4J8BA

Crystal structure of alpha-cop/emp47p complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
327
structure length
298
Chain Sequence
MAMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIAFHPTQPIFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRADAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRANDRFWFITVHPKLNLFAAAHDSGVMVFKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords coatomer alpha subunit
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
total genus 75
structure length 298
sequence length 327
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j8bA00
2PM9B 2YNPA 2CN3A 5EMJB 2TRCB 5IGQA 3DWLC 2IUVA 5GXIA 2IURA 2H68A 4L9OA 3IIWA 3KRWB 2AGZA 5GXHA 3A0FA 4PXWA 3VA6A 2H14A 3UVLA 5EMMB 5CYKB 3UVNA 4BUJC 5CXBB 1GG2B 4EWRA 3GREA 4OZUA 4TZ4A 3IKOA 3CIKB 5FKTA 4R7AB 3I7NA 3SCYA 1PI6A 3I2NA 1U4CA 3SBPA 3NVNA 5HE0B 3J80g 2AGXA 4J87A 3P4FA 4FA4D 4GZ8A 3I7KA 2J55H 4J78A 2AGLA 5CXCA 4A0AB 5HE1B 5A2Qg 2PBIB 4QQEA 5IJ7E 4OWRA 5B4WA 2H3XA 4GM8A 3EI4B 4JSXC 2OK4A 2YB8B 3MZKA 4G56B 3SFZA 4A09B 2Z2OA 2H9NA 2H6KA 2H6NA 1B9XA 3EG6A 3OTTA 4Y5RD 1B9YA 3V7DB 3SLED 3I7LA 4CZVA 5AMSA 2HJ4A 3JZHA 1K8KC 3OKWA 3PXWD 5H14A 4O45A 4CZYA 4ZOYA 3EMHA 2CE8A 2OVQB 4ERQA 3JROA 4JSNC 5K1CC 2CNXA 3K26A 2B5LA 4N14A 3SXTD 2UZYB 3UKUC 1SHYB 4A11A 5AFU3 5EAPA 2H6QA 1NR0A 2CN2A 3OKYA 5EARA 2HKMA 1MG3A 3SMRA 1S4UX 3AFCA 2B4EA 3AL8A 4JD2C 3L4OD 3FGBA 4L3GD 3ZWLB 3EI3A 4GMBA 2IUQA 2W18A 3CFVA 5HYNB 1JJUB 5IGOA 3AL9A 2GNQA 2XYIA 4Z8LA 3OKTA 3PSCB 3UVMA 4CI3A 5I5JA 5HE3B 4FB1D 4JXMA 3RLMD 3RFGA 3RSEC 2IAAA 2Z2NA 4IMMA 4J73A 4A0BB 5JWZA 2IUPA 3ODTA 3PVWB 1JMZB 5FKSA 2I0SA 2PM9A 1A0RB 3DM0A 1XKSA 4J0XA 4XEIC 2EBSA 3E0CA 1OMWB 2J56H 3F3GA 4GM3A 3UR4A 3B7FA 3VGZA 2AGYA 3UKRC 2B5MA 2P9LC 4J79A 4FAND 5CXBA 4J81A 5EMKB 4AOWA 3MMYA 3KRXB 3VH0A 1MDAH 2AH1A 3EI1A 3PXTD 4LGNA 4ZOZA 5I5MA 4ERZA 3UVKA 3JB9L 3EWEA 1TYQC 3JZNA 4O9DA 3DSMA 3I7PA 2I0TA 4YVDA 3JRPA 4H5IA 2CE9A 3OL2A 4J8BA 4PBZA 3RFHA 3OW8A 4NSXA 4ZOVA 2AGWA 2HJBA 4A0AA 3L4MD 3SWSD 2G9AA 3DXKC 1GXRA 1JMXB 5CXCB 5FLXg 2XL2A 3NVQA 4J84A 1RI6A 4A09A 3EI2B 4JT5C 4HDJA 2UZXB 3BWSA 2BCJB 2HKRA 1K32A 2CO0A 3RN1D 4E54B 2OIZA 3PSLA 4GQ1A 2HXCA 4X63B 3FM0A 1SQJA 1NEXB 4CZXA 5C9ZB 2AQ5A 4IA9A 4GGCA 2MTAH 4GGAA 5K19A 2PM7B 3U4YA 3GFCA 4A2LA 3I7HA 3JZGA 5IT9g 2P9NC 5HE2B 5EALA 3SJLD 4JT6C 2XL3A 2H9LA 1TBGA 2Q7QA 1YFQA 4E5ZA 4PSWB 4QT8A 4XYHA 4QRJA 2I3SA 4FA9D 2H47A 5EM2B 2HYEA 1GP2B 3I8EA 5AJAA 3F3FA 4K3ID 4O3UB 4K3JB 2P9KC 3CFSB 4MK0B 1VYHC 2I0RA 3I7OA 5FXYA 2OJYA 2B5NA 2H9PA 3IJ0A 4FWWA 4O3TB 3NVXA 2P9IC 5SXMA 4AEZA 3EI3B 5TEEA 3I89A 2Z2PA 3C5MA 1U2VC 3IJCA 3MZLA 4X3EA 2QC5A 3W15A 5HQGA 4GGDA 3UVOA 5KDOB 3IJ1A 3K27A 2H13A 4BH6A 4A08B 1P22A 3DXMC 4ZOXA 4GQBB 4A0BA 3V9FA 4J8GA 3ORVD 4FHLA 1PBYB 5THAA 4A7JA 4CI8A 2YMUA 3SN6B 2AH0A 3I8CA 4O1QD 5EAMA 4ERYA 1XIPA 2YNNA 3SBRA 4X60B 4CY3A 5CYKA 4PNKB 4LG8A 2CO0C 3ULEC 4CY2A 3C75H 2GC7A 2OVRB 3AH8B 1N6DA 4FAVD 1FWXA 3RN0D 3IIYA 3PXSD 3N0EA 4CY5A 4J77A 2J57G 3J81g 5FKQA 1SQ9A 2YNOA 4Y7RA 2O9KA 4ESGA 4CC9A 4L3HD 5H1MA 2G99A 3EI1B 5GMKn 5GSAA 2I3TA 4FA1D 2P9SC 1L0QA 4QL1A 3RMZD 5FKRA 3EI4A 4JSVC 3OL2B 4D6VA 3C99A 4PC0A 3V5WB 1Q47A 4ES0A 5TF2A 4L1QD 5I5IA 1R5MA 3EI2A 3C9CA 3F3PA 4E54A 5IJ8E 1N6FA 1ERJA 5H17A 2BBKH 2OVPB 3BG1A 4X61B 1QNIA 1N6EA 4JSPC 2IWKA 3HFQA 1XHMA 2XU7A 3SHFA 2QXVA 4LG9A 4A2MA 4XYIA 4GQ2P 5TDHB 4J86A 4H5JA 4GM9A 5FA5B 5FQDA 1PEVA 4PSXB 2H9MA 3SVWD 2IWFA 5IC7A 4A11B 3OKYB 3BG0A 5EM2A 5EMLB 2OK6A 4ZN4A 4E5ZB 2GC4A 4KFMB 3MKSB 3AL8B 1OLZA 4CI2A 4FA5D 4U7AA 2P9PC 2YBAA 3MXXA 2P9UC 2PM6B 4I79A 3PVUB 5C2VB 3JPXA 3SBQA 4U1EI 3RRMC 4D0KA 3JAMg 4PBYA 4BL0A 4CY1A 5C2WB 3N0DA 1PGUA 2HESX 1GOTB 3EU7A 4J0WA 1MG2A 4A08A 4J82A 4UI9R 5TEFA 3MKQA 4CI1A 1JOFA 3PE7A 3FRXA
chains in the Genus database with same CATH superfamily
2PM9B 2YNPA 2CN3A 5EMJB 2TRCB 5IGQA 1H2WA 3DWLC 2IUVA 5GXIA 2IURA 3VI4A 2H68A 4L9OA 2JKXA 3IIWA 3KRWB 2XE4A 2AGZA 5GXHA 3A0FA 4PXWA 3VA6A 2H14A 3UVLA 5EMMB 2QZPA 5CYKB 3UVNA 4BUJC 5CXBB 1GG2B 1VE6A 4EWRA 3GREA 4OZUA 4TZ4A 3IKOA 3QHYB 3CIKB 5FKTA 4R7AB 4JHPC 3I7NA 3SCYA 1PI6A 3EQ7A 3I2NA 1U4CA 3SBPA 3NVNA 4MMZA 5HE0B 3J80g 2AGXA 2VDMA 4J87A 3NIDA 3P4FA 4FA4D 3K72A 4GZ8A 3I7KA 1O6GA 3FCUA 5M5VA 2VDRA 2J55H 4J78A 2VDOA 3VI3A 4UM9A 4NENA 2AGLA 2HU7A 5CXCA 4A0AB 4G1MA 5HE1B 5A2Qg 2PBIB 4QQEA 3MUNA 5IJ7E 4OWRA 5B4WA 2H3XA 4GM8A 3EI4B 4JSXC 2OK4A 2YB8B 3MZKA 4G56B 3SFZA 4A09B 2Z2OA 3IJEA 2H9NA 4RE6A 2H6KA 2H6NA 1B9XA 3EG6A 3OTTA 4Y5RD 4UM8A 1B9YA 3V7DB 3SLED 3I7LA 4CZVA 5AMSA 2HJ4A 3JZHA 1K8KC 3OKWA 3PXWD 5H14A 4O45A 4DNWA 4CZYA 4ZOYA 3EMHA 2CE8A 2VZ3A 3IURA 2OVQB 4ERQA 1JTDB 3JROA 4Z7QA 4JSNC 5K1CC 2CNXA 3K26A 2B5LA 4N14A 3SXTD 2UZYB 3UKUC 1SHYB 4A11A 5AFU3 5EAPA 2H6QA 1NR0A 2CN2A 3OKYA 5EARA 2HKMA 1MG3A 3SMRA 1S4UX 3AFCA 2B4EA 3T3PA 3AL8A 4JD2C 3L4OD 3IULA 3FGBA 5C86A 4L3GD 3ZWLB 3EI3A 4GMBA 2VDPA 1H2YA 2IUQA 2W18A 3CFVA 2VDNA 3O4GA 3V4VA 5HYNB 1JJUB 1VE7A 5IGOA 4WK0A 3AL9A 2GNQA 2XYIA 4Z8LA 3OKTA 3IUNA 5C92A 3IUMA 2XZGA 3PSCB 3UVMA 4CI3A 3QI0A 5I5JA 5HE3B 4FB1D 1UTCA 4JXMA 3RLMD 3RFGA 3RSEC 2IAAA 2Z2NA 4IMMA 3ZE1A 4J73A 4A0BB 5JWZA 2IUPA 3ZDZA 5FFOA 4Z7NA 3ODTA 3PVWB 1JMZB 2WQ8A 5FKSA 2I0SA 2PM9A 1O6FA 1A0RB 3DM0A 4AMZA 1XKSA 4J0XA 4XEIC 2EBSA 3E0CA 1OMWB 2J56H 3F3GA 4GM3A 4MMXA 4WK2A 3UR4A 1UOPA 3B7FA 3VGZA 2AGYA 1U8CA 3UKRC 2B5MA 2P9LC 4J79A 4FAND 1A12A 5CXBA 4J81A 4WK4A 5EMKB 4AOWA 3MMYA 3EQ9A 3KRXB 3VH0A 3T3MA 4NC4A 1MDAH 2AH1A 2HU5A 3EI1A 3PXTD 4LGNA 3MUOA 4ZOZA 5I5MA 4ERZA 3UVKA 2VDQA 4AN1A 3EWEA 3JB9L 1TYQC 3JZNA 4O9DA 3DSMA 3I7PA 2I0TA 4YVDA 3JRPA 4H5IA 2CE9A 3OL2A 4J8BA 4PBZA 3RFHA 3OW8A 4NSXA 4ZOVA 2AGWA 2HJBA 4A0AA 3ZE2A 3L4MD 3OF7A 2G9AA 3DXKC 3SWSD 3NIGA 1GXRA 1JMXB 5CXCB 3ZDXA 5FLXg 2XL2A 3NVQA 4J84A 1RI6A 4A09A 3EI2B 5E6UA 4JT5C 4HDJA 4L1MA 2UZXB 3BWSA 2BCJB 2HKRA 1K32A 2CO0A 5M61A 3RN1D 4E54B 2OIZA 3PSLA 4GQ1A 2HXCA 4X63B 3FM0A 1SQJA 1NEXB 1GOGA 4CZXA 5C9ZB 2AQ5A 3IUQA 4IA9A 4GGCA 2MTAH 4GGAA 5K19A 4BCDA 2PM7B 3U4YA 3EQ8A 3GFCA 4A2LA 3I7HA 1E5TA 3JZGA 5IT9g 2P9NC 5HE2B 5EALA 4NBMA 3SJLD 4JT6C 3O4HA 2XL3A 2H9LA 1TBGA 2Q7QA 1YFQA 4E5ZA 4PSWB 4QT8A 4XYHA 4QRJA 2I3SA 4FA9D 2EICA 2H47A 2EIEA 5EM2B 2HYEA 4G1EA 4O02A 1GP2B 3I8EA 5AJAA 1BPOA 3F3FA 1H2ZA 4K3ID 4K3JB 2P9KC 3CFSB 4O3UB 4MK0B 1VYHC 2I0RA 3I7OA 1UOOA 5FXYA 2OJYA 3O4IA 2B5NA 2H9PA 2BKLA 3IJ0A 4FWWA 4O3TB 3NVXA 2P9IC 5SXMA 2EIDA 4AEZA 3EI3B 5TEEA 1QFSA 1YR2A 4G55A 3I89A 2Z2PA 3C5MA 1U2VC 3DDUA 3IJCA 3MZLA 5E6SA 4X3EA 2QC5A 3W15A 5HQGA 4GGDA 3UVOA 5KDOB 3IJ1A 1E8NA 2H13A 3K27A 4BH6A 4A08B 1P22A 5M5RA 3DXMC 4ZOXA 4GQBB 2VZ1A 4A0BA 3V9FA 4J8GA 3ORVD 4FHLA 1PBYB 5THAA 4A7JA 4CI8A 2YMUA 3GC3B 3SN6B 2AH0A 3I8CA 4O1QD 4DNUA 1L5GA 5EAMA 4ERYA 1XIPA 2YNNA 4O2WA 1VZ2A 3SBRA 1M1XA 4Z7OA 4X60B 4CY3A 5CYKA 4PNKB 4RE5A 4LG8A 2CO0C 3GD1I 3ULEC 4CY2A 3C75H 1E8MA 2GC7A 2OVRB 3AH8B 3K71A 1N6DA 4FAVD 1FWXA 3RN0D 3IIYA 3PXSD 3KCIA 3N0EA 4CY5A 5FFGA 4J77A 2J57G 3J81g 5FKQA 3O4JA 1SQ9A 2QR5A 2YNOA 4Y7RA 2O9KA 3ZE0A 3IUJA 4ESGA 4CC9A 4BCCA 1GOHA 4L3HD 5H1MA 2G99A 3EI1B 5GMKn 5GSAA 2I3TA 4AMYA 2VDKA 3IVMA 4FA1D 2P9SC 1L0QA 4QL1A 3RMZD 1UOQA 5FKRA 3EI4A 4JHNA 4JSVC 1C9LA 5M5UA 3OL2B 1TYEA 2HU8A 4D6VA 3C99A 4PC0A 3V5WB 1Q47A 4ES0A 5TF2A 4L1QD 5I5IA 1R5MA 3EI2A 4WJKA 1GOFA 3C9CA 4BP8A 3F3PA 4E54A 5IJ8E 1N6FA 1ERJA 5H17A 4AX4A 2BBKH 2OVPB 4MMYA 3BG1A 4X61B 1QNIA 4D9SA 1N6EA 4JSPC 2IWKA 3HFQA 1XHMA 1H2XA 3K6SA 2XU7A 2XDWA 3SHFA 2VDLA 2QXVA 4LG9A 4A2MA 4XYIA 4GQ2P 5TDHB 5M5TA 4J86A 4H5JA 4GM9A 5FA5B 5FQDA 1K3IA 1PEVA 4AN0A 4PSXB 2H9MA 3SVWD 2IWFA 5IC7A 4A11B 1VZ3A 4QAMA 3OKYB 3BG0A 5EM2A 5EMLB 2OK6A 4BP9A 4ZN4A 2GC4A 3NIFA 4E5ZB 1T2XA 4KFMB 4NAAA 3MKSB 5HDBA 5M5SA 3AL8B 1OLZA 4CI2A 4FA5D 4U7AA 2P9PC 4DNVA 2YBAA 3MXXA 1C9IA 3FCSA 3MVDK 2EIBA 2P9UC 2PM6B 4I79A 3PVUB 5C2VB 3JPXA 3SBQA 4U1EI 4BCBA 3RRMC 4D0KA 3JAMg 4PBYA 3V4PA 4BL0A 4CY1A 5C2WB 1QFMA 3N0DA 1PGUA 3ZDYA 2HESX 1GOTB 3EU7A 4J0WA 1MG2A 2VC2A 4IRZA 5E6RA 4A08A 4J82A 4UI9R 5TEFA 3MKQA 4CI1A 1I2MB 1JOFA 3PE7A 3FRXA 1JV2A
chains in the Genus database with same CATH topology
2PM9B 2YNPA 2CN3A 5EMJB 2TRCB 5IGQA 3DWLC 2IUVA 5GXIA 2IURA 2H68A 4L9OA 3IIWA 3KRWB 2AGZA 5GXHA 3A0FA 4PXWA 3VA6A 2H14A 3UVLA 5EMMB 5CYKB 3UVNA 4BUJC 5CXBB 1GG2B 4EWRA 3GREA 4OZUA 4TZ4A 3IKOA 3CIKB 5FKTA 4R7AB 3I7NA 3SCYA 1PI6A 3I2NA 1U4CA 3SBPA 3NVNA 5HE0B 3J80g 2AGXA 4J87A 3P4FA 4FA4D 4GZ8A 3I7KA 2J55H 4J78A 2AGLA 5CXCA 4A0AB 5HE1B 5A2Qg 2PBIB 4QQEA 5IJ7E 4OWRA 5B4WA 2H3XA 4GM8A 3EI4B 4JSXC 2OK4A 2YB8B 3MZKA 4G56B 3SFZA 4A09B 2Z2OA 2H9NA 2H6KA 2H6NA 1B9XA 3EG6A 3OTTA 4Y5RD 1B9YA 3V7DB 3SLED 3I7LA 4CZVA 5AMSA 2HJ4A 3JZHA 1K8KC 3OKWA 3PXWD 5H14A 4O45A 4CZYA 4ZOYA 3EMHA 2CE8A 2OVQB 4ERQA 3JROA 4JSNC 5K1CC 2CNXA 3K26A 2B5LA 4N14A 3SXTD 2UZYB 3UKUC 1SHYB 4A11A 5AFU3 5EAPA 2H6QA 1NR0A 2CN2A 3OKYA 5EARA 2HKMA 1MG3A 3SMRA 1S4UX 3AFCA 2B4EA 3AL8A 4JD2C 3L4OD 3FGBA 4L3GD 3ZWLB 3EI3A 4GMBA 2IUQA 2W18A 3CFVA 5HYNB 1JJUB 5IGOA 3AL9A 2GNQA 2XYIA 4Z8LA 3OKTA 3PSCB 3UVMA 4CI3A 5I5JA 5HE3B 4FB1D 4JXMA 3RLMD 3RFGA 3RSEC 2IAAA 2Z2NA 4IMMA 4J73A 4A0BB 5JWZA 2IUPA 3ODTA 3PVWB 1JMZB 5FKSA 2I0SA 2PM9A 1A0RB 3DM0A 1XKSA 4J0XA 4XEIC 2EBSA 3E0CA 1OMWB 2J56H 3F3GA 4GM3A 3UR4A 3B7FA 3VGZA 2AGYA 3UKRC 2B5MA 2P9LC 4J79A 4FAND 5CXBA 4J81A 5EMKB 4AOWA 3MMYA 3KRXB 3VH0A 1MDAH 2AH1A 3EI1A 3PXTD 4LGNA 4ZOZA 5I5MA 4ERZA 3UVKA 3JB9L 3EWEA 1TYQC 3JZNA 4O9DA 3DSMA 3I7PA 2I0TA 4YVDA 3JRPA 4H5IA 2CE9A 3OL2A 4J8BA 4PBZA 3RFHA 3OW8A 4NSXA 4ZOVA 2AGWA 2HJBA 4A0AA 3L4MD 3SWSD 2G9AA 3DXKC 1GXRA 1JMXB 5CXCB 5FLXg 2XL2A 3NVQA 4J84A 1RI6A 4A09A 3EI2B 4JT5C 4HDJA 2UZXB 3BWSA 2BCJB 2HKRA 1K32A 2CO0A 3RN1D 4E54B 2OIZA 3PSLA 4GQ1A 2HXCA 4X63B 3FM0A 1SQJA 1NEXB 4CZXA 5C9ZB 2AQ5A 4IA9A 4GGCA 2MTAH 4GGAA 5K19A 2PM7B 3U4YA 3GFCA 4A2LA 3I7HA 3JZGA 5IT9g 2P9NC 5HE2B 5EALA 3SJLD 4JT6C 2XL3A 2H9LA 1TBGA 2Q7QA 1YFQA 4E5ZA 4PSWB 4QT8A 4XYHA 4QRJA 2I3SA 4FA9D 2H47A 5EM2B 2HYEA 1GP2B 3I8EA 5AJAA 3F3FA 4K3ID 4O3UB 4K3JB 2P9KC 3CFSB 4MK0B 1VYHC 2I0RA 3I7OA 5FXYA 2OJYA 2B5NA 2H9PA 3IJ0A 4FWWA 4O3TB 3NVXA 2P9IC 5SXMA 4AEZA 3EI3B 5TEEA 3I89A 2Z2PA 3C5MA 1U2VC 3IJCA 3MZLA 4X3EA 2QC5A 3W15A 5HQGA 4GGDA 3UVOA 5KDOB 3IJ1A 3K27A 2H13A 4BH6A 4A08B 1P22A 3DXMC 4ZOXA 4GQBB 4A0BA 3V9FA 4J8GA 3ORVD 4FHLA 1PBYB 5THAA 4A7JA 4CI8A 2YMUA 3SN6B 2AH0A 3I8CA 4O1QD 5EAMA 4ERYA 1XIPA 2YNNA 3SBRA 4X60B 4CY3A 5CYKA 4PNKB 4LG8A 2CO0C 3ULEC 4CY2A 3C75H 2GC7A 2OVRB 3AH8B 1N6DA 4FAVD 1FWXA 3RN0D 3IIYA 3PXSD 3N0EA 4CY5A 4J77A 2J57G 3J81g 5FKQA 1SQ9A 2YNOA 4Y7RA 2O9KA 4ESGA 4CC9A 4L3HD 5H1MA 2G99A 3EI1B 5GMKn 5GSAA 2I3TA 4FA1D 2P9SC 1L0QA 4QL1A 3RMZD 5FKRA 3EI4A 4JSVC 3OL2B 4D6VA 3C99A 4PC0A 3V5WB 1Q47A 4ES0A 5TF2A 4L1QD 5I5IA 1R5MA 3EI2A 3C9CA 3F3PA 4E54A 5IJ8E 1N6FA 1ERJA 5H17A 2BBKH 2OVPB 3BG1A 4X61B 1QNIA 1N6EA 4JSPC 2IWKA 3HFQA 1XHMA 2XU7A 3SHFA 2QXVA 4LG9A 4A2MA 4XYIA 4GQ2P 5TDHB 4J86A 4H5JA 4GM9A 5FA5B 5FQDA 1PEVA 4PSXB 2H9MA 3SVWD 2IWFA 5IC7A 4A11B 3OKYB 3BG0A 5EM2A 5EMLB 2OK6A 4ZN4A 4E5ZB 2GC4A 4KFMB 3MKSB 3AL8B 1OLZA 4CI2A 4FA5D 4U7AA 2P9PC 2YBAA 3MXXA 2P9UC 2PM6B 4I79A 3PVUB 5C2VB 3JPXA 3SBQA 4U1EI 3RRMC 4D0KA 3JAMg 4PBYA 4BL0A 4CY1A 5C2WB 3N0DA 1PGUA 2HESX 1GOTB 3EU7A 4J0WA 1MG2A 4A08A 4J82A 4UI9R 5TEFA 3MKQA 4CI1A 1JOFA 3PE7A 3FRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PM9 B;  2YNP A;  2CN3 A;  5EMJ B;  2TRC B;  5IGQ A;  3DWL C;  2IUV A;  5GXI A;  2IUR A;  2H68 A;  4L9O A;  3IIW A;  3KRW B;  2AGZ A;  5GXH A;  3A0F A;  4PXW A;  3VA6 A;  2H14 A;  3UVL A;  5EMM B;  5CYK B;  3UVN A;  4BUJ C;  5CXB B;  1GG2 B;  4EWR A;  3GRE A;  4OZU A;  4TZ4 A;  3IKO A;  3CIK B;  5FKT A;  4R7A B;  3I7N A;  3SCY A;  1PI6 A;  3I2N A;  1U4C A;  3SBP A;  3NVN A;  5HE0 B;  3J80 g;  2AGX A;  4J87 A;  3P4F A;  4FA4 D;  4GZ8 A;  3I7K A;  2J55 H;  4J78 A;  2AGL A;  5CXC A;  4A0A B;  5HE1 B;  5A2Q g;  2PBI B;  4QQE A;  5IJ7 E;  4OWR A;  5B4W A;  2H3X A;  4GM8 A;  3EI4 B;  4JSX C;  2OK4 A;  2YB8 B;  3MZK A;  4G56 B;  3SFZ A;  4A09 B;  2Z2O A;  2H9N A;  2H6K A;  2H6N A;  1B9X A;  3EG6 A;  3OTT A;  4Y5R D;  1B9Y A;  3V7D B;  3SLE D;  3I7L A;  4CZV A;  5AMS A;  2HJ4 A;  3JZH A;  1K8K C;  3OKW A;  3PXW D;  5H14 A;  4O45 A;  4CZY A;  4ZOY A;  3EMH A;  2CE8 A;  2OVQ B;  4ERQ A;  3JRO A;  4JSN C;  5K1C C;  2CNX A;  3K26 A;  2B5L A;  4N14 A;  3SXT D;  2UZY B;  3UKU C;  1SHY B;  4A11 A;  5AFU 3;  5EAP A;  2H6Q A;  1NR0 A;  2CN2 A;  3OKY A;  5EAR A;  2HKM A;  1MG3 A;  3SMR A;  1S4U X;  3AFC A;  2B4E A;  3AL8 A;  4JD2 C;  3L4O D;  3FGB A;  4L3G D;  3ZWL B;  3EI3 A;  4GMB A;  2IUQ A;  2W18 A;  3CFV A;  5HYN B;  1JJU B;  5IGO A;  3AL9 A;  2GNQ A;  2XYI A;  4Z8L A;  3OKT A;  3PSC B;  3UVM A;  4CI3 A;  5I5J A;  5HE3 B;  4FB1 D;  4JXM A;  3RLM D;  3RFG A;  3RSE C;  2IAA A;  2Z2N A;  4IMM A;  4J73 A;  4A0B B;  5JWZ A;  2IUP A;  3ODT A;  3PVW B;  1JMZ B;  5FKS A;  2I0S A;  2PM9 A;  1A0R B;  3DM0 A;  1XKS A;  4J0X A;  4XEI C;  2EBS A;  3E0C A;  1OMW B;  2J56 H;  3F3G A;  4GM3 A;  3UR4 A;  3B7F A;  3VGZ A;  2AGY A;  3UKR C;  2B5M A;  2P9L C;  4J79 A;  4FAN D;  5CXB A;  4J81 A;  5EMK B;  4AOW A;  3MMY A;  3KRX B;  3VH0 A;  1MDA H;  2AH1 A;  3EI1 A;  3PXT D;  4LGN A;  4ZOZ A;  5I5M A;  4ERZ A;  3UVK A;  3JB9 L;  3EWE A;  1TYQ C;  3JZN A;  4O9D A;  3DSM A;  3I7P A;  2I0T A;  4YVD A;  3JRP A;  4H5I A;  2CE9 A;  3OL2 A;  4J8B A;  4PBZ A;  3RFH A;  3OW8 A;  4NSX A;  4ZOV A;  2AGW A;  2HJB A;  4A0A A;  3L4M D;  3SWS D;  2G9A A;  3DXK C;  1GXR A;  1JMX B;  5CXC B;  5FLX g;  2XL2 A;  3NVQ A;  4J84 A;  1RI6 A;  4A09 A;  3EI2 B;  4JT5 C;  4HDJ A;  2UZX B;  3BWS A;  2BCJ B;  2HKR A;  1K32 A;  2CO0 A;  3RN1 D;  4E54 B;  2OIZ A;  3PSL A;  4GQ1 A;  2HXC A;  4X63 B;  3FM0 A;  1SQJ A;  1NEX B;  4CZX A;  5C9Z B;  2AQ5 A;  4IA9 A;  4GGC A;  2MTA H;  4GGA A;  5K19 A;  2PM7 B;  3U4Y A;  3GFC A;  4A2L A;  3I7H A;  3JZG A;  5IT9 g;  2P9N C;  5HE2 B;  5EAL A;  3SJL D;  4JT6 C;  2XL3 A;  2H9L A;  1TBG A;  2Q7Q A;  1YFQ A;  4E5Z A;  4PSW B;  4QT8 A;  4XYH A;  4QRJ A;  2I3S A;  4FA9 D;  2H47 A;  5EM2 B;  2HYE A;  1GP2 B;  3I8E A;  5AJA A;  3F3F A;  4K3I D;  4O3U B;  4K3J B;  2P9K C;  3CFS B;  4MK0 B;  1VYH C;  2I0R A;  3I7O A;  5FXY A;  2OJY A;  2B5N A;  2H9P A;  3IJ0 A;  4FWW A;  4O3T B;  3NVX A;  2P9I C;  5SXM A;  4AEZ A;  3EI3 B;  5TEE A;  3I89 A;  2Z2P A;  3C5M A;  1U2V C;  3IJC A;  3MZL A;  4X3E A;  2QC5 A;  3W15 A;  5HQG A;  4GGD A;  3UVO A;  5KDO B;  3IJ1 A;  3K27 A;  2H13 A;  4BH6 A;  4A08 B;  1P22 A;  3DXM C;  4ZOX A;  4GQB B;  4A0B A;  3V9F A;  4J8G A;  3ORV D;  4FHL A;  1PBY B;  5THA A;  4A7J A;  4CI8 A;  2YMU A;  3SN6 B;  2AH0 A;  3I8C A;  4O1Q D;  5EAM A;  4ERY A;  1XIP A;  2YNN A;  3SBR A;  4X60 B;  4CY3 A;  5CYK A;  4PNK B;  4LG8 A;  2CO0 C;  3ULE C;  4CY2 A;  3C75 H;  2GC7 A;  2OVR B;  3AH8 B;  1N6D A;  4FAV D;  1FWX A;  3RN0 D;  3IIY A;  3PXS D;  3N0E A;  4CY5 A;  4J77 A;  2J57 G;  3J81 g;  5FKQ A;  1SQ9 A;  2YNO A;  4Y7R A;  2O9K A;  4ESG A;  4CC9 A;  4L3H D;  5H1M A;  2G99 A;  3EI1 B;  5GMK n;  5GSA A;  2I3T A;  4FA1 D;  2P9S C;  1L0Q A;  4QL1 A;  3RMZ D;  5FKR A;  3EI4 A;  4JSV C;  3OL2 B;  4D6V A;  3C99 A;  4PC0 A;  3V5W B;  1Q47 A;  4ES0 A;  5TF2 A;  4L1Q D;  5I5I A;  1R5M A;  3EI2 A;  3C9C A;  3F3P A;  4E54 A;  5IJ8 E;  1N6F A;  1ERJ A;  5H17 A;  2BBK H;  2OVP B;  3BG1 A;  4X61 B;  1QNI A;  1N6E A;  4JSP C;  2IWK A;  3HFQ A;  1XHM A;  2XU7 A;  3SHF A;  2QXV A;  4LG9 A;  4A2M A;  4XYI A;  4GQ2 P;  5TDH B;  4J86 A;  4H5J A;  4GM9 A;  5FA5 B;  5FQD A;  1PEV A;  4PSX B;  2H9M A;  3SVW D;  2IWF A;  5IC7 A;  4A11 B;  3OKY B;  3BG0 A;  5EM2 A;  5EML B;  2OK6 A;  4ZN4 A;  4E5Z B;  2GC4 A;  4KFM B;  3MKS B;  3AL8 B;  1OLZ A;  4CI2 A;  4FA5 D;  4U7A A;  2P9P C;  2YBA A;  3MXX A;  2P9U C;  2PM6 B;  4I79 A;  3PVU B;  5C2V B;  3JPX A;  3SBQ A;  4U1E I;  3RRM C;  4D0K A;  3JAM g;  4PBY A;  4BL0 A;  4CY1 A;  5C2W B;  3N0D A;  1PGU A;  2HES X;  1GOT B;  3EU7 A;  4J0W A;  1MG2 A;  4A08 A;  4J82 A;  4UI9 R;  5TEF A;  3MKQ A;  4CI1 A;  1JOF A;  3PE7 A;  3FRX A; 
#chains in the Genus database with same CATH topology
 2PM9 B;  2YNP A;  2CN3 A;  5EMJ B;  2TRC B;  5IGQ A;  1H2W A;  3DWL C;  2IUV A;  5GXI A;  2IUR A;  3VI4 A;  2H68 A;  4L9O A;  2JKX A;  3IIW A;  3KRW B;  2XE4 A;  2AGZ A;  5GXH A;  3A0F A;  4PXW A;  3VA6 A;  2H14 A;  3UVL A;  5EMM B;  2QZP A;  5CYK B;  3UVN A;  4BUJ C;  5CXB B;  1GG2 B;  1VE6 A;  4EWR A;  3GRE A;  4OZU A;  4TZ4 A;  3IKO A;  3QHY B;  3CIK B;  5FKT A;  4R7A B;  4JHP C;  3I7N A;  3SCY A;  1PI6 A;  3EQ7 A;  3I2N A;  1U4C A;  3SBP A;  3NVN A;  4MMZ A;  5HE0 B;  3J80 g;  2AGX A;  2VDM A;  4J87 A;  3NID A;  3P4F A;  4FA4 D;  3K72 A;  4GZ8 A;  3I7K A;  1O6G A;  3FCU A;  5M5V A;  2VDR A;  2J55 H;  4J78 A;  2VDO A;  3VI3 A;  4UM9 A;  4NEN A;  2AGL A;  2HU7 A;  5CXC A;  4A0A B;  4G1M A;  5HE1 B;  5A2Q g;  2PBI B;  4QQE A;  3MUN A;  5IJ7 E;  4OWR A;  5B4W A;  2H3X A;  4GM8 A;  3EI4 B;  4JSX C;  2OK4 A;  2YB8 B;  3MZK A;  4G56 B;  3SFZ A;  4A09 B;  2Z2O A;  3IJE A;  2H9N A;  4RE6 A;  2H6K A;  2H6N A;  1B9X A;  3EG6 A;  3OTT A;  4Y5R D;  4UM8 A;  1B9Y A;  3V7D B;  3SLE D;  3I7L A;  4CZV A;  5AMS A;  2HJ4 A;  3JZH A;  1K8K C;  3OKW A;  3PXW D;  5H14 A;  4O45 A;  4DNW A;  4CZY A;  4ZOY A;  3EMH A;  2CE8 A;  2VZ3 A;  3IUR A;  2OVQ B;  4ERQ A;  1JTD B;  3JRO A;  4Z7Q A;  4JSN C;  5K1C C;  2CNX A;  3K26 A;  2B5L A;  4N14 A;  3SXT D;  2UZY B;  3UKU C;  1SHY B;  4A11 A;  5AFU 3;  5EAP A;  2H6Q A;  1NR0 A;  2CN2 A;  3OKY A;  5EAR A;  2HKM A;  1MG3 A;  3SMR A;  1S4U X;  3AFC A;  2B4E A;  3T3P A;  3AL8 A;  4JD2 C;  3L4O D;  3IUL A;  3FGB A;  5C86 A;  4L3G D;  3ZWL B;  3EI3 A;  4GMB A;  2VDP A;  1H2Y A;  2IUQ A;  2W18 A;  3CFV A;  2VDN A;  3O4G A;  3V4V A;  5HYN B;  1JJU B;  1VE7 A;  5IGO A;  4WK0 A;  3AL9 A;  2GNQ A;  2XYI A;  4Z8L A;  3OKT A;  3IUN A;  5C92 A;  3IUM A;  2XZG A;  3PSC B;  3UVM A;  4CI3 A;  3QI0 A;  5I5J A;  5HE3 B;  4FB1 D;  1UTC A;  4JXM A;  3RLM D;  3RFG A;  3RSE C;  2IAA A;  2Z2N A;  4IMM A;  3ZE1 A;  4J73 A;  4A0B B;  5JWZ A;  2IUP A;  3ZDZ A;  5FFO A;  4Z7N A;  3ODT A;  3PVW B;  1JMZ B;  2WQ8 A;  5FKS A;  2I0S A;  2PM9 A;  1O6F A;  1A0R B;  3DM0 A;  4AMZ A;  1XKS A;  4J0X A;  4XEI C;  2EBS A;  3E0C A;  1OMW B;  2J56 H;  3F3G A;  4GM3 A;  4MMX A;  4WK2 A;  3UR4 A;  1UOP A;  3B7F A;  3VGZ A;  2AGY A;  1U8C A;  3UKR C;  2B5M A;  2P9L C;  4J79 A;  4FAN D;  1A12 A;  5CXB A;  4J81 A;  4WK4 A;  5EMK B;  4AOW A;  3MMY A;  3EQ9 A;  3KRX B;  3VH0 A;  3T3M A;  4NC4 A;  1MDA H;  2AH1 A;  2HU5 A;  3EI1 A;  3PXT D;  4LGN A;  3MUO A;  4ZOZ A;  5I5M A;  4ERZ A;  3UVK A;  2VDQ A;  4AN1 A;  3EWE A;  3JB9 L;  1TYQ C;  3JZN A;  4O9D A;  3DSM A;  3I7P A;  2I0T A;  4YVD A;  3JRP A;  4H5I A;  2CE9 A;  3OL2 A;  4J8B A;  4PBZ A;  3RFH A;  3OW8 A;  4NSX A;  4ZOV A;  2AGW A;  2HJB A;  4A0A A;  3ZE2 A;  3L4M D;  3OF7 A;  2G9A A;  3DXK C;  3SWS D;  3NIG A;  1GXR A;  1JMX B;  5CXC B;  3ZDX A;  5FLX g;  2XL2 A;  3NVQ A;  4J84 A;  1RI6 A;  4A09 A;  3EI2 B;  5E6U A;  4JT5 C;  4HDJ A;  4L1M A;  2UZX B;  3BWS A;  2BCJ B;  2HKR A;  1K32 A;  2CO0 A;  5M61 A;  3RN1 D;  4E54 B;  2OIZ A;  3PSL A;  4GQ1 A;  2HXC A;  4X63 B;  3FM0 A;  1SQJ A;  1NEX B;  1GOG A;  4CZX A;  5C9Z B;  2AQ5 A;  3IUQ A;  4IA9 A;  4GGC A;  2MTA H;  4GGA A;  5K19 A;  4BCD A;  2PM7 B;  3U4Y A;  3EQ8 A;  3GFC A;  4A2L A;  3I7H A;  1E5T A;  3JZG A;  5IT9 g;  2P9N C;  5HE2 B;  5EAL A;  4NBM A;  3SJL D;  4JT6 C;  3O4H A;  2XL3 A;  2H9L A;  1TBG A;  2Q7Q A;  1YFQ A;  4E5Z A;  4PSW B;  4QT8 A;  4XYH A;  4QRJ A;  2I3S A;  4FA9 D;  2EIC A;  2H47 A;  2EIE A;  5EM2 B;  2HYE A;  4G1E A;  4O02 A;  1GP2 B;  3I8E A;  5AJA A;  1BPO A;  3F3F A;  1H2Z A;  4K3I D;  4K3J B;  2P9K C;  3CFS B;  4O3U B;  4MK0 B;  1VYH C;  2I0R A;  3I7O A;  1UOO A;  5FXY A;  2OJY A;  3O4I A;  2B5N A;  2H9P A;  2BKL A;  3IJ0 A;  4FWW A;  4O3T B;  3NVX A;  2P9I C;  5SXM A;  2EID A;  4AEZ A;  3EI3 B;  5TEE A;  1QFS A;  1YR2 A;  4G55 A;  3I89 A;  2Z2P A;  3C5M A;  1U2V C;  3DDU A;  3IJC A;  3MZL A;  5E6S A;  4X3E A;  2QC5 A;  3W15 A;  5HQG A;  4GGD A;  3UVO A;  5KDO B;  3IJ1 A;  1E8N A;  2H13 A;  3K27 A;  4BH6 A;  4A08 B;  1P22 A;  5M5R A;  3DXM C;  4ZOX A;  4GQB B;  2VZ1 A;  4A0B A;  3V9F A;  4J8G A;  3ORV D;  4FHL A;  1PBY B;  5THA A;  4A7J A;  4CI8 A;  2YMU A;  3GC3 B;  3SN6 B;  2AH0 A;  3I8C A;  4O1Q D;  4DNU A;  1L5G A;  5EAM A;  4ERY A;  1XIP A;  2YNN A;  4O2W A;  1VZ2 A;  3SBR A;  1M1X A;  4Z7O A;  4X60 B;  4CY3 A;  5CYK A;  4PNK B;  4RE5 A;  4LG8 A;  2CO0 C;  3GD1 I;  3ULE C;  4CY2 A;  3C75 H;  1E8M A;  2GC7 A;  2OVR B;  3AH8 B;  3K71 A;  1N6D A;  4FAV D;  1FWX A;  3RN0 D;  3IIY A;  3PXS D;  3KCI A;  3N0E A;  4CY5 A;  5FFG A;  4J77 A;  2J57 G;  3J81 g;  5FKQ A;  3O4J A;  1SQ9 A;  2QR5 A;  2YNO A;  4Y7R A;  2O9K A;  3ZE0 A;  3IUJ A;  4ESG A;  4CC9 A;  4BCC A;  1GOH A;  4L3H D;  5H1M A;  2G99 A;  3EI1 B;  5GMK n;  5GSA A;  2I3T A;  4AMY A;  2VDK A;  3IVM A;  4FA1 D;  2P9S C;  1L0Q A;  4QL1 A;  3RMZ D;  1UOQ A;  5FKR A;  3EI4 A;  4JHN A;  4JSV C;  1C9L A;  5M5U A;  3OL2 B;  1TYE A;  2HU8 A;  4D6V A;  3C99 A;  4PC0 A;  3V5W B;  1Q47 A;  4ES0 A;  5TF2 A;  4L1Q D;  5I5I A;  1R5M A;  3EI2 A;  4WJK A;  1GOF A;  3C9C A;  4BP8 A;  3F3P A;  4E54 A;  5IJ8 E;  1N6F A;  1ERJ A;  5H17 A;  4AX4 A;  2BBK H;  2OVP B;  4MMY A;  3BG1 A;  4X61 B;  1QNI A;  4D9S A;  1N6E A;  4JSP C;  2IWK A;  3HFQ A;  1XHM A;  1H2X A;  3K6S A;  2XU7 A;  2XDW A;  3SHF A;  2VDL A;  2QXV A;  4LG9 A;  4A2M A;  4XYI A;  4GQ2 P;  5TDH B;  5M5T A;  4J86 A;  4H5J A;  4GM9 A;  5FA5 B;  5FQD A;  1K3I A;  1PEV A;  4AN0 A;  4PSX B;  2H9M A;  3SVW D;  2IWF A;  5IC7 A;  4A11 B;  1VZ3 A;  4QAM A;  3OKY B;  3BG0 A;  5EM2 A;  5EML B;  2OK6 A;  4BP9 A;  4ZN4 A;  2GC4 A;  3NIF A;  4E5Z B;  1T2X A;  4KFM B;  4NAA A;  3MKS B;  5HDB A;  5M5S A;  3AL8 B;  1OLZ A;  4CI2 A;  4FA5 D;  4U7A A;  2P9P C;  4DNV A;  2YBA A;  3MXX A;  1C9I A;  3FCS A;  3MVD K;  2EIB A;  2P9U C;  2PM6 B;  4I79 A;  3PVU B;  5C2V B;  3JPX A;  3SBQ A;  4U1E I;  4BCB A;  3RRM C;  4D0K A;  3JAM g;  4PBY A;  3V4P A;  4BL0 A;  4CY1 A;  5C2W B;  1QFM A;  3N0D A;  1PGU A;  3ZDY A;  2HES X;  1GOT B;  3EU7 A;  4J0W A;  1MG2 A;  2VC2 A;  4IRZ A;  5E6R A;  4A08 A;  4J82 A;  4UI9 R;  5TEF A;  3MKQ A;  4CI1 A;  1I2M B;  1JOF A;  3PE7 A;  3FRX A;  1JV2 A; 
#chains in the Genus database with same CATH homology
 2PM9 B;  2YNP A;  2CN3 A;  5EMJ B;  2TRC B;  5IGQ A;  3DWL C;  2IUV A;  5GXI A;  2IUR A;  2H68 A;  4L9O A;  3IIW A;  3KRW B;  2AGZ A;  5GXH A;  3A0F A;  4PXW A;  3VA6 A;  2H14 A;  3UVL A;  5EMM B;  5CYK B;  3UVN A;  4BUJ C;  5CXB B;  1GG2 B;  4EWR A;  3GRE A;  4OZU A;  4TZ4 A;  3IKO A;  3CIK B;  5FKT A;  4R7A B;  3I7N A;  3SCY A;  1PI6 A;  3I2N A;  1U4C A;  3SBP A;  3NVN A;  5HE0 B;  3J80 g;  2AGX A;  4J87 A;  3P4F A;  4FA4 D;  4GZ8 A;  3I7K A;  2J55 H;  4J78 A;  2AGL A;  5CXC A;  4A0A B;  5HE1 B;  5A2Q g;  2PBI B;  4QQE A;  5IJ7 E;  4OWR A;  5B4W A;  2H3X A;  4GM8 A;  3EI4 B;  4JSX C;  2OK4 A;  2YB8 B;  3MZK A;  4G56 B;  3SFZ A;  4A09 B;  2Z2O A;  2H9N A;  2H6K A;  2H6N A;  1B9X A;  3EG6 A;  3OTT A;  4Y5R D;  1B9Y A;  3V7D B;  3SLE D;  3I7L A;  4CZV A;  5AMS A;  2HJ4 A;  3JZH A;  1K8K C;  3OKW A;  3PXW D;  5H14 A;  4O45 A;  4CZY A;  4ZOY A;  3EMH A;  2CE8 A;  2OVQ B;  4ERQ A;  3JRO A;  4JSN C;  5K1C C;  2CNX A;  3K26 A;  2B5L A;  4N14 A;  3SXT D;  2UZY B;  3UKU C;  1SHY B;  4A11 A;  5AFU 3;  5EAP A;  2H6Q A;  1NR0 A;  2CN2 A;  3OKY A;  5EAR A;  2HKM A;  1MG3 A;  3SMR A;  1S4U X;  3AFC A;  2B4E A;  3AL8 A;  4JD2 C;  3L4O D;  3FGB A;  4L3G D;  3ZWL B;  3EI3 A;  4GMB A;  2IUQ A;  2W18 A;  3CFV A;  5HYN B;  1JJU B;  5IGO A;  3AL9 A;  2GNQ A;  2XYI A;  4Z8L A;  3OKT A;  3PSC B;  3UVM A;  4CI3 A;  5I5J A;  5HE3 B;  4FB1 D;  4JXM A;  3RLM D;  3RFG A;  3RSE C;  2IAA A;  2Z2N A;  4IMM A;  4J73 A;  4A0B B;  5JWZ A;  2IUP A;  3ODT A;  3PVW B;  1JMZ B;  5FKS A;  2I0S A;  2PM9 A;  1A0R B;  3DM0 A;  1XKS A;  4J0X A;  4XEI C;  2EBS A;  3E0C A;  1OMW B;  2J56 H;  3F3G A;  4GM3 A;  3UR4 A;  3B7F A;  3VGZ A;  2AGY A;  3UKR C;  2B5M A;  2P9L C;  4J79 A;  4FAN D;  5CXB A;  4J81 A;  5EMK B;  4AOW A;  3MMY A;  3KRX B;  3VH0 A;  1MDA H;  2AH1 A;  3EI1 A;  3PXT D;  4LGN A;  4ZOZ A;  5I5M A;  4ERZ A;  3UVK A;  3JB9 L;  3EWE A;  1TYQ C;  3JZN A;  4O9D A;  3DSM A;  3I7P A;  2I0T A;  4YVD A;  3JRP A;  4H5I A;  2CE9 A;  3OL2 A;  4J8B A;  4PBZ A;  3RFH A;  3OW8 A;  4NSX A;  4ZOV A;  2AGW A;  2HJB A;  4A0A A;  3L4M D;  3SWS D;  2G9A A;  3DXK C;  1GXR A;  1JMX B;  5CXC B;  5FLX g;  2XL2 A;  3NVQ A;  4J84 A;  1RI6 A;  4A09 A;  3EI2 B;  4JT5 C;  4HDJ A;  2UZX B;  3BWS A;  2BCJ B;  2HKR A;  1K32 A;  2CO0 A;  3RN1 D;  4E54 B;  2OIZ A;  3PSL A;  4GQ1 A;  2HXC A;  4X63 B;  3FM0 A;  1SQJ A;  1NEX B;  4CZX A;  5C9Z B;  2AQ5 A;  4IA9 A;  4GGC A;  2MTA H;  4GGA A;  5K19 A;  2PM7 B;  3U4Y A;  3GFC A;  4A2L A;  3I7H A;  3JZG A;  5IT9 g;  2P9N C;  5HE2 B;  5EAL A;  3SJL D;  4JT6 C;  2XL3 A;  2H9L A;  1TBG A;  2Q7Q A;  1YFQ A;  4E5Z A;  4PSW B;  4QT8 A;  4XYH A;  4QRJ A;  2I3S A;  4FA9 D;  2H47 A;  5EM2 B;  2HYE A;  1GP2 B;  3I8E A;  5AJA A;  3F3F A;  4K3I D;  4O3U B;  4K3J B;  2P9K C;  3CFS B;  4MK0 B;  1VYH C;  2I0R A;  3I7O A;  5FXY A;  2OJY A;  2B5N A;  2H9P A;  3IJ0 A;  4FWW A;  4O3T B;  3NVX A;  2P9I C;  5SXM A;  4AEZ A;  3EI3 B;  5TEE A;  3I89 A;  2Z2P A;  3C5M A;  1U2V C;  3IJC A;  3MZL A;  4X3E A;  2QC5 A;  3W15 A;  5HQG A;  4GGD A;  3UVO A;  5KDO B;  3IJ1 A;  3K27 A;  2H13 A;  4BH6 A;  4A08 B;  1P22 A;  3DXM C;  4ZOX A;  4GQB B;  4A0B A;  3V9F A;  4J8G A;  3ORV D;  4FHL A;  1PBY B;  5THA A;  4A7J A;  4CI8 A;  2YMU A;  3SN6 B;  2AH0 A;  3I8C A;  4O1Q D;  5EAM A;  4ERY A;  1XIP A;  2YNN A;  3SBR A;  4X60 B;  4CY3 A;  5CYK A;  4PNK B;  4LG8 A;  2CO0 C;  3ULE C;  4CY2 A;  3C75 H;  2GC7 A;  2OVR B;  3AH8 B;  1N6D A;  4FAV D;  1FWX A;  3RN0 D;  3IIY A;  3PXS D;  3N0E A;  4CY5 A;  4J77 A;  2J57 G;  3J81 g;  5FKQ A;  1SQ9 A;  2YNO A;  4Y7R A;  2O9K A;  4ESG A;  4CC9 A;  4L3H D;  5H1M A;  2G99 A;  3EI1 B;  5GMK n;  5GSA A;  2I3T A;  4FA1 D;  2P9S C;  1L0Q A;  4QL1 A;  3RMZ D;  5FKR A;  3EI4 A;  4JSV C;  3OL2 B;  4D6V A;  3C99 A;  4PC0 A;  3V5W B;  1Q47 A;  4ES0 A;  5TF2 A;  4L1Q D;  5I5I A;  1R5M A;  3EI2 A;  3C9C A;  3F3P A;  4E54 A;  5IJ8 E;  1N6F A;  1ERJ A;  5H17 A;  2BBK H;  2OVP B;  3BG1 A;  4X61 B;  1QNI A;  1N6E A;  4JSP C;  2IWK A;  3HFQ A;  1XHM A;  2XU7 A;  3SHF A;  2QXV A;  4LG9 A;  4A2M A;  4XYI A;  4GQ2 P;  5TDH B;  4J86 A;  4H5J A;  4GM9 A;  5FA5 B;  5FQD A;  1PEV A;  4PSX B;  2H9M A;  3SVW D;  2IWF A;  5IC7 A;  4A11 B;  3OKY B;  3BG0 A;  5EM2 A;  5EML B;  2OK6 A;  4ZN4 A;  4E5Z B;  2GC4 A;  4KFM B;  3MKS B;  3AL8 B;  1OLZ A;  4CI2 A;  4FA5 D;  4U7A A;  2P9P C;  2YBA A;  3MXX A;  2P9U C;  2PM6 B;  4I79 A;  3PVU B;  5C2V B;  3JPX A;  3SBQ A;  4U1E I;  3RRM C;  4D0K A;  3JAM g;  4PBY A;  4BL0 A;  4CY1 A;  5C2W B;  3N0D A;  1PGU A;  2HES X;  1GOT B;  3EU7 A;  4J0W A;  1MG2 A;  4A08 A;  4J82 A;  4UI9 R;  5TEF A;  3MKQ A;  4CI1 A;  1JOF A;  3PE7 A;  3FRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...