 5CXCB 2OVPB 5E6UA 1YR2A 5E6RA 3EU7A 2P9LC 3GREA 3IUQA 5HDBA 3C5MA 3OKYB 5M5SA 4X60B 1P22A 3RLMD 4IRZA 3SLED 5EMMB 5FA5B 1UOOA 5TEEA 3CFSB 4LG9A 1C9LA 3A0FA 4D0KA 2YMUA 4CY2A 2AGWA 4PBYA 2IURA 1S4UX 3RRMC 3IJEA 2AGZA 4ZOXA 4ES0A 3UVLA 5HE3B 2HU5A 4E54A 4GM8A 4CI3A 1C9IA 4UM9A 1TYEA 4EWRA 4FAVD 3O4HA 3OL2A 3V9FA 2I3SA 2J56H 2MTAH 5C92A 2Z2OA 4K3JB 4KFMB 1GXRA 5JWZA 3L4OD 1BPOA 1MG2A 5TDHB 3K26A 4I79A 2B5LA 1NR0A 5FFGA 4CI8A 4GM3A 2UZYB 3I8EA 4JT6C 4OZUA 4L3GD 2VZ1A 3JRPA 3C9CA 1E8NA 3UR4A 4TZ4A 3FCUA 4GQ2P 5CYKA 5C2VB 3KRXB 4MMZA 2VDLA 2BKLA 4FB1D 2P9NC 4QQEA 4CZVA 1XIPA 4AMYA 4A2MA 3RN0D 3MVDK 4ZOZA 4NBMA 1VZ3A 1XKSA 2H47A 4PSXB 2EIDA 3SBQA 4FAND 2VDOA 3E0CA 5FKSA 3ZDYA 2CN3A 3IJ1A 3OKYA 1GP2B 4XYIA 2P9PC 3NIDA 3DWLC 5AMSA 4MMXA 5H14A 1JV2A 2BBKH 3ULEC 3UVMA 3DXMC 3PSLA 2H6KA 4X61B 4FA5D 4BCBA 3ODTA 4A11A 3IUMA 4J8BA 1JMXB 4O9DA 3VH0A 2EIEA 4J82A 3VA6A 4JD2C 4O2WA 4J8GA 2H6QA 2H9LA 1YFQA 3SN6B 3RMZD 5A2Qg 4AN0A 4D6VA 5EMJB 2EBSA 4Z7OA 4QL1A 3IKOA 4AOWA 3IURA 2AH1A 4GZ8A 3T3PA 2XU7A 3EI4B 2CN2A 4DNUA 4A08A 2B4EA 3P4FA 1SHYB 3IJ0A 3FCSA 3UKRC 3O4GA 4GQBB 4CI2A 2G99A 3FM0A 3I7PA 2GNQA 2Q7QA 3OW8A 2IWFA 1TBGA 5K1CC 3UKUC 4FWWA 1UOQA 4CZYA 1MG3A 4ESGA 1XHMA 4NSXA 4GMBA 3JROA 5I5JA 4BH6A 3MMYA 1TYQC 3SCYA 3RSEC 2W18A 4X63B 4E5ZA 3IULA 3FGBA 1N6FA 1U2VC 2IUQA 4AX4A 1N6DA 3MUNA 1UOPA 1A0RB 3EQ9A 4LG8A 3PSCB 3SBRA 4DNVA 2AGXA 4CZXA 4Z7QA 4A0BB 3K71A 3UVKA 2PM7B 2OK4A 3PVUB 3CFVA 4G1MA 4CC9A 1R5MA 5IGQA 2AQ5A 1N6EA 3SVWD 3MXXA 5EAPA 4CY3A 2VZ3A 2YNNA 2J57G 3KCIA 3IUNA 3AL9A 3I7LA 3U4YA 2HKMA 3K72A 3I7OA 3V4VA 3V4PA 3ZE1A 4CY5A 2VDQA 3DDUA 2QXVA 2IUVA 5IGOA 4A7JA 3EI3B 1M1XA 3L4MD 5EALA 3PE7A 3K6SA 2CE8A 1RI6A 5GXIA 4MK0B 3J80g 5M5UA 4J81A 4N14A 1H2YA 2HKRA 3IIWA 2TRCB 2QC5A 3JPXA 3EI1A 2HJBA 4J79A 1SQ9A 5FXYA 4D9SA 2AH0A 2Z2NA 4QT8A 2I0SA 5CXBA 1SQJA 3AL8A 4O3TB 3EQ7A 4J86A 3ZE2A 3PXWD 2P9KC 4BP8A 5EM2B 4GM9A 4FA4D 3RFGA 3NIGA 5THAA 3N0DA 4JSPC 4GGDA 4MMYA 1QFSA 4J0WA 5FKRA 3VI4A 3DSMA 5K19A 3UVNA 2HYEA 5IC7A 2XYIA 4JSNC 3CIKB 4J73A 3W15A 2CNXA 4O3UB 3EI2A 2P9UC 4A08B 3EI2B 2PBIB 4Z7NA 4J84A 4YVDA 5E6SA 3DXKC 5C86A 3GC3B 4K3ID 3JZHA 4A09B 1PBYB 4A0AA 2HESX 1K3IA 1MDAH 3C99A 4CI1A 5M5RA 4A2LA 5GSAA 4R7AB 1O6GA 2IWKA 5IJ7E 3UVOA 3VGZA 4PBZA 4PC0A 4A09A 3I7HA 4WJKA 3EQ8A 2VDRA 3PVWB 5I5MA 4L1MA 5FKTA 2YB8B 2J55H 2PM6B 1B9YA 2HU8A 3HFQA 2I3TA 3PXTD 4JSXC 4NC4A 2AGLA 5FLXg 3FRXA 2H68A 2O9KA 5HYNB 2CO0C 5EM2A 3MZLA 5HQGA 1PEVA 2Z2PA 4CY1A 1QFMA 2H9MA 3B7FA 5CXBB 3IIYA 4Z8LA 1PI6A 4UM8A 3O4JA 1VE6A 1H2ZA 3I2NA 2B5MA 1B9XA 1GG2B 3T3MA 1A12A 4ERQA 4FHLA 4U7AA 3NIFA 3ZDXA 1ERJA 3BG1A 3O4IA 4G55A 2HXCA 4LGNA 3I7NA 5IT9g 4PSWB 3OKTA 2VDKA 4RE5A 4BUJC 5EMKB 1L5GA 2G9AA 2JKXA 5HE2B 5M5TA 3BG0A 3AH8B 3F3GA 4HDJA 3IUJA 4JT5C 5FQDA 2H6NA 5AJAA 4L9OA 4PNKB 3K27A 4G1EA 1JTDB 3JZGA 4RE6A 4AMZA 3EI3A 4WK2A 3EWEA 2PM9A 3C75H 2BCJB 2EIBA 4GGCA 4Y7RA 3ORVD 3SJLD 1K32A 2H9NA 4BP9A 2HJ4A 4G56B 3EG6A 3SFZA 2XE4A 2GC4A 4J0XA 1E5TA 4QRJA 5HE1B 1E8MA 4U1EI 4XEIC 1U4CA 5GMKn 5GXHA 3QHYB 3F3FA 4H5JA 1L0QA 2VDPA 4E5ZB 2OK6A 4NAAA 4JXMA 2WQ8A 3QI0A 3MZKA 5KDOB 4L1QD 3EI1B 4NENA 4AEZA 4BL0A 2H14A 4O45A 2I0TA 3MKSB 4O02A 5FKQA 2YNOA 4ZOYA 1PGUA 3I89A 5FFOA 4XYHA 1JOFA 4J87A 2XL2A 2H9PA 2H13A 2VDMA 3VI3A 4ZOVA 2HU7A 2IAAA 2VC2A 5IJ8E 4JSVC 4OWRA 4O1QD 2H3XA 2XL3A 4J78A 1VE7A 5TEFA 4J77A 3V5WB 2OJYA 3AL8B 4H5IA 4FA9D 4WK0A 1H2XA 2CE9A 4AN1A 4GQ1A 4ERZA 1Q47A 4GGAA 5CXCA 3SWSD 5CYKB 3OF7A 2P9IC 3PXSD 4ZN4A 4IA9A 2I0RA 3JZNA 4BCCA 1GOHA 5C2WB 3GD1I 3ZDZA 3OKWA 5I5IA 2AGYA 1VYHC 2GC7A 2P9SC 3F3PA 5AFU3 5TF2A 3RN1D 3RFHA 1GOTB 2OIZA 2IUPA 1QNIA 4A0AB 1FWXA 2XZGA 1T2XA 2YNPA 4JHNA 3IJCA 3JB9L 4FA1D 3SXTD 4L3HD 4IMMA 3SBPA 4X3EA 3AFCA 2QZPA 4UI9R 3KRWB
chains in the Genus database with same CATH topology
3I7KA 2PM9B 4PXWA 3I8CA 3JAMg 4Y5RD 3NVXA 5EARA 5B4WA 5EAMA 3GFCA 1OMWB 4ERYA 2OVRB 3N0EA 5HE0B 3J81g 3V7DB 5EMLB 3EI4A 3SHFA 4E54B 2B5NA 3ZWLB 5H1MA 1K8KC 3BWSA 1JMZB 1JJUB 1NEXB 3OTTA 3OL2B 3MKQA 3DM0A 3SMRA 4A0BA 3NVQA 2CO0A 5SXMA 2YBAA 1OLZA 2UZXB 5H17A 2OVQB 5C9ZB 3NVNA 4A11B 3EMHA 5CXCB 2OVPB 3EU7A 2P9LC 3GREA 3C5MA 3OKYB 4X60B 1P22A 3RLMD 3SLED 5EMMB 5FA5B 5TEEA 3CFSB 4LG9A 3A0FA 4D0KA 2YMUA 4CY2A 2AGWA 4PBYA 2IURA 1S4UX 3RRMC 2AGZA 4ZOXA 4ES0A 3UVLA 5HE3B 4E54A 4GM8A 4CI3A 4EWRA 4FAVD 3OL2A 3V9FA 2I3SA 2J56H 2MTAH 2Z2OA 4K3JB 4KFMB 1GXRA 5JWZA 3L4OD 1MG2A 5TDHB 4I79A 3K26A 2B5LA 1NR0A 4CI8A 4GM3A 2UZYB 3I8EA 4JT6C 4OZUA 4L3GD 3JRPA 3C9CA 3UR4A 4TZ4A 4GQ2P 5CYKA 5C2VB 3KRXB 4FB1D 2P9NC 4QQEA 4CZVA 1XIPA 4A2MA 3RN0D 4ZOZA 3SBQA 1XKSA 2H47A 4PSXB 4FAND 3E0CA 5FKSA 2CN3A 3IJ1A 3OKYA 1GP2B 4XYIA 2P9PC 3DWLC 5AMSA 5H14A 2BBKH 3ULEC 3UVMA 3DXMC 3PSLA 2H6KA 4X61B 4FA5D 3ODTA 4A11A 4J8BA 1JMXB 4O9DA 3VH0A 4J82A 3VA6A 4JD2C 4J8GA 2H6QA 2H9LA 1YFQA 3SN6B 3RMZD 5A2Qg 4D6VA 5EMJB 2EBSA 4QL1A 3IKOA 4AOWA 2AH1A 4GZ8A 2XU7A 3EI4B 2CN2A 4A08A 2B4EA 3P4FA 1SHYB 3IJ0A 3UKRC 4GQBB 4CI2A 2G99A 3FM0A 3I7PA 2GNQA 2Q7QA 3OW8A 2IWFA 1TBGA 5K1CC 3UKUC 4FWWA 4CZYA 1MG3A 4ESGA 1XHMA 4NSXA 4GMBA 3JROA 5I5JA 4BH6A 3MMYA 1TYQC 3SCYA 3RSEC 2W18A 4X63B 4E5ZA 3FGBA 1N6FA 1U2VC 2IUQA 1N6DA 1A0RB 4LG8A 3PSCB 3SBRA 2AGXA 4CZXA 4A0BB 3UVKA 2PM7B 2OK4A 3PVUB 3CFVA 4CC9A 1R5MA 5IGQA 2AQ5A 1N6EA 3SVWD 3MXXA 5EAPA 4CY3A 2YNNA 2J57G 3AL9A 3I7LA 3U4YA 2HKMA 3I7OA 4CY5A 2QXVA 2IUVA 5IGOA 4A7JA 3EI3B 3L4MD 5EALA 3PE7A 2CE8A 1RI6A 5GXIA 4MK0B 3J80g 4J81A 4N14A 2HKRA 3IIWA 2TRCB 2QC5A 3JPXA 3EI1A 2HJBA 4J79A 1SQ9A 5FXYA 2AH0A 2Z2NA 4QT8A 2I0SA 5CXBA 1SQJA 3AL8A 4O3TB 4J86A 3PXWD 2P9KC 5EM2B 4GM9A 4FA4D 3RFGA 5THAA 3N0DA 4JSPC 4GGDA 5FKRA 4J0WA 3DSMA 5K19A 3UVNA 2HYEA 5IC7A 2XYIA 4JSNC 3CIKB 4J73A 3W15A 2CNXA 4O3UB 3EI2A 2P9UC 4A08B 3EI2B 2PBIB 4J84A 4YVDA 3DXKC 4K3ID 3JZHA 4A09B 1PBYB 4A0AA 2HESX 1MDAH 3C99A 4CI1A 4A2LA 5GSAA 4R7AB 2IWKA 5IJ7E 3UVOA 3VGZA 4PBZA 4PC0A 4A09A 3I7HA 5I5MA 3PVWB 5FKTA 2YB8B 2J55H 2PM6B 1B9YA 3HFQA 2I3TA 3PXTD 4JSXC 2AGLA 5FLXg 3FRXA 2H68A 2O9KA 5HYNB 2CO0C 5EM2A 3MZLA 5HQGA 1PEVA 2Z2PA 4CY1A 5CXBB 2H9MA 3B7FA 3IIYA 4Z8LA 1PI6A 3I2NA 2B5MA 1B9XA 1GG2B 4ERQA 4FHLA 4U7AA 1ERJA 3BG1A 4LGNA 2HXCA 3I7NA 5IT9g 4PSWB 3OKTA 4BUJC 5EMKB 2G9AA 5HE2B 3BG0A 3AH8B 3F3GA 4HDJA 4JT5C 5FQDA 2H6NA 5AJAA 4L9OA 4PNKB 3K27A 3JZGA 3EI3A 3EWEA 2PM9A 3C75H 2BCJB 4GGCA 4Y7RA 3ORVD 3SJLD 1K32A 2H9NA 2HJ4A 4G56B 3EG6A 3SFZA 2GC4A 4J0XA 4QRJA 5HE1B 4U1EI 4XEIC 1U4CA 5GMKn 5GXHA 3F3FA 4H5JA 1L0QA 4E5ZB 2OK6A 4JXMA 3MZKA 5KDOB 4L1QD 3EI1B 4AEZA 4BL0A 2H14A 4O45A 2I0TA 3MKSB 5FKQA 2YNOA 4ZOYA 1PGUA 3I89A 4XYHA 1JOFA 4J87A 2XL2A 2H9PA 2H13A 4ZOVA 2IAAA 5IJ8E 4JSVC 4OWRA 4O1QD 2H3XA 2XL3A 4J78A 5TEFA 4J77A 3V5WB 2OJYA 3AL8B 4H5IA 4FA9D 2CE9A 4GQ1A 4ERZA 1Q47A 4GGAA 5CXCA 3SWSD 5CYKB 2P9IC 3PXSD 4ZN4A 4IA9A 2I0RA 3JZNA 5C2WB 3OKWA 5I5IA 2AGYA 1VYHC 2GC7A 2P9SC 3F3PA 5AFU3 5TF2A 3RN1D 3RFHA 1GOTB 2OIZA 2IUPA 1QNIA 4A0AB 1FWXA 2YNPA 3IJCA 3JB9L 4FA1D 3SXTD 4L3HD 4IMMA 3SBPA 4X3EA 3AFCA 4UI9R 3KRWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7K A;  2PM9 B;  4PXW A;  3I8C A;  3JAM g;  4Y5R D;  3NVX A;  5EAR A;  5B4W A;  5EAM A;  3GFC A;  1OMW B;  4ERY A;  2OVR B;  3N0E A;  5HE0 B;  3J81 g;  3V7D B;  5EML B;  3EI4 A;  3SHF A;  4E54 B;  2B5N A;  3ZWL B;  5H1M A;  1K8K C;  3BWS A;  1JMZ B;  1JJU B;  1NEX B;  3OTT A;  3OL2 B;  3MKQ A;  3DM0 A;  3SMR A;  4A0B A;  3NVQ A;  2CO0 A;  5SXM A;  2YBA A;  1OLZ A;  2UZX B;  5H17 A;  2OVQ B;  5C9Z B;  3NVN A;  4A11 B;  3EMH A;  5CXC B;  2OVP B;  3EU7 A;  2P9L C;  3GRE A;  3C5M A;  3OKY B;  4X60 B;  1P22 A;  3RLM D;  3SLE D;  5EMM B;  5FA5 B;  5TEE A;  3CFS B;  4LG9 A;  3A0F A;  4D0K A;  2YMU A;  4CY2 A;  2AGW A;  4PBY A;  2IUR A;  1S4U X;  3RRM C;  2AGZ A;  4ZOX A;  4ES0 A;  3UVL A;  5HE3 B;  4E54 A;  4GM8 A;  4CI3 A;  4EWR A;  4FAV D;  3OL2 A;  3V9F A;  2I3S A;  2J56 H;  2MTA H;  2Z2O A;  4K3J B;  4KFM B;  1GXR A;  5JWZ A;  3L4O D;  1MG2 A;  5TDH B;  4I79 A;  3K26 A;  2B5L A;  1NR0 A;  4CI8 A;  4GM3 A;  2UZY B;  3I8E A;  4JT6 C;  4OZU A;  4L3G D;  3JRP A;  3C9C A;  3UR4 A;  4TZ4 A;  4GQ2 P;  5CYK A;  5C2V B;  3KRX B;  4FB1 D;  2P9N C;  4QQE A;  4CZV A;  1XIP A;  4A2M A;  3RN0 D;  4ZOZ A;  3SBQ A;  1XKS A;  2H47 A;  4PSX B;  4FAN D;  3E0C A;  5FKS A;  2CN3 A;  3IJ1 A;  3OKY A;  1GP2 B;  4XYI A;  2P9P C;  3DWL C;  5AMS A;  5H14 A;  2BBK H;  3ULE C;  3UVM A;  3DXM C;  3PSL A;  2H6K A;  4X61 B;  4FA5 D;  3ODT A;  4A11 A;  4J8B A;  1JMX B;  4O9D A;  3VH0 A;  4J82 A;  3VA6 A;  4JD2 C;  4J8G A;  2H6Q A;  2H9L A;  1YFQ A;  3SN6 B;  3RMZ D;  5A2Q g;  4D6V A;  5EMJ B;  2EBS A;  4QL1 A;  3IKO A;  4AOW A;  2AH1 A;  4GZ8 A;  2XU7 A;  3EI4 B;  2CN2 A;  4A08 A;  2B4E A;  3P4F A;  1SHY B;  3IJ0 A;  3UKR C;  4GQB B;  4CI2 A;  2G99 A;  3FM0 A;  3I7P A;  2GNQ A;  2Q7Q A;  3OW8 A;  2IWF A;  1TBG A;  5K1C C;  3UKU C;  4FWW A;  4CZY A;  1MG3 A;  4ESG A;  1XHM A;  4NSX A;  4GMB A;  3JRO A;  5I5J A;  4BH6 A;  3MMY A;  1TYQ C;  3SCY A;  3RSE C;  2W18 A;  4X63 B;  4E5Z A;  3FGB A;  1N6F A;  1U2V C;  2IUQ A;  1N6D A;  1A0R B;  4LG8 A;  3PSC B;  3SBR A;  2AGX A;  4CZX A;  4A0B B;  3UVK A;  2PM7 B;  2OK4 A;  3PVU B;  3CFV A;  4CC9 A;  1R5M A;  5IGQ A;  2AQ5 A;  1N6E A;  3SVW D;  3MXX A;  5EAP A;  4CY3 A;  2YNN A;  2J57 G;  3AL9 A;  3I7L A;  3U4Y A;  2HKM A;  3I7O A;  4CY5 A;  2QXV A;  2IUV A;  5IGO A;  4A7J A;  3EI3 B;  3L4M D;  5EAL A;  3PE7 A;  2CE8 A;  1RI6 A;  5GXI A;  4MK0 B;  3J80 g;  4J81 A;  4N14 A;  2HKR A;  3IIW A;  2TRC B;  2QC5 A;  3JPX A;  3EI1 A;  2HJB A;  4J79 A;  1SQ9 A;  5FXY A;  2AH0 A;  2Z2N A;  4QT8 A;  2I0S A;  5CXB A;  1SQJ A;  3AL8 A;  4O3T B;  4J86 A;  3PXW D;  2P9K C;  5EM2 B;  4GM9 A;  4FA4 D;  3RFG A;  5THA A;  3N0D A;  4JSP C;  4GGD A;  5FKR A;  4J0W A;  3DSM A;  5K19 A;  3UVN A;  2HYE A;  5IC7 A;  2XYI A;  4JSN C;  3CIK B;  4J73 A;  3W15 A;  2CNX A;  4O3U B;  3EI2 A;  2P9U C;  4A08 B;  3EI2 B;  2PBI B;  4J84 A;  4YVD A;  3DXK C;  4K3I D;  3JZH A;  4A09 B;  1PBY B;  4A0A A;  2HES X;  1MDA H;  3C99 A;  4CI1 A;  4A2L A;  5GSA A;  4R7A B;  2IWK A;  5IJ7 E;  3UVO A;  3VGZ A;  4PBZ A;  4PC0 A;  4A09 A;  3I7H A;  5I5M A;  3PVW B;  5FKT A;  2YB8 B;  2J55 H;  2PM6 B;  1B9Y A;  3HFQ A;  2I3T A;  3PXT D;  4JSX C;  2AGL A;  5FLX g;  3FRX A;  2H68 A;  2O9K A;  5HYN B;  2CO0 C;  5EM2 A;  3MZL A;  5HQG A;  1PEV A;  2Z2P A;  4CY1 A;  5CXB B;  2H9M A;  3B7F A;  3IIY A;  4Z8L A;  1PI6 A;  3I2N A;  2B5M A;  1B9X A;  1GG2 B;  4ERQ A;  4FHL A;  4U7A A;  1ERJ A;  3BG1 A;  4LGN A;  2HXC A;  3I7N A;  5IT9 g;  4PSW B;  3OKT A;  4BUJ C;  5EMK B;  2G9A A;  5HE2 B;  3BG0 A;  3AH8 B;  3F3G A;  4HDJ A;  4JT5 C;  5FQD A;  2H6N A;  5AJA A;  4L9O A;  4PNK B;  3K27 A;  3JZG A;  3EI3 A;  3EWE A;  2PM9 A;  3C75 H;  2BCJ B;  4GGC A;  4Y7R A;  3ORV D;  3SJL D;  1K32 A;  2H9N A;  2HJ4 A;  4G56 B;  3EG6 A;  3SFZ A;  2GC4 A;  4J0X A;  4QRJ A;  5HE1 B;  4U1E I;  4XEI C;  1U4C A;  5GMK n;  5GXH A;  3F3F A;  4H5J A;  1L0Q A;  4E5Z B;  2OK6 A;  4JXM A;  3MZK A;  5KDO B;  4L1Q D;  3EI1 B;  4AEZ A;  4BL0 A;  2H14 A;  4O45 A;  2I0T A;  3MKS B;  5FKQ A;  2YNO A;  4ZOY A;  1PGU A;  3I89 A;  4XYH A;  1JOF A;  4J87 A;  2XL2 A;  2H9P A;  2H13 A;  4ZOV A;  2IAA A;  5IJ8 E;  4JSV C;  4OWR A;  4O1Q D;  2H3X A;  2XL3 A;  4J78 A;  5TEF A;  4J77 A;  3V5W B;  2OJY A;  3AL8 B;  4H5I A;  4FA9 D;  2CE9 A;  4GQ1 A;  4ERZ A;  1Q47 A;  4GGA A;  5CXC A;  3SWS D;  5CYK B;  2P9I C;  3PXS D;  4ZN4 A;  4IA9 A;  2I0R A;  3JZN A;  5C2W B;  3OKW A;  5I5I A;  2AGY A;  1VYH C;  2GC7 A;  2P9S C;  3F3P A;  5AFU 3;  5TF2 A;  3RN1 D;  3RFH A;  1GOT B;  2OIZ A;  2IUP A;  1QNI A;  4A0A B;  1FWX A;  2YNP A;  3IJC A;  3JB9 L;  4FA1 D;  3SXT D;  4L3H D;  4IMM A;  3SBP A;  4X3E A;  3AFC A;  4UI9 R;  3KRW B; 
#chains in the Genus database with same CATH topology
 3I7K A;  2PM9 B;  4PXW A;  3I8C A;  3JAM g;  1VZ2 A;  2EIC A;  4Y5R D;  5M61 A;  3NVX A;  5EAR A;  5B4W A;  4JHP C;  4WK4 A;  5EAM A;  3GFC A;  4BCD A;  1OMW B;  4ERY A;  2OVR B;  3N0E A;  5HE0 B;  3J81 g;  3V7D B;  1H2W A;  5EML B;  3EI4 A;  3SHF A;  4E54 B;  2B5N A;  4DNW A;  3ZWL B;  5H1M A;  1K8K C;  3BWS A;  1JMZ B;  1JJU B;  1NEX B;  2XDW A;  3OTT A;  3OL2 B;  3MKQ A;  3DM0 A;  3IVM A;  3SMR A;  4A0B A;  1U8C A;  3NVQ A;  5M5V A;  3ZE0 A;  2CO0 A;  5SXM A;  2YBA A;  4QAM A;  1OLZ A;  2UZX B;  5H17 A;  2OVQ B;  5C9Z B;  1UTC A;  2QR5 A;  1GOG A;  1I2M B;  1O6F A;  1GOF A;  3MUO A;  3NVN A;  2VDN A;  4A11 B;  3EMH A;  5CXC B;  2OVP B;  5E6U A;  1YR2 A;  5E6R A;  3EU7 A;  2P9L C;  3GRE A;  3IUQ A;  5HDB A;  3C5M A;  3OKY B;  5M5S A;  4X60 B;  1P22 A;  3RLM D;  4IRZ A;  3SLE D;  5EMM B;  5FA5 B;  1UOO A;  5TEE A;  3CFS B;  4LG9 A;  1C9L A;  3A0F A;  4D0K A;  2YMU A;  4CY2 A;  2AGW A;  4PBY A;  2IUR A;  1S4U X;  3RRM C;  3IJE A;  2AGZ A;  4ZOX A;  4ES0 A;  3UVL A;  5HE3 B;  2HU5 A;  4E54 A;  4GM8 A;  4CI3 A;  1C9I A;  4UM9 A;  1TYE A;  4EWR A;  4FAV D;  3O4H A;  3OL2 A;  3V9F A;  2I3S A;  2J56 H;  2MTA H;  5C92 A;  2Z2O A;  4K3J B;  4KFM B;  1GXR A;  5JWZ A;  3L4O D;  1BPO A;  1MG2 A;  5TDH B;  3K26 A;  4I79 A;  2B5L A;  1NR0 A;  5FFG A;  4CI8 A;  4GM3 A;  2UZY B;  3I8E A;  4JT6 C;  4OZU A;  4L3G D;  2VZ1 A;  3JRP A;  3C9C A;  1E8N A;  3UR4 A;  4TZ4 A;  3FCU A;  4GQ2 P;  5CYK A;  5C2V B;  3KRX B;  4MMZ A;  2VDL A;  2BKL A;  4FB1 D;  2P9N C;  4QQE A;  4CZV A;  1XIP A;  4AMY A;  4A2M A;  3RN0 D;  3MVD K;  4ZOZ A;  4NBM A;  1VZ3 A;  1XKS A;  2H47 A;  4PSX B;  2EID A;  3SBQ A;  4FAN D;  2VDO A;  3E0C A;  5FKS A;  3ZDY A;  2CN3 A;  3IJ1 A;  3OKY A;  1GP2 B;  4XYI A;  2P9P C;  3NID A;  3DWL C;  5AMS A;  4MMX A;  5H14 A;  1JV2 A;  2BBK H;  3ULE C;  3UVM A;  3DXM C;  3PSL A;  2H6K A;  4X61 B;  4FA5 D;  4BCB A;  3ODT A;  4A11 A;  3IUM A;  4J8B A;  1JMX B;  4O9D A;  3VH0 A;  2EIE A;  4J82 A;  3VA6 A;  4JD2 C;  4O2W A;  4J8G A;  2H6Q A;  2H9L A;  1YFQ A;  3SN6 B;  3RMZ D;  5A2Q g;  4AN0 A;  4D6V A;  5EMJ B;  2EBS A;  4Z7O A;  4QL1 A;  3IKO A;  4AOW A;  3IUR A;  2AH1 A;  4GZ8 A;  3T3P A;  2XU7 A;  3EI4 B;  2CN2 A;  4DNU A;  4A08 A;  2B4E A;  3P4F A;  1SHY B;  3IJ0 A;  3FCS A;  3UKR C;  3O4G A;  4GQB B;  4CI2 A;  2G99 A;  3FM0 A;  3I7P A;  2GNQ A;  2Q7Q A;  3OW8 A;  2IWF A;  1TBG A;  5K1C C;  3UKU C;  4FWW A;  1UOQ A;  4CZY A;  1MG3 A;  4ESG A;  1XHM A;  4NSX A;  4GMB A;  3JRO A;  5I5J A;  4BH6 A;  3MMY A;  1TYQ C;  3SCY A;  3RSE C;  2W18 A;  4X63 B;  4E5Z A;  3IUL A;  3FGB A;  1N6F A;  1U2V C;  2IUQ A;  4AX4 A;  1N6D A;  3MUN A;  1UOP A;  1A0R B;  3EQ9 A;  4LG8 A;  3PSC B;  3SBR A;  4DNV A;  2AGX A;  4CZX A;  4Z7Q A;  4A0B B;  3K71 A;  3UVK A;  2PM7 B;  2OK4 A;  3PVU B;  3CFV A;  4G1M A;  4CC9 A;  1R5M A;  5IGQ A;  2AQ5 A;  1N6E A;  3SVW D;  3MXX A;  5EAP A;  4CY3 A;  2VZ3 A;  2YNN A;  2J57 G;  3KCI A;  3IUN A;  3AL9 A;  3I7L A;  3U4Y A;  2HKM A;  3K72 A;  3I7O A;  3V4V A;  3V4P A;  3ZE1 A;  4CY5 A;  2VDQ A;  3DDU A;  2QXV A;  2IUV A;  5IGO A;  4A7J A;  3EI3 B;  1M1X A;  3L4M D;  5EAL A;  3PE7 A;  3K6S A;  2CE8 A;  1RI6 A;  5GXI A;  4MK0 B;  3J80 g;  5M5U A;  4J81 A;  4N14 A;  1H2Y A;  2HKR A;  3IIW A;  2TRC B;  2QC5 A;  3JPX A;  3EI1 A;  2HJB A;  4J79 A;  1SQ9 A;  5FXY A;  4D9S A;  2AH0 A;  2Z2N A;  4QT8 A;  2I0S A;  5CXB A;  1SQJ A;  3AL8 A;  4O3T B;  3EQ7 A;  4J86 A;  3ZE2 A;  3PXW D;  2P9K C;  4BP8 A;  5EM2 B;  4GM9 A;  4FA4 D;  3RFG A;  3NIG A;  5THA A;  3N0D A;  4JSP C;  4GGD A;  4MMY A;  1QFS A;  4J0W A;  5FKR A;  3VI4 A;  3DSM A;  5K19 A;  3UVN A;  2HYE A;  5IC7 A;  2XYI A;  4JSN C;  3CIK B;  4J73 A;  3W15 A;  2CNX A;  4O3U B;  3EI2 A;  2P9U C;  4A08 B;  3EI2 B;  2PBI B;  4Z7N A;  4J84 A;  4YVD A;  5E6S A;  3DXK C;  5C86 A;  3GC3 B;  4K3I D;  3JZH A;  4A09 B;  1PBY B;  4A0A A;  2HES X;  1K3I A;  1MDA H;  3C99 A;  4CI1 A;  5M5R A;  4A2L A;  5GSA A;  4R7A B;  1O6G A;  2IWK A;  5IJ7 E;  3UVO A;  3VGZ A;  4PBZ A;  4PC0 A;  4A09 A;  3I7H A;  4WJK A;  3EQ8 A;  2VDR A;  3PVW B;  5I5M A;  4L1M A;  5FKT A;  2YB8 B;  2J55 H;  2PM6 B;  1B9Y A;  2HU8 A;  3HFQ A;  2I3T A;  3PXT D;  4JSX C;  4NC4 A;  2AGL A;  5FLX g;  3FRX A;  2H68 A;  2O9K A;  5HYN B;  2CO0 C;  5EM2 A;  3MZL A;  5HQG A;  1PEV A;  2Z2P A;  4CY1 A;  1QFM A;  2H9M A;  3B7F A;  5CXB B;  3IIY A;  4Z8L A;  1PI6 A;  4UM8 A;  3O4J A;  1VE6 A;  1H2Z A;  3I2N A;  2B5M A;  1B9X A;  1GG2 B;  3T3M A;  1A12 A;  4ERQ A;  4FHL A;  4U7A A;  3NIF A;  3ZDX A;  1ERJ A;  3BG1 A;  3O4I A;  4G55 A;  2HXC A;  4LGN A;  3I7N A;  5IT9 g;  4PSW B;  3OKT A;  2VDK A;  4RE5 A;  4BUJ C;  5EMK B;  1L5G A;  2G9A A;  2JKX A;  5HE2 B;  5M5T A;  3BG0 A;  3AH8 B;  3F3G A;  4HDJ A;  3IUJ A;  4JT5 C;  5FQD A;  2H6N A;  5AJA A;  4L9O A;  4PNK B;  3K27 A;  4G1E A;  1JTD B;  3JZG A;  4RE6 A;  4AMZ A;  3EI3 A;  4WK2 A;  3EWE A;  2PM9 A;  3C75 H;  2BCJ B;  2EIB A;  4GGC A;  4Y7R A;  3ORV D;  3SJL D;  1K32 A;  2H9N A;  4BP9 A;  2HJ4 A;  4G56 B;  3EG6 A;  3SFZ A;  2XE4 A;  2GC4 A;  4J0X A;  1E5T A;  4QRJ A;  5HE1 B;  1E8M A;  4U1E I;  4XEI C;  1U4C A;  5GMK n;  5GXH A;  3QHY B;  3F3F A;  4H5J A;  1L0Q A;  2VDP A;  4E5Z B;  2OK6 A;  4NAA A;  4JXM A;  2WQ8 A;  3QI0 A;  3MZK A;  5KDO B;  4L1Q D;  3EI1 B;  4NEN A;  4AEZ A;  4BL0 A;  2H14 A;  4O45 A;  2I0T A;  3MKS B;  4O02 A;  5FKQ A;  2YNO A;  4ZOY A;  1PGU A;  3I89 A;  5FFO A;  4XYH A;  1JOF A;  4J87 A;  2XL2 A;  2H9P A;  2H13 A;  2VDM A;  3VI3 A;  4ZOV A;  2HU7 A;  2IAA A;  2VC2 A;  5IJ8 E;  4JSV C;  4OWR A;  4O1Q D;  2H3X A;  2XL3 A;  4J78 A;  1VE7 A;  5TEF A;  4J77 A;  3V5W B;  2OJY A;  3AL8 B;  4H5I A;  4FA9 D;  4WK0 A;  1H2X A;  2CE9 A;  4AN1 A;  4GQ1 A;  4ERZ A;  1Q47 A;  4GGA A;  5CXC A;  3SWS D;  5CYK B;  3OF7 A;  2P9I C;  3PXS D;  4ZN4 A;  4IA9 A;  2I0R A;  3JZN A;  4BCC A;  1GOH A;  5C2W B;  3GD1 I;  3ZDZ A;  3OKW A;  5I5I A;  2AGY A;  1VYH C;  2GC7 A;  2P9S C;  3F3P A;  5AFU 3;  5TF2 A;  3RN1 D;  3RFH A;  1GOT B;  2OIZ A;  2IUP A;  1QNI A;  4A0A B;  1FWX A;  2XZG A;  1T2X A;  2YNP A;  4JHN A;  3IJC A;  3JB9 L;  4FA1 D;  3SXT D;  4L3H D;  4IMM A;  3SBP A;  4X3E A;  3AFC A;  2QZP A;  4UI9 R;  3KRW B; 
#chains in the Genus database with same CATH homology
 3I7K A;  2PM9 B;  4PXW A;  3I8C A;  3JAM g;  4Y5R D;  3NVX A;  5EAR A;  5B4W A;  5EAM A;  3GFC A;  1OMW B;  4ERY A;  2OVR B;  3N0E A;  5HE0 B;  3J81 g;  3V7D B;  5EML B;  3EI4 A;  3SHF A;  4E54 B;  2B5N A;  3ZWL B;  5H1M A;  1K8K C;  3BWS A;  1JMZ B;  1JJU B;  1NEX B;  3OTT A;  3OL2 B;  3MKQ A;  3DM0 A;  3SMR A;  4A0B A;  3NVQ A;  2CO0 A;  5SXM A;  2YBA A;  1OLZ A;  2UZX B;  5H17 A;  2OVQ B;  5C9Z B;  3NVN A;  4A11 B;  3EMH A;  5CXC B;  2OVP B;  3EU7 A;  2P9L C;  3GRE A;  3C5M A;  3OKY B;  4X60 B;  1P22 A;  3RLM D;  3SLE D;  5EMM B;  5FA5 B;  5TEE A;  3CFS B;  4LG9 A;  3A0F A;  4D0K A;  2YMU A;  4CY2 A;  2AGW A;  4PBY A;  2IUR A;  1S4U X;  3RRM C;  2AGZ A;  4ZOX A;  4ES0 A;  3UVL A;  5HE3 B;  4E54 A;  4GM8 A;  4CI3 A;  4EWR A;  4FAV D;  3OL2 A;  3V9F A;  2I3S A;  2J56 H;  2MTA H;  2Z2O A;  4K3J B;  4KFM B;  1GXR A;  5JWZ A;  3L4O D;  1MG2 A;  5TDH B;  4I79 A;  3K26 A;  2B5L A;  1NR0 A;  4CI8 A;  4GM3 A;  2UZY B;  3I8E A;  4JT6 C;  4OZU A;  4L3G D;  3JRP A;  3C9C A;  3UR4 A;  4TZ4 A;  4GQ2 P;  5CYK A;  5C2V B;  3KRX B;  4FB1 D;  2P9N C;  4QQE A;  4CZV A;  1XIP A;  4A2M A;  3RN0 D;  4ZOZ A;  3SBQ A;  1XKS A;  2H47 A;  4PSX B;  4FAN D;  3E0C A;  5FKS A;  2CN3 A;  3IJ1 A;  3OKY A;  1GP2 B;  4XYI A;  2P9P C;  3DWL C;  5AMS A;  5H14 A;  2BBK H;  3ULE C;  3UVM A;  3DXM C;  3PSL A;  2H6K A;  4X61 B;  4FA5 D;  3ODT A;  4A11 A;  4J8B A;  1JMX B;  4O9D A;  3VH0 A;  4J82 A;  3VA6 A;  4JD2 C;  4J8G A;  2H6Q A;  2H9L A;  1YFQ A;  3SN6 B;  3RMZ D;  5A2Q g;  4D6V A;  5EMJ B;  2EBS A;  4QL1 A;  3IKO A;  4AOW A;  2AH1 A;  4GZ8 A;  2XU7 A;  3EI4 B;  2CN2 A;  4A08 A;  2B4E A;  3P4F A;  1SHY B;  3IJ0 A;  3UKR C;  4GQB B;  4CI2 A;  2G99 A;  3FM0 A;  3I7P A;  2GNQ A;  2Q7Q A;  3OW8 A;  2IWF A;  1TBG A;  5K1C C;  3UKU C;  4FWW A;  4CZY A;  1MG3 A;  4ESG A;  1XHM A;  4NSX A;  4GMB A;  3JRO A;  5I5J A;  4BH6 A;  3MMY A;  1TYQ C;  3SCY A;  3RSE C;  2W18 A;  4X63 B;  4E5Z A;  3FGB A;  1N6F A;  1U2V C;  2IUQ A;  1N6D A;  1A0R B;  4LG8 A;  3PSC B;  3SBR A;  2AGX A;  4CZX A;  4A0B B;  3UVK A;  2PM7 B;  2OK4 A;  3PVU B;  3CFV A;  4CC9 A;  1R5M A;  5IGQ A;  2AQ5 A;  1N6E A;  3SVW D;  3MXX A;  5EAP A;  4CY3 A;  2YNN A;  2J57 G;  3AL9 A;  3I7L A;  3U4Y A;  2HKM A;  3I7O A;  4CY5 A;  2QXV A;  2IUV A;  5IGO A;  4A7J A;  3EI3 B;  3L4M D;  5EAL A;  3PE7 A;  2CE8 A;  1RI6 A;  5GXI A;  4MK0 B;  3J80 g;  4J81 A;  4N14 A;  2HKR A;  3IIW A;  2TRC B;  2QC5 A;  3JPX A;  3EI1 A;  2HJB A;  4J79 A;  1SQ9 A;  5FXY A;  2AH0 A;  2Z2N A;  4QT8 A;  2I0S A;  5CXB A;  1SQJ A;  3AL8 A;  4O3T B;  4J86 A;  3PXW D;  2P9K C;  5EM2 B;  4GM9 A;  4FA4 D;  3RFG A;  5THA A;  3N0D A;  4JSP C;  4GGD A;  5FKR A;  4J0W A;  3DSM A;  5K19 A;  3UVN A;  2HYE A;  5IC7 A;  2XYI A;  4JSN C;  3CIK B;  4J73 A;  3W15 A;  2CNX A;  4O3U B;  3EI2 A;  2P9U C;  4A08 B;  3EI2 B;  2PBI B;  4J84 A;  4YVD A;  3DXK C;  4K3I D;  3JZH A;  4A09 B;  1PBY B;  4A0A A;  2HES X;  1MDA H;  3C99 A;  4CI1 A;  4A2L A;  5GSA A;  4R7A B;  2IWK A;  5IJ7 E;  3UVO A;  3VGZ A;  4PBZ A;  4PC0 A;  4A09 A;  3I7H A;  5I5M A;  3PVW B;  5FKT A;  2YB8 B;  2J55 H;  2PM6 B;  1B9Y A;  3HFQ A;  2I3T A;  3PXT D;  4JSX C;  2AGL A;  5FLX g;  3FRX A;  2H68 A;  2O9K A;  5HYN B;  2CO0 C;  5EM2 A;  3MZL A;  5HQG A;  1PEV A;  2Z2P A;  4CY1 A;  5CXB B;  2H9M A;  3B7F A;  3IIY A;  4Z8L A;  1PI6 A;  3I2N A;  2B5M A;  1B9X A;  1GG2 B;  4ERQ A;  4FHL A;  4U7A A;  1ERJ A;  3BG1 A;  4LGN A;  2HXC A;  3I7N A;  5IT9 g;  4PSW B;  3OKT A;  4BUJ C;  5EMK B;  2G9A A;  5HE2 B;  3BG0 A;  3AH8 B;  3F3G A;  4HDJ A;  4JT5 C;  5FQD A;  2H6N A;  5AJA A;  4L9O A;  4PNK B;  3K27 A;  3JZG A;  3EI3 A;  3EWE A;  2PM9 A;  3C75 H;  2BCJ B;  4GGC A;  4Y7R A;  3ORV D;  3SJL D;  1K32 A;  2H9N A;  2HJ4 A;  4G56 B;  3EG6 A;  3SFZ A;  2GC4 A;  4J0X A;  4QRJ A;  5HE1 B;  4U1E I;  4XEI C;  1U4C A;  5GMK n;  5GXH A;  3F3F A;  4H5J A;  1L0Q A;  4E5Z B;  2OK6 A;  4JXM A;  3MZK A;  5KDO B;  4L1Q D;  3EI1 B;  4AEZ A;  4BL0 A;  2H14 A;  4O45 A;  2I0T A;  3MKS B;  5FKQ A;  2YNO A;  4ZOY A;  1PGU A;  3I89 A;  4XYH A;  1JOF A;  4J87 A;  2XL2 A;  2H9P A;  2H13 A;  4ZOV A;  2IAA A;  5IJ8 E;  4JSV C;  4OWR A;  4O1Q D;  2H3X A;  2XL3 A;  4J78 A;  5TEF A;  4J77 A;  3V5W B;  2OJY A;  3AL8 B;  4H5I A;  4FA9 D;  2CE9 A;  4GQ1 A;  4ERZ A;  1Q47 A;  4GGA A;  5CXC A;  3SWS D;  5CYK B;  2P9I C;  3PXS D;  4ZN4 A;  4IA9 A;  2I0R A;  3JZN A;  5C2W B;  3OKW A;  5I5I A;  2AGY A;  1VYH C;  2GC7 A;  2P9S C;  3F3P A;  5AFU 3;  5TF2 A;  3RN1 D;  3RFH A;  1GOT B;  2OIZ A;  2IUP A;  1QNI A;  4A0A B;  1FWX A;  2YNP A;  3IJC A;  3JB9 L;  4FA1 D;  3SXT D;  4L3H D;  4IMM A;  3SBP A;  4X3E A;  3AFC A;  4UI9 R;  3KRW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...