4J8BA

Crystal structure of alpha-cop/emp47p complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
327
structure length
298
Chain Sequence
MAMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIAFHPTQPIFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRADAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRANDRFWFITVHPKLNLFAAAHDSGVMVFKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords coatomer alpha subunit
total genus 75
structure length 298
sequence length 327
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j8bA00
2H9PA 3PVUB 3I8CA 4X3EA 3I89A 4Z8LA 2CN2A 2OJYA 4PNKB 3IIWA 1OMWB 3OL2A 3PXSD 5IC7A 3VH0A 2AQ5A 4J0XA 4IMMA 1U4CA 2P9KC 1TBGA 3BG1A 2B5MA 5AJAA 2IUPA 3B7FA 1K32A 5EMKB 3DSMA 5H1MA 5TEEA 2H9NA 4NSXA 3SJLD 3DWLC 3MKQA 1XHMA 2AGWA 1OLZA 4OWRA 3SBPA 1VYHC 2Z2PA 2Q7QA 3MZLA 1S4UX 1JMXB 4JT5C 3PE7A 5H17A 2UZXB 4FWWA 4FB1D 4O3TB 4CY1A 2HESX 3AL8B 1QNIA 5CYKB 3DXMC 2IUQA 4PBZA 4A0BB 2P9IC 3K26A 3L4OD 4L1QD 3SVWD 3SLED 3J81g 1MDAH 3SCYA 4FAND 5HYNB 3HFQA 3FRXA 3EI3B 3ZWLB 5C9ZB 3EI4A 3RN0D 3JZNA 4JD2C 3SBRA 4L3GD 3OKYA 3I2NA 4J82A 2AGXA 2H47A 3SWSD 1XIPA 3K27A 4J8GA 4CZVA 2I3SA 2HJBA 1YFQA 3NVXA 1JOFA 4MK0B 5HE0B 1PI6A 2CN3A 2OVPB 5EALA 4CI3A 4CY5A 2CO0C 4GM8A 4A0AA 2OIZA 5AMSA 1GOTB 2PBIB 5C2VB 4A09B 2P9LC 4U7AA 3ORVD 4J81A 5CXCB 5H14A 4E54A 4J86A 3EWEA 2H6QA 2PM6B 5A2Qg 2P9UC 3PSCB 3JZGA 5IJ8E 2AH0A 3C75H 4QL1A 2YNPA 2G99A 5KDOB 5K19A 3JROA 4GGDA 4Y7RA 1NEXB 2P9SC 4FA1D 4QT8A 2AH1A 5B4WA 5GXHA 4CI8A 2XL2A 1N6DA 2QXVA 2Z2NA 3N0EA 4J77A 5FQDA 3I8EA 5FA5B 2PM7B 3DM0A 2OK4A 5K1CC 2P9NC 1SQ9A 1R5MA 4D6VA 3EI3A 4PC0A 4X63B 3EI4B 5EMLB 2B5LA 3V9FA 4AOWA 3AFCA 3GFCA 2H6NA 3UVNA 4R7AB 4FA4D 2YNOA 3L4MD 3I7HA 4QQEA 4J0WA 4EWRA 2Z2OA 2XU7A 3V7DB 4CZYA 3W15A 2XL3A 3PXWD 1B9YA 4GQBB 4J78A 4J79A 2MTAH 3BG0A 3RLMD 5CYKA 5SXMA 4LG9A 3RFGA 1MG3A 3J80g 1JMZB 3N0DA 1Q47A 4A09A 1SHYB 4JXMA 2H9LA 4XYHA 4E54B 1RI6A 3EMHA 5FLXg 2OVRB 4ZOZA 2IURA 3I7LA 3SXTD 3KRWB 4O45A 3SFZA 2IWFA 5FKRA 3EI1A 4TZ4A 4FA9D 4X60B 2BBKH 4O9DA 4BL0A 1PGUA 3MMYA 5FKQA 3OKWA 3JAMg 1PBYB 5EAMA 2I0TA 3AL9A 3IJ0A 4BUJC 4A0AB 2YMUA 4H5IA 3RRMC 4PSXB 4CY3A 2J55H 3ODTA 4PXWA 4CY2A 3UVLA 4PSWB 5CXCA 5IJ7E 2OK6A 2CNXA 2H14A 5HE2B 3F3GA 4XYIA 3NVQA 2CE9A 3MZKA 4CZXA 2EBSA 4CI2A 4FAVD 2GNQA 4IA9A 4FHLA 3C5MA 4I79A 3U4YA 2P9PC 1XKSA 4ZN4A 2YBAA 4AEZA 4GGAA 3JZHA 5TEFA 1GXRA 2HKMA 3RMZD 3RFHA 1NR0A 5EAPA 3SHFA 2HJ4A 4GZ8A 3EI2B 5I5IA 1MG2A 5THAA 3FM0A 1B9XA 4LG8A 1TYQC 1A0RB 3IIYA 3PVWB 1K8KC 4GMBA 3EU7A 1FWXA 4A08B 4ERZA 2AGLA 2H6KA 3V5WB 5I5JA 4N14A 4A11B 4OZUA 5EM2B 4QRJA 4ERQA 3MXXA 1N6EA 4HDJA 3UVKA 5FKSA 3SBQA 1PEVA 4FA5D 3A0FA 4ZOYA 3IKOA 4A2LA 1U2VC 3IJCA 3SMRA 5IGQA 2YNNA 2GC4A 2G9AA 4GGCA 2BCJB 4J84A 3JPXA 4GM9A 2PM9B 5GMKn 3CFSB 4J87A 3E0CA 4UI9R 3EI1B 3PSLA 1SQJA 3UKUC 1GG2B 3SN6B 5HQGA 3I7KA 2H3XA 1GP2B 2B4EA 3C9CA 3DXKC 3RN1D 4X61B 4JSNC 5I5MA 4LGNA 5EMJB 4D0KA 4H5JA 5TF2A 5EMMB 2CO0A 3FGBA 3F3FA 4XEIC 3VA6A 4A2MA 1N6FA 4U1EI 3KRXB 5IGOA 3F3PA 2O9KA 3CIKB 4ES0A 4G56B 4CC9A 2CE8A 1P22A 4BH6A 4E5ZA 5JWZA 4ESGA 2YB8B 4L9OA 3PXTD 5HE3B 5CXBB 3ULEC 4JSXC 4Y5RD 3BWSA 2GC7A 4J8BA 1L0QA 3UVMA 3RSEC 4GM3A 2I3TA 3UR4A 4K3ID 3OL2B 3OKTA 4K3JB 2B5NA 2QC5A 2IWKA 3OTTA 2UZYB 2W18A 5FKTA 4GQ1A 3EI2A 3C99A 4JSVC 2H9MA 3I7OA 4ERYA 2I0RA 2AGYA 3OW8A 3JB9L 4A7JA 4O1QD 1JJUB 3UKRC 2PM9A 2HXCA 3CFVA 3NVNA 5FXYA 2XYIA 3GREA 3JRPA 3I7PA 4A08A 4PBYA 4A11A 5EM2A 4JSPC 3AL8A 2HKRA 4L3HD 2J56H 4YVDA 5GXIA 5GSAA 2IUVA 2J57G 2H68A 2I0SA 3MKSB 4A0BA 3IJ1A 2AGZA 2H13A 3UVOA 4ZOVA 4JT6C 2OVQB 3P4FA 5HE1B 4KFMB 5IT9g 4CI1A 5AFU3 5C2WB 2IAAA 1ERJA 3OKYB 3AH8B 3VGZA 4J73A 4E5ZB 5TDHB 2HYEA 4ZOXA 5EARA 4GQ2P 4O3UB 2TRCB 3EG6A 5CXBA 3I7NA
chains in the Genus database with same CATH superfamily
3DDUA 5E6RA 2H9PA 3MVDK 1JV2A 3PVUB 3I8CA 4X3EA 3I89A 1E8MA 2VC2A 2CN2A 2OJYA 4PNKB 4Z8LA 3IIWA 2HU7A 1U8CA 1OMWB 3OL2A 1E5TA 3PXSD 5IC7A 3VH0A 2AQ5A 4J0XA 4IMMA 3ZE1A 1UOQA 1U4CA 2P9KC 1TBGA 3BG1A 2B5MA 5AJAA 3IUMA 2IUPA 3B7FA 1K32A 5EMKB 3DSMA 5H1MA 5TEEA 2H9NA 2VDKA 4NSXA 2VDLA 3SJLD 3T3MA 3DWLC 3MKQA 1UTCA 1YR2A 3NIGA 1XHMA 2AGWA 1OLZA 4OWRA 3SBPA 1VYHC 2Z2PA 2Q7QA 3MZLA 1S4UX 1JMXB 4JT5C 3PE7A 1C9IA 3IUJA 4WK2A 2UZXB 4FWWA 5H17A 4FB1D 4O3TB 2EIDA 4CY1A 2HESX 3K72A 3AL8B 1QNIA 5CYKB 3DXMC 2IUQA 4PBZA 1UOOA 4A0BB 2P9IC 3K26A 3L4OD 3IVMA 4L1QD 3SVWD 3SLED 3J81g 1MDAH 3MUNA 3SCYA 3K71A 3ZDXA 4FAND 5HYNB 3HFQA 2WQ8A 3FRXA 3EI3B 3ZWLB 5C9ZB 3EI4A 3RN0D 1L5GA 3JZNA 4JD2C 3SBRA 4L3GD 2EIEA 3OKYA 4MMXA 3I2NA 1VE6A 4WK4A 4J82A 2AGXA 2H47A 3SWSD 5C92A 1XIPA 3K27A 3QI0A 4J8GA 4UM9A 4DNVA 4CZVA 2I3SA 2HJBA 1YFQA 3NVXA 1JOFA 4MK0B 4G1EA 5HE0B 1PI6A 2CN3A 2OVPB 5EALA 4AMYA 4CI3A 4CY5A 2HU8A 2CO0C 4GM8A 4A0AA 2OIZA 5AMSA 1GOTB 1GOGA 2PBIB 5C2VB 1M1XA 4A09B 2P9LC 4U7AA 3ORVD 4J81A 5CXCB 5H14A 4E54A 4J86A 3EWEA 2H6QA 2PM6B 5A2Qg 2P9UC 3PSCB 3JZGA 5IJ8E 1VZ2A 2AH0A 2VDPA 3C75H 4QL1A 2YNPA 2G99A 5KDOB 4Z7OA 5K19A 3JROA 4GGDA 4Y7RA 1NEXB 2P9SC 4FA1D 4QT8A 2AH1A 3O4HA 4JHPC 5B4WA 5GXHA 4CI8A 4L1MA 2XL2A 1N6DA 2QXVA 5M5UA 2Z2NA 3N0EA 4J77A 5FQDA 3I8EA 5FA5B 2PM7B 3DM0A 2OK4A 4RE6A 2P9NC 5K1CC 1SQ9A 1R5MA 4D6VA 5M61A 3V4PA 3EI3A 2VZ3A 4PC0A 4X63B 3EI4B 5EMLB 2B5LA 3V9FA 4AOWA 3AFCA 3GFCA 2H6NA 3UVNA 4R7AB 4FA4D 2YNOA 3L4MD 3I7HA 4QQEA 5E6UA 4J0WA 4EWRA 2Z2OA 3O4GA 2XU7A 3V7DB 4CZYA 3GC3B 3W15A 2XL3A 3PXWD 5C86A 1B9YA 4GQBB 4J78A 4J79A 2MTAH 4G1MA 2VDQA 3BG0A 3RLMD 5CYKA 5E6SA 5SXMA 4LG9A 3IUQA 3RFGA 1MG3A 4UM8A 3J80g 3QHYB 1JMZB 3N0DA 1Q47A 5FFGA 1SHYB 4A09A 3FCUA 4IRZA 4JXMA 2H9LA 4XYHA 4E54B 1RI6A 3IJEA 1TYEA 3EMHA 5FLXg 4BP9A 4Z7NA 2OVRB 4ZOZA 2IURA 3I7LA 3SXTD 3KRWB 4O45A 3SFZA 2IWFA 5FKRA 3EI1A 4TZ4A 4FA9D 1T2XA 3V4VA 4X60B 2BBKH 4O9DA 4BL0A 1PGUA 3MMYA 1BPOA 5FKQA 3NIFA 3OKWA 3JAMg 1PBYB 5EAMA 2I0TA 3AL9A 1H2XA 3IJ0A 3ZE0A 4BUJC 4A0AB 2YMUA 4H5IA 3RRMC 4PSXB 4G55A 4CY3A 2J55H 3ODTA 4PXWA 1H2YA 4CY2A 3VI4A 4MMZA 3UVLA 4PSWB 5CXCA 5IJ7E 2OK6A 2CNXA 2H14A 1QFSA 5HE2B 3F3GA 4XYIA 3NVQA 2CE9A 3MZKA 4CZXA 2EBSA 4CI2A 4FAVD 2GNQA 4IA9A 4FHLA 3C5MA 4I79A 3U4YA 2P9PC 1XKSA 3EQ8A 4NAAA 4ZN4A 2YBAA 4AEZA 3ZDYA 4GGAA 3JZHA 5TEFA 4Z7QA 1GXRA 2HKMA 1E8NA 3RMZD 3RFHA 3EQ9A 1NR0A 5EAPA 3SHFA 2HJ4A 4GZ8A 4AN0A 3EI2B 5I5IA 1MG2A 3GD1I 5THAA 1GOFA 3FM0A 1B9XA 4LG8A 1TYQC 1A0RB 3IIYA 3PVWB 1K8KC 4GMBA 4AMZA 4AN1A 3K6SA 3EU7A 1FWXA 4A08B 4ERZA 2AGLA 2H6KA 3V5WB 2XDWA 5I5JA 4N14A 4A11B 4OZUA 3KCIA 5EM2B 4QRJA 5M5RA 4ERQA 3MXXA 5M5SA 1N6EA 3IUNA 1I2MB 4HDJA 3UVKA 5FKSA 3SBQA 1PEVA 4FA5D 3A0FA 4ZOYA 3IKOA 4A2LA 2HU5A 1U2VC 3MUOA 4BCBA 4O02A 3IJCA 2JKXA 4WK0A 3SMRA 5IGQA 2YNNA 2GC4A 2G9AA 2EIBA 4GGCA 4NENA 2BCJB 1VE7A 4J84A 3JPXA 4GM9A 2PM9B 3IULA 5GMKn 1A12A 4WJKA 3CFSB 4J87A 3E0CA 4UI9R 3EI1B 2VZ1A 3EQ7A 3PSLA 1SQJA 3UKUC 1GG2B 3SN6B 5HQGA 4AX4A 3I7KA 2H3XA 1UOPA 1GP2B 2B4EA 2EICA 3C9CA 4BP8A 3DXKC 1GOHA 3RN1D 5M5VA 4X61B 4JSNC 5I5MA 4LGNA 5EMJB 4D0KA 4H5JA 5TF2A 5EMMB 2CO0A 3FGBA 3F3FA 4XEIC 3VA6A 4A2MA 1N6FA 4QAMA 4U1EI 3KRXB 4NC4A 5IGOA 3F3PA 2O9KA 4D9SA 3CIKB 4ES0A 2QR5A 4G56B 4CC9A 2CE8A 1JTDB 1C9LA 1P22A 3VI3A 4BH6A 4E5ZA 5JWZA 3O4JA 4ESGA 2YB8B 4L9OA 3PXTD 4O2WA 4DNWA 5HE3B 5CXBB 3ZDZA 2VDRA 3ULEC 4JSXC 4J8BA 3BWSA 2GC7A 4Y5RD 1L0QA 3UVMA 3RSEC 3NIDA 4GM3A 2I3TA 3UR4A 4K3ID 5HDBA 3ZE2A 3OL2B 2BKLA 3OKTA 4K3JB 2B5NA 2QC5A 2IWKA 3O4IA 3OTTA 2UZYB 2W18A 5FKTA 4GQ1A 4MMYA 3EI2A 3C99A 4JSVC 2H9MA 3I7OA 4ERYA 1O6GA 2AGYA 2I0RA 3OW8A 3JB9L 4A7JA 4JHNA 4O1QD 3IURA 1JJUB 1VZ3A 3UKRC 2PM9A 2HXCA 3NVNA 3CFVA 5FXYA 2XYIA 3GREA 3JRPA 1H2WA 4BCCA 3I7PA 5M5TA 4A08A 3FCSA 3T3PA 3OF7A 4PBYA 4DNUA 1O6FA 4BCDA 4A11A 5EM2A 4NBMA 2QZPA 4JSPC 3AL8A 2HKRA 4L3HD 2XZGA 2J56H 4YVDA 2VDOA 5GXIA 1QFMA 5GSAA 2IUVA 2J57G 2H68A 2I0SA 3MKSB 4A0BA 3IJ1A 2AGZA 2H13A 3UVOA 4ZOVA 2VDNA 2VDMA 4JT6C 2OVQB 2XE4A 1H2ZA 1K3IA 3P4FA 5HE1B 4KFMB 5IT9g 4CI1A 5AFU3 5C2WB 2IAAA 4RE5A 1ERJA 3OKYB 3AH8B 3VGZA 4J73A 4E5ZB 5TDHB 2HYEA 4ZOXA 5EARA 4GQ2P 2TRCB 4O3UB 3EG6A 5CXBA 3I7NA 5FFOA
chains in the Genus database with same CATH topology
2H9PA 3PVUB 3I8CA 4X3EA 3I89A 4Z8LA 2CN2A 2OJYA 4PNKB 3IIWA 1OMWB 3OL2A 3PXSD 5IC7A 3VH0A 2AQ5A 4J0XA 4IMMA 1U4CA 2P9KC 1TBGA 3BG1A 2B5MA 5AJAA 2IUPA 3B7FA 1K32A 5EMKB 3DSMA 5H1MA 5TEEA 2H9NA 4NSXA 3SJLD 3DWLC 3MKQA 1XHMA 2AGWA 1OLZA 4OWRA 3SBPA 1VYHC 2Z2PA 2Q7QA 3MZLA 1S4UX 1JMXB 4JT5C 3PE7A 5H17A 2UZXB 4FWWA 4FB1D 4O3TB 4CY1A 2HESX 3AL8B 1QNIA 5CYKB 3DXMC 2IUQA 4PBZA 4A0BB 2P9IC 3K26A 3L4OD 4L1QD 3SVWD 3SLED 3J81g 1MDAH 3SCYA 4FAND 5HYNB 3HFQA 3FRXA 3EI3B 3ZWLB 5C9ZB 3EI4A 3RN0D 3JZNA 4JD2C 3SBRA 4L3GD 3OKYA 3I2NA 4J82A 2AGXA 2H47A 3SWSD 1XIPA 3K27A 4J8GA 4CZVA 2I3SA 2HJBA 1YFQA 3NVXA 1JOFA 4MK0B 5HE0B 1PI6A 2CN3A 2OVPB 5EALA 4CI3A 4CY5A 2CO0C 4GM8A 4A0AA 2OIZA 5AMSA 1GOTB 2PBIB 5C2VB 4A09B 2P9LC 4U7AA 3ORVD 4J81A 5CXCB 5H14A 4E54A 4J86A 3EWEA 2H6QA 2PM6B 5A2Qg 2P9UC 3PSCB 3JZGA 5IJ8E 2AH0A 3C75H 4QL1A 2YNPA 2G99A 5KDOB 5K19A 3JROA 4GGDA 4Y7RA 1NEXB 2P9SC 4FA1D 4QT8A 2AH1A 5B4WA 5GXHA 4CI8A 2XL2A 1N6DA 2QXVA 2Z2NA 3N0EA 4J77A 5FQDA 3I8EA 5FA5B 2PM7B 3DM0A 2OK4A 5K1CC 2P9NC 1SQ9A 1R5MA 4D6VA 3EI3A 4PC0A 4X63B 3EI4B 5EMLB 2B5LA 3V9FA 4AOWA 3AFCA 3GFCA 2H6NA 3UVNA 4R7AB 4FA4D 2YNOA 3L4MD 3I7HA 4QQEA 4J0WA 4EWRA 2Z2OA 2XU7A 3V7DB 4CZYA 3W15A 2XL3A 3PXWD 1B9YA 4GQBB 4J78A 4J79A 2MTAH 3BG0A 3RLMD 5CYKA 5SXMA 4LG9A 3RFGA 1MG3A 3J80g 1JMZB 3N0DA 1Q47A 4A09A 1SHYB 4JXMA 2H9LA 4XYHA 4E54B 1RI6A 3EMHA 5FLXg 2OVRB 4ZOZA 2IURA 3I7LA 3SXTD 3KRWB 4O45A 3SFZA 2IWFA 5FKRA 3EI1A 4TZ4A 4FA9D 4X60B 2BBKH 4O9DA 4BL0A 1PGUA 3MMYA 5FKQA 3OKWA 3JAMg 1PBYB 5EAMA 2I0TA 3AL9A 3IJ0A 4BUJC 4A0AB 2YMUA 4H5IA 3RRMC 4PSXB 4CY3A 2J55H 3ODTA 4PXWA 4CY2A 3UVLA 4PSWB 5CXCA 5IJ7E 2OK6A 2CNXA 2H14A 5HE2B 3F3GA 4XYIA 3NVQA 2CE9A 3MZKA 4CZXA 2EBSA 4CI2A 4FAVD 2GNQA 4IA9A 4FHLA 3C5MA 4I79A 3U4YA 2P9PC 1XKSA 4ZN4A 2YBAA 4AEZA 4GGAA 3JZHA 5TEFA 1GXRA 2HKMA 3RMZD 3RFHA 1NR0A 5EAPA 3SHFA 2HJ4A 4GZ8A 3EI2B 5I5IA 1MG2A 5THAA 3FM0A 1B9XA 4LG8A 1TYQC 1A0RB 3IIYA 3PVWB 1K8KC 4GMBA 3EU7A 1FWXA 4A08B 4ERZA 2AGLA 2H6KA 3V5WB 5I5JA 4N14A 4A11B 4OZUA 5EM2B 4QRJA 4ERQA 3MXXA 1N6EA 4HDJA 3UVKA 5FKSA 3SBQA 1PEVA 4FA5D 3A0FA 4ZOYA 3IKOA 4A2LA 1U2VC 3IJCA 3SMRA 5IGQA 2YNNA 2GC4A 2G9AA 4GGCA 2BCJB 4J84A 3JPXA 4GM9A 2PM9B 5GMKn 3CFSB 4J87A 3E0CA 4UI9R 3EI1B 3PSLA 1SQJA 3UKUC 1GG2B 3SN6B 5HQGA 3I7KA 2H3XA 1GP2B 2B4EA 3C9CA 3DXKC 3RN1D 4X61B 4JSNC 5I5MA 4LGNA 5EMJB 4D0KA 4H5JA 5TF2A 5EMMB 2CO0A 3FGBA 3F3FA 4XEIC 3VA6A 4A2MA 1N6FA 4U1EI 3KRXB 5IGOA 3F3PA 2O9KA 3CIKB 4ES0A 4G56B 4CC9A 2CE8A 1P22A 4BH6A 4E5ZA 5JWZA 4ESGA 2YB8B 4L9OA 3PXTD 5HE3B 5CXBB 3ULEC 4JSXC 4Y5RD 3BWSA 2GC7A 4J8BA 1L0QA 3UVMA 3RSEC 4GM3A 2I3TA 3UR4A 4K3ID 3OL2B 3OKTA 4K3JB 2B5NA 2QC5A 2IWKA 3OTTA 2UZYB 2W18A 5FKTA 4GQ1A 3EI2A 3C99A 4JSVC 2H9MA 3I7OA 4ERYA 2I0RA 2AGYA 3OW8A 3JB9L 4A7JA 4O1QD 1JJUB 3UKRC 2PM9A 2HXCA 3CFVA 3NVNA 5FXYA 2XYIA 3GREA 3JRPA 3I7PA 4A08A 4PBYA 4A11A 5EM2A 4JSPC 3AL8A 2HKRA 4L3HD 2J56H 4YVDA 5GXIA 5GSAA 2IUVA 2J57G 2H68A 2I0SA 3MKSB 4A0BA 3IJ1A 2AGZA 2H13A 3UVOA 4ZOVA 4JT6C 2OVQB 3P4FA 5HE1B 4KFMB 5IT9g 4CI1A 5AFU3 5C2WB 2IAAA 1ERJA 3OKYB 3AH8B 3VGZA 4J73A 4E5ZB 5TDHB 2HYEA 4ZOXA 5EARA 4GQ2P 4O3UB 2TRCB 3EG6A 5CXBA 3I7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H9P A;  3PVU B;  3I8C A;  4X3E A;  3I89 A;  4Z8L A;  2CN2 A;  2OJY A;  4PNK B;  3IIW A;  1OMW B;  3OL2 A;  3PXS D;  5IC7 A;  3VH0 A;  2AQ5 A;  4J0X A;  4IMM A;  1U4C A;  2P9K C;  1TBG A;  3BG1 A;  2B5M A;  5AJA A;  2IUP A;  3B7F A;  1K32 A;  5EMK B;  3DSM A;  5H1M A;  5TEE A;  2H9N A;  4NSX A;  3SJL D;  3DWL C;  3MKQ A;  1XHM A;  2AGW A;  1OLZ A;  4OWR A;  3SBP A;  1VYH C;  2Z2P A;  2Q7Q A;  3MZL A;  1S4U X;  1JMX B;  4JT5 C;  3PE7 A;  5H17 A;  2UZX B;  4FWW A;  4FB1 D;  4O3T B;  4CY1 A;  2HES X;  3AL8 B;  1QNI A;  5CYK B;  3DXM C;  2IUQ A;  4PBZ A;  4A0B B;  2P9I C;  3K26 A;  3L4O D;  4L1Q D;  3SVW D;  3SLE D;  3J81 g;  1MDA H;  3SCY A;  4FAN D;  5HYN B;  3HFQ A;  3FRX A;  3EI3 B;  3ZWL B;  5C9Z B;  3EI4 A;  3RN0 D;  3JZN A;  4JD2 C;  3SBR A;  4L3G D;  3OKY A;  3I2N A;  4J82 A;  2AGX A;  2H47 A;  3SWS D;  1XIP A;  3K27 A;  4J8G A;  4CZV A;  2I3S A;  2HJB A;  1YFQ A;  3NVX A;  1JOF A;  4MK0 B;  5HE0 B;  1PI6 A;  2CN3 A;  2OVP B;  5EAL A;  4CI3 A;  4CY5 A;  2CO0 C;  4GM8 A;  4A0A A;  2OIZ A;  5AMS A;  1GOT B;  2PBI B;  5C2V B;  4A09 B;  2P9L C;  4U7A A;  3ORV D;  4J81 A;  5CXC B;  5H14 A;  4E54 A;  4J86 A;  3EWE A;  2H6Q A;  2PM6 B;  5A2Q g;  2P9U C;  3PSC B;  3JZG A;  5IJ8 E;  2AH0 A;  3C75 H;  4QL1 A;  2YNP A;  2G99 A;  5KDO B;  5K19 A;  3JRO A;  4GGD A;  4Y7R A;  1NEX B;  2P9S C;  4FA1 D;  4QT8 A;  2AH1 A;  5B4W A;  5GXH A;  4CI8 A;  2XL2 A;  1N6D A;  2QXV A;  2Z2N A;  3N0E A;  4J77 A;  5FQD A;  3I8E A;  5FA5 B;  2PM7 B;  3DM0 A;  2OK4 A;  5K1C C;  2P9N C;  1SQ9 A;  1R5M A;  4D6V A;  3EI3 A;  4PC0 A;  4X63 B;  3EI4 B;  5EML B;  2B5L A;  3V9F A;  4AOW A;  3AFC A;  3GFC A;  2H6N A;  3UVN A;  4R7A B;  4FA4 D;  2YNO A;  3L4M D;  3I7H A;  4QQE A;  4J0W A;  4EWR A;  2Z2O A;  2XU7 A;  3V7D B;  4CZY A;  3W15 A;  2XL3 A;  3PXW D;  1B9Y A;  4GQB B;  4J78 A;  4J79 A;  2MTA H;  3BG0 A;  3RLM D;  5CYK A;  5SXM A;  4LG9 A;  3RFG A;  1MG3 A;  3J80 g;  1JMZ B;  3N0D A;  1Q47 A;  4A09 A;  1SHY B;  4JXM A;  2H9L A;  4XYH A;  4E54 B;  1RI6 A;  3EMH A;  5FLX g;  2OVR B;  4ZOZ A;  2IUR A;  3I7L A;  3SXT D;  3KRW B;  4O45 A;  3SFZ A;  2IWF A;  5FKR A;  3EI1 A;  4TZ4 A;  4FA9 D;  4X60 B;  2BBK H;  4O9D A;  4BL0 A;  1PGU A;  3MMY A;  5FKQ A;  3OKW A;  3JAM g;  1PBY B;  5EAM A;  2I0T A;  3AL9 A;  3IJ0 A;  4BUJ C;  4A0A B;  2YMU A;  4H5I A;  3RRM C;  4PSX B;  4CY3 A;  2J55 H;  3ODT A;  4PXW A;  4CY2 A;  3UVL A;  4PSW B;  5CXC A;  5IJ7 E;  2OK6 A;  2CNX A;  2H14 A;  5HE2 B;  3F3G A;  4XYI A;  3NVQ A;  2CE9 A;  3MZK A;  4CZX A;  2EBS A;  4CI2 A;  4FAV D;  2GNQ A;  4IA9 A;  4FHL A;  3C5M A;  4I79 A;  3U4Y A;  2P9P C;  1XKS A;  4ZN4 A;  2YBA A;  4AEZ A;  4GGA A;  3JZH A;  5TEF A;  1GXR A;  2HKM A;  3RMZ D;  3RFH A;  1NR0 A;  5EAP A;  3SHF A;  2HJ4 A;  4GZ8 A;  3EI2 B;  5I5I A;  1MG2 A;  5THA A;  3FM0 A;  1B9X A;  4LG8 A;  1TYQ C;  1A0R B;  3IIY A;  3PVW B;  1K8K C;  4GMB A;  3EU7 A;  1FWX A;  4A08 B;  4ERZ A;  2AGL A;  2H6K A;  3V5W B;  5I5J A;  4N14 A;  4A11 B;  4OZU A;  5EM2 B;  4QRJ A;  4ERQ A;  3MXX A;  1N6E A;  4HDJ A;  3UVK A;  5FKS A;  3SBQ A;  1PEV A;  4FA5 D;  3A0F A;  4ZOY A;  3IKO A;  4A2L A;  1U2V C;  3IJC A;  3SMR A;  5IGQ A;  2YNN A;  2GC4 A;  2G9A A;  4GGC A;  2BCJ B;  4J84 A;  3JPX A;  4GM9 A;  2PM9 B;  5GMK n;  3CFS B;  4J87 A;  3E0C A;  4UI9 R;  3EI1 B;  3PSL A;  1SQJ A;  3UKU C;  1GG2 B;  3SN6 B;  5HQG A;  3I7K A;  2H3X A;  1GP2 B;  2B4E A;  3C9C A;  3DXK C;  3RN1 D;  4X61 B;  4JSN C;  5I5M A;  4LGN A;  5EMJ B;  4D0K A;  4H5J A;  5TF2 A;  5EMM B;  2CO0 A;  3FGB A;  3F3F A;  4XEI C;  3VA6 A;  4A2M A;  1N6F A;  4U1E I;  3KRX B;  5IGO A;  3F3P A;  2O9K A;  3CIK B;  4ES0 A;  4G56 B;  4CC9 A;  2CE8 A;  1P22 A;  4BH6 A;  4E5Z A;  5JWZ A;  4ESG A;  2YB8 B;  4L9O A;  3PXT D;  5HE3 B;  5CXB B;  3ULE C;  4JSX C;  4Y5R D;  3BWS A;  2GC7 A;  4J8B A;  1L0Q A;  3UVM A;  3RSE C;  4GM3 A;  2I3T A;  3UR4 A;  4K3I D;  3OL2 B;  3OKT A;  4K3J B;  2B5N A;  2QC5 A;  2IWK A;  3OTT A;  2UZY B;  2W18 A;  5FKT A;  4GQ1 A;  3EI2 A;  3C99 A;  4JSV C;  2H9M A;  3I7O A;  4ERY A;  2I0R A;  2AGY A;  3OW8 A;  3JB9 L;  4A7J A;  4O1Q D;  1JJU B;  3UKR C;  2PM9 A;  2HXC A;  3CFV A;  3NVN A;  5FXY A;  2XYI A;  3GRE A;  3JRP A;  3I7P A;  4A08 A;  4PBY A;  4A11 A;  5EM2 A;  4JSP C;  3AL8 A;  2HKR A;  4L3H D;  2J56 H;  4YVD A;  5GXI A;  5GSA A;  2IUV A;  2J57 G;  2H68 A;  2I0S A;  3MKS B;  4A0B A;  3IJ1 A;  2AGZ A;  2H13 A;  3UVO A;  4ZOV A;  4JT6 C;  2OVQ B;  3P4F A;  5HE1 B;  4KFM B;  5IT9 g;  4CI1 A;  5AFU 3;  5C2W B;  2IAA A;  1ERJ A;  3OKY B;  3AH8 B;  3VGZ A;  4J73 A;  4E5Z B;  5TDH B;  2HYE A;  4ZOX A;  5EAR A;  4GQ2 P;  4O3U B;  2TRC B;  3EG6 A;  5CXB A;  3I7N A; 
#chains in the Genus database with same CATH topology
 3DDU A;  5E6R A;  2H9P A;  3MVD K;  1JV2 A;  3PVU B;  3I8C A;  4X3E A;  3I89 A;  1E8M A;  2VC2 A;  2CN2 A;  2OJY A;  4PNK B;  4Z8L A;  3IIW A;  2HU7 A;  1U8C A;  1OMW B;  3OL2 A;  1E5T A;  3PXS D;  5IC7 A;  3VH0 A;  2AQ5 A;  4J0X A;  4IMM A;  3ZE1 A;  1UOQ A;  1U4C A;  2P9K C;  1TBG A;  3BG1 A;  2B5M A;  5AJA A;  3IUM A;  2IUP A;  3B7F A;  1K32 A;  5EMK B;  3DSM A;  5H1M A;  5TEE A;  2H9N A;  2VDK A;  4NSX A;  2VDL A;  3SJL D;  3T3M A;  3DWL C;  3MKQ A;  1UTC A;  1YR2 A;  3NIG A;  1XHM A;  2AGW A;  1OLZ A;  4OWR A;  3SBP A;  1VYH C;  2Z2P A;  2Q7Q A;  3MZL A;  1S4U X;  1JMX B;  4JT5 C;  3PE7 A;  1C9I A;  3IUJ A;  4WK2 A;  2UZX B;  4FWW A;  5H17 A;  4FB1 D;  4O3T B;  2EID A;  4CY1 A;  2HES X;  3K72 A;  3AL8 B;  1QNI A;  5CYK B;  3DXM C;  2IUQ A;  4PBZ A;  1UOO A;  4A0B B;  2P9I C;  3K26 A;  3L4O D;  3IVM A;  4L1Q D;  3SVW D;  3SLE D;  3J81 g;  1MDA H;  3MUN A;  3SCY A;  3K71 A;  3ZDX A;  4FAN D;  5HYN B;  3HFQ A;  2WQ8 A;  3FRX A;  3EI3 B;  3ZWL B;  5C9Z B;  3EI4 A;  3RN0 D;  1L5G A;  3JZN A;  4JD2 C;  3SBR A;  4L3G D;  2EIE A;  3OKY A;  4MMX A;  3I2N A;  1VE6 A;  4WK4 A;  4J82 A;  2AGX A;  2H47 A;  3SWS D;  5C92 A;  1XIP A;  3K27 A;  3QI0 A;  4J8G A;  4UM9 A;  4DNV A;  4CZV A;  2I3S A;  2HJB A;  1YFQ A;  3NVX A;  1JOF A;  4MK0 B;  4G1E A;  5HE0 B;  1PI6 A;  2CN3 A;  2OVP B;  5EAL A;  4AMY A;  4CI3 A;  4CY5 A;  2HU8 A;  2CO0 C;  4GM8 A;  4A0A A;  2OIZ A;  5AMS A;  1GOT B;  1GOG A;  2PBI B;  5C2V B;  1M1X A;  4A09 B;  2P9L C;  4U7A A;  3ORV D;  4J81 A;  5CXC B;  5H14 A;  4E54 A;  4J86 A;  3EWE A;  2H6Q A;  2PM6 B;  5A2Q g;  2P9U C;  3PSC B;  3JZG A;  5IJ8 E;  1VZ2 A;  2AH0 A;  2VDP A;  3C75 H;  4QL1 A;  2YNP A;  2G99 A;  5KDO B;  4Z7O A;  5K19 A;  3JRO A;  4GGD A;  4Y7R A;  1NEX B;  2P9S C;  4FA1 D;  4QT8 A;  2AH1 A;  3O4H A;  4JHP C;  5B4W A;  5GXH A;  4CI8 A;  4L1M A;  2XL2 A;  1N6D A;  2QXV A;  5M5U A;  2Z2N A;  3N0E A;  4J77 A;  5FQD A;  3I8E A;  5FA5 B;  2PM7 B;  3DM0 A;  2OK4 A;  4RE6 A;  2P9N C;  5K1C C;  1SQ9 A;  1R5M A;  4D6V A;  5M61 A;  3V4P A;  3EI3 A;  2VZ3 A;  4PC0 A;  4X63 B;  3EI4 B;  5EML B;  2B5L A;  3V9F A;  4AOW A;  3AFC A;  3GFC A;  2H6N A;  3UVN A;  4R7A B;  4FA4 D;  2YNO A;  3L4M D;  3I7H A;  4QQE A;  5E6U A;  4J0W A;  4EWR A;  2Z2O A;  3O4G A;  2XU7 A;  3V7D B;  4CZY A;  3GC3 B;  3W15 A;  2XL3 A;  3PXW D;  5C86 A;  1B9Y A;  4GQB B;  4J78 A;  4J79 A;  2MTA H;  4G1M A;  2VDQ A;  3BG0 A;  3RLM D;  5CYK A;  5E6S A;  5SXM A;  4LG9 A;  3IUQ A;  3RFG A;  1MG3 A;  4UM8 A;  3J80 g;  3QHY B;  1JMZ B;  3N0D A;  1Q47 A;  5FFG A;  1SHY B;  4A09 A;  3FCU A;  4IRZ A;  4JXM A;  2H9L A;  4XYH A;  4E54 B;  1RI6 A;  3IJE A;  1TYE A;  3EMH A;  5FLX g;  4BP9 A;  4Z7N A;  2OVR B;  4ZOZ A;  2IUR A;  3I7L A;  3SXT D;  3KRW B;  4O45 A;  3SFZ A;  2IWF A;  5FKR A;  3EI1 A;  4TZ4 A;  4FA9 D;  1T2X A;  3V4V A;  4X60 B;  2BBK H;  4O9D A;  4BL0 A;  1PGU A;  3MMY A;  1BPO A;  5FKQ A;  3NIF A;  3OKW A;  3JAM g;  1PBY B;  5EAM A;  2I0T A;  3AL9 A;  1H2X A;  3IJ0 A;  3ZE0 A;  4BUJ C;  4A0A B;  2YMU A;  4H5I A;  3RRM C;  4PSX B;  4G55 A;  4CY3 A;  2J55 H;  3ODT A;  4PXW A;  1H2Y A;  4CY2 A;  3VI4 A;  4MMZ A;  3UVL A;  4PSW B;  5CXC A;  5IJ7 E;  2OK6 A;  2CNX A;  2H14 A;  1QFS A;  5HE2 B;  3F3G A;  4XYI A;  3NVQ A;  2CE9 A;  3MZK A;  4CZX A;  2EBS A;  4CI2 A;  4FAV D;  2GNQ A;  4IA9 A;  4FHL A;  3C5M A;  4I79 A;  3U4Y A;  2P9P C;  1XKS A;  3EQ8 A;  4NAA A;  4ZN4 A;  2YBA A;  4AEZ A;  3ZDY A;  4GGA A;  3JZH A;  5TEF A;  4Z7Q A;  1GXR A;  2HKM A;  1E8N A;  3RMZ D;  3RFH A;  3EQ9 A;  1NR0 A;  5EAP A;  3SHF A;  2HJ4 A;  4GZ8 A;  4AN0 A;  3EI2 B;  5I5I A;  1MG2 A;  3GD1 I;  5THA A;  1GOF A;  3FM0 A;  1B9X A;  4LG8 A;  1TYQ C;  1A0R B;  3IIY A;  3PVW B;  1K8K C;  4GMB A;  4AMZ A;  4AN1 A;  3K6S A;  3EU7 A;  1FWX A;  4A08 B;  4ERZ A;  2AGL A;  2H6K A;  3V5W B;  2XDW A;  5I5J A;  4N14 A;  4A11 B;  4OZU A;  3KCI A;  5EM2 B;  4QRJ A;  5M5R A;  4ERQ A;  3MXX A;  5M5S A;  1N6E A;  3IUN A;  1I2M B;  4HDJ A;  3UVK A;  5FKS A;  3SBQ A;  1PEV A;  4FA5 D;  3A0F A;  4ZOY A;  3IKO A;  4A2L A;  2HU5 A;  1U2V C;  3MUO A;  4BCB A;  4O02 A;  3IJC A;  2JKX A;  4WK0 A;  3SMR A;  5IGQ A;  2YNN A;  2GC4 A;  2G9A A;  2EIB A;  4GGC A;  4NEN A;  2BCJ B;  1VE7 A;  4J84 A;  3JPX A;  4GM9 A;  2PM9 B;  3IUL A;  5GMK n;  1A12 A;  4WJK A;  3CFS B;  4J87 A;  3E0C A;  4UI9 R;  3EI1 B;  2VZ1 A;  3EQ7 A;  3PSL A;  1SQJ A;  3UKU C;  1GG2 B;  3SN6 B;  5HQG A;  4AX4 A;  3I7K A;  2H3X A;  1UOP A;  1GP2 B;  2B4E A;  2EIC A;  3C9C A;  4BP8 A;  3DXK C;  1GOH A;  3RN1 D;  5M5V A;  4X61 B;  4JSN C;  5I5M A;  4LGN A;  5EMJ B;  4D0K A;  4H5J A;  5TF2 A;  5EMM B;  2CO0 A;  3FGB A;  3F3F A;  4XEI C;  3VA6 A;  4A2M A;  1N6F A;  4QAM A;  4U1E I;  3KRX B;  4NC4 A;  5IGO A;  3F3P A;  2O9K A;  4D9S A;  3CIK B;  4ES0 A;  2QR5 A;  4G56 B;  4CC9 A;  2CE8 A;  1JTD B;  1C9L A;  1P22 A;  3VI3 A;  4BH6 A;  4E5Z A;  5JWZ A;  3O4J A;  4ESG A;  2YB8 B;  4L9O A;  3PXT D;  4O2W A;  4DNW A;  5HE3 B;  5CXB B;  3ZDZ A;  2VDR A;  3ULE C;  4JSX C;  4J8B A;  3BWS A;  2GC7 A;  4Y5R D;  1L0Q A;  3UVM A;  3RSE C;  3NID A;  4GM3 A;  2I3T A;  3UR4 A;  4K3I D;  5HDB A;  3ZE2 A;  3OL2 B;  2BKL A;  3OKT A;  4K3J B;  2B5N A;  2QC5 A;  2IWK A;  3O4I A;  3OTT A;  2UZY B;  2W18 A;  5FKT A;  4GQ1 A;  4MMY A;  3EI2 A;  3C99 A;  4JSV C;  2H9M A;  3I7O A;  4ERY A;  1O6G A;  2AGY A;  2I0R A;  3OW8 A;  3JB9 L;  4A7J A;  4JHN A;  4O1Q D;  3IUR A;  1JJU B;  1VZ3 A;  3UKR C;  2PM9 A;  2HXC A;  3NVN A;  3CFV A;  5FXY A;  2XYI A;  3GRE A;  3JRP A;  1H2W A;  4BCC A;  3I7P A;  5M5T A;  4A08 A;  3FCS A;  3T3P A;  3OF7 A;  4PBY A;  4DNU A;  1O6F A;  4BCD A;  4A11 A;  5EM2 A;  4NBM A;  2QZP A;  4JSP C;  3AL8 A;  2HKR A;  4L3H D;  2XZG A;  2J56 H;  4YVD A;  2VDO A;  5GXI A;  1QFM A;  5GSA A;  2IUV A;  2J57 G;  2H68 A;  2I0S A;  3MKS B;  4A0B A;  3IJ1 A;  2AGZ A;  2H13 A;  3UVO A;  4ZOV A;  2VDN A;  2VDM A;  4JT6 C;  2OVQ B;  2XE4 A;  1H2Z A;  1K3I A;  3P4F A;  5HE1 B;  4KFM B;  5IT9 g;  4CI1 A;  5AFU 3;  5C2W B;  2IAA A;  4RE5 A;  1ERJ A;  3OKY B;  3AH8 B;  3VGZ A;  4J73 A;  4E5Z B;  5TDH B;  2HYE A;  4ZOX A;  5EAR A;  4GQ2 P;  2TRC B;  4O3U B;  3EG6 A;  5CXB A;  3I7N A;  5FFO A; 
#chains in the Genus database with same CATH homology
 2H9P A;  3PVU B;  3I8C A;  4X3E A;  3I89 A;  4Z8L A;  2CN2 A;  2OJY A;  4PNK B;  3IIW A;  1OMW B;  3OL2 A;  3PXS D;  5IC7 A;  3VH0 A;  2AQ5 A;  4J0X A;  4IMM A;  1U4C A;  2P9K C;  1TBG A;  3BG1 A;  2B5M A;  5AJA A;  2IUP A;  3B7F A;  1K32 A;  5EMK B;  3DSM A;  5H1M A;  5TEE A;  2H9N A;  4NSX A;  3SJL D;  3DWL C;  3MKQ A;  1XHM A;  2AGW A;  1OLZ A;  4OWR A;  3SBP A;  1VYH C;  2Z2P A;  2Q7Q A;  3MZL A;  1S4U X;  1JMX B;  4JT5 C;  3PE7 A;  5H17 A;  2UZX B;  4FWW A;  4FB1 D;  4O3T B;  4CY1 A;  2HES X;  3AL8 B;  1QNI A;  5CYK B;  3DXM C;  2IUQ A;  4PBZ A;  4A0B B;  2P9I C;  3K26 A;  3L4O D;  4L1Q D;  3SVW D;  3SLE D;  3J81 g;  1MDA H;  3SCY A;  4FAN D;  5HYN B;  3HFQ A;  3FRX A;  3EI3 B;  3ZWL B;  5C9Z B;  3EI4 A;  3RN0 D;  3JZN A;  4JD2 C;  3SBR A;  4L3G D;  3OKY A;  3I2N A;  4J82 A;  2AGX A;  2H47 A;  3SWS D;  1XIP A;  3K27 A;  4J8G A;  4CZV A;  2I3S A;  2HJB A;  1YFQ A;  3NVX A;  1JOF A;  4MK0 B;  5HE0 B;  1PI6 A;  2CN3 A;  2OVP B;  5EAL A;  4CI3 A;  4CY5 A;  2CO0 C;  4GM8 A;  4A0A A;  2OIZ A;  5AMS A;  1GOT B;  2PBI B;  5C2V B;  4A09 B;  2P9L C;  4U7A A;  3ORV D;  4J81 A;  5CXC B;  5H14 A;  4E54 A;  4J86 A;  3EWE A;  2H6Q A;  2PM6 B;  5A2Q g;  2P9U C;  3PSC B;  3JZG A;  5IJ8 E;  2AH0 A;  3C75 H;  4QL1 A;  2YNP A;  2G99 A;  5KDO B;  5K19 A;  3JRO A;  4GGD A;  4Y7R A;  1NEX B;  2P9S C;  4FA1 D;  4QT8 A;  2AH1 A;  5B4W A;  5GXH A;  4CI8 A;  2XL2 A;  1N6D A;  2QXV A;  2Z2N A;  3N0E A;  4J77 A;  5FQD A;  3I8E A;  5FA5 B;  2PM7 B;  3DM0 A;  2OK4 A;  5K1C C;  2P9N C;  1SQ9 A;  1R5M A;  4D6V A;  3EI3 A;  4PC0 A;  4X63 B;  3EI4 B;  5EML B;  2B5L A;  3V9F A;  4AOW A;  3AFC A;  3GFC A;  2H6N A;  3UVN A;  4R7A B;  4FA4 D;  2YNO A;  3L4M D;  3I7H A;  4QQE A;  4J0W A;  4EWR A;  2Z2O A;  2XU7 A;  3V7D B;  4CZY A;  3W15 A;  2XL3 A;  3PXW D;  1B9Y A;  4GQB B;  4J78 A;  4J79 A;  2MTA H;  3BG0 A;  3RLM D;  5CYK A;  5SXM A;  4LG9 A;  3RFG A;  1MG3 A;  3J80 g;  1JMZ B;  3N0D A;  1Q47 A;  4A09 A;  1SHY B;  4JXM A;  2H9L A;  4XYH A;  4E54 B;  1RI6 A;  3EMH A;  5FLX g;  2OVR B;  4ZOZ A;  2IUR A;  3I7L A;  3SXT D;  3KRW B;  4O45 A;  3SFZ A;  2IWF A;  5FKR A;  3EI1 A;  4TZ4 A;  4FA9 D;  4X60 B;  2BBK H;  4O9D A;  4BL0 A;  1PGU A;  3MMY A;  5FKQ A;  3OKW A;  3JAM g;  1PBY B;  5EAM A;  2I0T A;  3AL9 A;  3IJ0 A;  4BUJ C;  4A0A B;  2YMU A;  4H5I A;  3RRM C;  4PSX B;  4CY3 A;  2J55 H;  3ODT A;  4PXW A;  4CY2 A;  3UVL A;  4PSW B;  5CXC A;  5IJ7 E;  2OK6 A;  2CNX A;  2H14 A;  5HE2 B;  3F3G A;  4XYI A;  3NVQ A;  2CE9 A;  3MZK A;  4CZX A;  2EBS A;  4CI2 A;  4FAV D;  2GNQ A;  4IA9 A;  4FHL A;  3C5M A;  4I79 A;  3U4Y A;  2P9P C;  1XKS A;  4ZN4 A;  2YBA A;  4AEZ A;  4GGA A;  3JZH A;  5TEF A;  1GXR A;  2HKM A;  3RMZ D;  3RFH A;  1NR0 A;  5EAP A;  3SHF A;  2HJ4 A;  4GZ8 A;  3EI2 B;  5I5I A;  1MG2 A;  5THA A;  3FM0 A;  1B9X A;  4LG8 A;  1TYQ C;  1A0R B;  3IIY A;  3PVW B;  1K8K C;  4GMB A;  3EU7 A;  1FWX A;  4A08 B;  4ERZ A;  2AGL A;  2H6K A;  3V5W B;  5I5J A;  4N14 A;  4A11 B;  4OZU A;  5EM2 B;  4QRJ A;  4ERQ A;  3MXX A;  1N6E A;  4HDJ A;  3UVK A;  5FKS A;  3SBQ A;  1PEV A;  4FA5 D;  3A0F A;  4ZOY A;  3IKO A;  4A2L A;  1U2V C;  3IJC A;  3SMR A;  5IGQ A;  2YNN A;  2GC4 A;  2G9A A;  4GGC A;  2BCJ B;  4J84 A;  3JPX A;  4GM9 A;  2PM9 B;  5GMK n;  3CFS B;  4J87 A;  3E0C A;  4UI9 R;  3EI1 B;  3PSL A;  1SQJ A;  3UKU C;  1GG2 B;  3SN6 B;  5HQG A;  3I7K A;  2H3X A;  1GP2 B;  2B4E A;  3C9C A;  3DXK C;  3RN1 D;  4X61 B;  4JSN C;  5I5M A;  4LGN A;  5EMJ B;  4D0K A;  4H5J A;  5TF2 A;  5EMM B;  2CO0 A;  3FGB A;  3F3F A;  4XEI C;  3VA6 A;  4A2M A;  1N6F A;  4U1E I;  3KRX B;  5IGO A;  3F3P A;  2O9K A;  3CIK B;  4ES0 A;  4G56 B;  4CC9 A;  2CE8 A;  1P22 A;  4BH6 A;  4E5Z A;  5JWZ A;  4ESG A;  2YB8 B;  4L9O A;  3PXT D;  5HE3 B;  5CXB B;  3ULE C;  4JSX C;  4Y5R D;  3BWS A;  2GC7 A;  4J8B A;  1L0Q A;  3UVM A;  3RSE C;  4GM3 A;  2I3T A;  3UR4 A;  4K3I D;  3OL2 B;  3OKT A;  4K3J B;  2B5N A;  2QC5 A;  2IWK A;  3OTT A;  2UZY B;  2W18 A;  5FKT A;  4GQ1 A;  3EI2 A;  3C99 A;  4JSV C;  2H9M A;  3I7O A;  4ERY A;  2I0R A;  2AGY A;  3OW8 A;  3JB9 L;  4A7J A;  4O1Q D;  1JJU B;  3UKR C;  2PM9 A;  2HXC A;  3CFV A;  3NVN A;  5FXY A;  2XYI A;  3GRE A;  3JRP A;  3I7P A;  4A08 A;  4PBY A;  4A11 A;  5EM2 A;  4JSP C;  3AL8 A;  2HKR A;  4L3H D;  2J56 H;  4YVD A;  5GXI A;  5GSA A;  2IUV A;  2J57 G;  2H68 A;  2I0S A;  3MKS B;  4A0B A;  3IJ1 A;  2AGZ A;  2H13 A;  3UVO A;  4ZOV A;  4JT6 C;  2OVQ B;  3P4F A;  5HE1 B;  4KFM B;  5IT9 g;  4CI1 A;  5AFU 3;  5C2W B;  2IAA A;  1ERJ A;  3OKY B;  3AH8 B;  3VGZ A;  4J73 A;  4E5Z B;  5TDH B;  2HYE A;  4ZOX A;  5EAR A;  4GQ2 P;  4O3U B;  2TRC B;  3EG6 A;  5CXB A;  3I7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...