4J8BA

Crystal structure of alpha-cop/emp47p complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
327
structure length
298
Chain Sequence
MAMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIAFHPTQPIFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRADAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRANDRFWFITVHPKLNLFAAAHDSGVMVFKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coatomer alpha subunit
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 75
structure length 298
sequence length 327
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j8bA00
1R5MA 4BL0A 2EBSA 2PBIB 3IIYA 1N6DA 3N0EA 3SN6B 3VA6A 5C9ZB 5JWZA 2IURA 4UI9R 1OLZA 2IUQA 4U7AA 5FKQA 2CO0C 1N6EA 4PSXB 5HE2B 1NR0A 2B5NA 2OVPB 4GQBB 3AL8B 3V9FA 3F3GA 3RLMD 4XYIA 3W15A 3RFHA 4CZYA 3L4MD 2P9PC 4YVDA 3PSLA 4PSWB 2H9NA 4J78A 4X61B 3CIKB 4D0KA 4A0AA 1GXRA 3EI2B 3EI3B 1SQJA 4FAND 5FKSA 4R7AB 2P9UC 4O3TB 3PE7A 4CY1A 4CI8A 2H14A 3SVWD 3B7FA 1L0QA 3OKTA 4XEIC 4ZOYA 2OIZA 5C2VB 1A0RB 1S4UX 4PC0A 4JT5C 1XKSA 1RI6A 2I3TA 3U4YA 4QT8A 2QC5A 5EARA 3UKUC 4FAVD 3SHFA 2OK6A 4PXWA 5AFU3 2PM9B 3FRXA 4ZN4A 3I7PA 2B5MA 5CXCB 2O9KA 3EG6A 5HQGA 3J81g 1PBYB 3AL8A 5IJ7E 5FXYA 3CFVA 4MK0B 2CE9A 5TF2A 2CE8A 2Z2NA 3PXSD 2GC7A 2I3SA 3MKQA 4NSXA 4CY5A 2XU7A 2G99A 4L9OA 4J82A 3EI2A 3EI1B 3RN1D 3EI3A 3MZKA 2AH1A 4N14A 3C99A 1GP2B 2J55H 2H6QA 4FA1D 4ES0A 4JSPC 3SBQA 2P9NC 2HKMA 3NVNA 3OKYB 3AH8B 4GQ1A 3DWLC 4GGDA 2AGLA 5EM2B 5H17A 4GZ8A 4CI3A 3MXXA 4U1EI 3GREA 4OWRA 2AGYA 1GG2B 3IIWA 4XYHA 3DM0A 1PI6A 5CXBB 2PM9A 3SXTD 3I7LA 2PM7B 5CXCA 4H5JA 2H68A 5KDOB 3BWSA 3NVXA 5C2WB 3OW8A 5H14A 2IUVA 5HE1B 2XYIA 1MDAH 4CC9A 4K3ID 3BG1A 3RMZD 4J8BA 3SLED 4FHLA 3KRWB 5B4WA 3EI1A 1OMWB 3UR4A 2G9AA 3OKWA 3UVLA 2OVQB 4Z8LA 4QL1A 2B5LA 2GNQA 3C9CA 4JD2C 2OK4A 1JMZB 4FA4D 3SJLD 4O3UB 3IKOA 4GM9A 5THAA 3NVQA 4K3JB 4A11B 4E5ZB 3C5MA 3OKYA 4PBZA 2QXVA 1ERJA 1SQ9A 3JZGA 3K26A 3BG0A 2H9PA 4GGCA 4O9DA 2P9SC 4CY3A 5EMMB 4J79A 4O45A 2CO0A 1TBGA 2UZYB 5IJ8E 1K8KC 2MTAH 4QRJA 1JJUB 3ZWLB 5CXBA 3IJCA 4J73A 4FB1D 4A08B 2YNPA 3C75H 4IMMA 3AL9A 2HJBA 3IJ0A 3SBPA 4J87A 3SMRA 3MZLA 4QQEA 1MG3A 3SFZA 4ESGA 4L1QD 4A2LA 4CZXA 5EMKB 2YMUA 3I89A 4GGAA 4J86A 4HDJA 2H13A 4X60B 1U2VC 4GMBA 5EAPA 3IJ1A 4BH6A 3RRMC 3J80g 4IA9A 3I7OA 4TZ4A 4GM8A 4JSNC 3RFGA 2AQ5A 2P9KC 2H3XA 1P22A 4ERYA 4J77A 4J81A 3I8CA 4JSXC 4A11A 4E5ZA 3K27A 2TRCB 3F3PA 5H1MA 2AH0A 4PNKB 2PM6B 4CI1A 3MMYA 1JOFA 2OVRB 2IWFA 3EI4B 4PBYA 2W18A 3CFSB 4ERQA 3VH0A 4LGNA 3JZHA 4ZOZA 2HXCA 5HE0B 3ORVD 3UVOA 3V7DB 5IGQA 4A08A 2AGXA 4J0XA 4L3HD 3I7NA 1Q47A 3OL2B 3DXMC 3KRXB 4ERZA 4A0BB 4Y7RA 2YB8B 4GM3A 4JT6C 5IT9g 4D6VA 3UVKA 2J57G 2IWKA 2OJYA 4KFMB 5FQDA 5IC7A 3P4FA 3AFCA 3HFQA 2Q7QA 5FA5B 3A0FA 4G56B 3RSEC 4J8GA 5A2Qg 3JB9L 3ULEC 4OZUA 4L3GD 3V5WB 5HE3B 3RN0D 3UKRC 4I79A 1FWXA 3I8EA 5EAMA 5I5JA 1XHMA 3EI4A 2P9LC 2CNXA 5EM2A 4JXMA 4A09B 4H5IA 5TDHB 1XIPA 5EMLB 3EMHA 3FM0A 2YNNA 5EMJB 5TEEA 1N6FA 4JSVC 2H9LA 3PVUB 1B9XA 4LG8A 5CYKB 3OL2A 5HYNB 1VYHC 2BCJB 3EU7A 2IAAA 2XL2A 2YBAA 4A0BA 3PXTD 5EALA 4J0WA 4ZOXA 2H6NA 4GQ2P 2AGZA 3ODTA 2H6KA 3N0DA 2UZXB 2Z2OA 3JAMg 2XL3A 4X3EA 3UVMA 3E0CA 4ZOVA 2HKRA 3GFCA 3PVWB 5TEFA 1JMXB 1NEXB 4E54B 2CN2A 3F3FA 4A7JA 3OTTA 3DXKC 3PXWD 2B4EA 5GXHA 4AEZA 2H9MA 2HJ4A 4A2MA 4Y5RD 4AOWA 5AJAA 3SWSD 3I7KA 3JROA 4FA9D 5I5MA 5IGOA 2BBKH 2I0TA 2I0RA 3SBRA 1MG2A 4CI2A 2GC4A 3JRPA 4BUJC 4A09A 1QNIA 2AGWA 5GMKn 3EWEA 1K32A 2HESX 4FWWA 3UVNA 5I5IA 4J84A 5K1CC 3FGBA 5CYKA 2CN3A 1GOTB 5GSAA 5K19A 4CY2A 1U4CA 1SHYB 5FLXg 4A0AB 1TYQC 2I0SA 4X63B 1YFQA 2H47A 2P9IC 3JZNA 3L4OD 4LG9A 3PSCB 4FA5D 1B9YA 4CZVA 3JPXA 5GXIA 5SXMA 4O1QD 2IUPA 1PGUA 2YNOA 5AMSA 3DSMA 3VGZA 1PEVA 4E54A 3I2NA 2J56H 4EWRA 3SCYA 5FKRA 3MKSB 3I7HA 5FKTA 2HYEA 2Z2PA
chains in the Genus database with same CATH superfamily
1R5MA 4BL0A 2EBSA 2PBIB 3IIYA 2HU5A 1N6DA 3N0EA 3SN6B 1VZ2A 3VA6A 4D9SA 5C9ZB 5JWZA 1GOGA 2IURA 4UM8A 4UI9R 1OLZA 1UTCA 2IUQA 4U7AA 4AN0A 5FKQA 2CO0C 1N6EA 4PSXB 5HE2B 1NR0A 2EIEA 2B5NA 2OVPB 5E6RA 4GQBB 3AL8B 3V9FA 1UOQA 3F3GA 3RLMD 4WK2A 3KCIA 4XYIA 3W15A 3RFHA 4CZYA 3L4MD 2P9PC 4YVDA 3PSLA 4PSWB 2H9NA 4J78A 4X61B 1I2MB 3CIKB 4D0KA 4A0AA 1GXRA 3EI2B 3EI3B 1SQJA 4JHPC 3T3MA 4FAND 5FKSA 4R7AB 2P9UC 4O3TB 1JV2A 3PE7A 4CY1A 4CI8A 2H14A 3VI4A 4UM9A 3SVWD 3T3PA 3B7FA 4MMZA 1L0QA 3QHYB 3OKTA 4IRZA 4XEIC 4ZOYA 2OIZA 5C2VB 1A0RB 1S4UX 4PC0A 3IJEA 1VE6A 4JT5C 1XKSA 1RI6A 2I3TA 3U4YA 4QT8A 2QZPA 2QC5A 5EARA 5E6UA 3UKUC 2VC2A 4FAVD 3SHFA 2QR5A 2OK6A 3ZE2A 4PXWA 5AFU3 4WK4A 2PM9B 3FRXA 4ZN4A 4Z7QA 3I7PA 2B5MA 5CXCB 2O9KA 3EG6A 5HQGA 3J81g 1PBYB 3AL8A 1E5TA 5IJ7E 1JTDB 3CFVA 4MK0B 2CE9A 5FXYA 5TF2A 1GOHA 2CE8A 2VDQA 3NIGA 2VDKA 2Z2NA 3PXSD 2GC7A 2I3SA 3MKQA 4NSXA 4BCBA 4CY5A 4MMYA 2XU7A 2G99A 4L9OA 4J82A 4G1MA 1A12A 3EI2A 3EI1B 3RN1D 3EI3A 3K71A 3MZKA 1H2XA 2AH1A 2VZ1A 4N14A 1QFSA 3C99A 3MVDK 4BP8A 1K3IA 1GP2B 2J55H 2VDLA 2H6QA 4FA1D 4ES0A 4JSPC 3SBQA 3IUQA 2P9NC 2HKMA 3NVNA 3OKYB 3AH8B 5M5UA 4GQ1A 3DWLC 4GGDA 4MMXA 2AGLA 4BCCA 3IUNA 5EM2B 5H17A 2VDOA 4GZ8A 4O02A 4CI3A 3MXXA 4QAMA 4U1EI 3GREA 4OWRA 2AGYA 3IUJA 1GG2B 1TYEA 3IIWA 4XYHA 1UOPA 3DM0A 1PI6A 5CXBB 2PM9A 3SXTD 3I7LA 2PM7B 5E6SA 5CXCA 4H5JA 2H68A 5KDOB 3K6SA 3BWSA 3NVXA 3EQ7A 5C2WB 3V4VA 3OW8A 4AX4A 3ZDZA 5H14A 2EIDA 2IUVA 5HE1B 2XYIA 1MDAH 1U8CA 4AMYA 4CC9A 4Z7NA 1L5GA 4K3ID 3BG1A 3RMZD 5C86A 4RE5A 4J8BA 5M5VA 3SLED 4FHLA 2VDRA 3KRWB 5B4WA 3EI1A 1OMWB 3UR4A 5M61A 2G9AA 3OKWA 3UVLA 2OVQB 4Z8LA 4QL1A 2B5LA 3FCSA 2GNQA 5M5RA 3VI3A 3C9CA 2XZGA 4JD2C 2VDPA 2OK4A 1JMZB 4FA4D 3SJLD 4O3UB 3IKOA 1H2ZA 2EICA 4GM9A 5THAA 3NVQA 4K3JB 4A11B 4E5ZB 3C5MA 3OKYA 4PBZA 2XE4A 2QXVA 1ERJA 1SQ9A 3JZGA 3K26A 3BG0A 2H9PA 4GGCA 4O9DA 3DDUA 2P9SC 4CY3A 4NBMA 5EMMB 1C9LA 4J79A 4O45A 2CO0A 1TBGA 2UZYB 5IJ8E 1K8KC 2MTAH 4QRJA 1JJUB 3IULA 3ZWLB 5CXBA 3IJCA 3MUOA 4J73A 4FB1D 4A08B 2YNPA 3C75H 4IMMA 2VDMA 3AL9A 2HJBA 4BP9A 3IJ0A 3SBPA 4J87A 3SMRA 3MZLA 4L1MA 4QQEA 1MG3A 3O4IA 3SFZA 4ESGA 4L1QD 3FCUA 2WQ8A 4A2LA 4CZXA 5EMKB 2YMUA 3I89A 4GGAA 4J86A 4HDJA 2H13A 4X60B 1U2VC 2HU7A 4AMZA 4GMBA 2VDNA 3EQ8A 5EAPA 3IJ1A 4BH6A 3RRMC 3J80g 4IA9A 5C92A 3IVMA 3I7OA 4TZ4A 4GM8A 4JSNC 3RFGA 2AQ5A 2P9KC 2H3XA 1P22A 1O6FA 4G1EA 4J77A 4ERYA 4J81A 3I8CA 4JSXC 4A11A 4E5ZA 3K27A 2TRCB 3F3PA 5H1MA 2AH0A 4PNKB 2PM6B 4CI1A 3MMYA 1JOFA 2OVRB 2IWFA 3EI4B 4PBYA 5M5TA 2W18A 3CFSB 4Z7OA 4ERQA 3VH0A 4LGNA 3JZHA 4ZOZA 2HXCA 5HE0B 3ORVD 3UVOA 3V7DB 5IGQA 4A08A 2AGXA 4J0XA 4O2WA 4L3HD 3I7NA 5FFOA 3EQ9A 1Q47A 3OL2B 3DXMC 4WK0A 3KRXB 5HDBA 4ERZA 4A0BB 3GC3B 4Y7RA 5FFGA 2JKXA 1BPOA 2YB8B 4DNVA 4GM3A 4AN1A 4JT6C 5IT9g 4D6VA 2VZ3A 3NIFA 2J57G 3UVKA 2IWKA 1H2YA 2OJYA 5M5SA 4KFMB 5FQDA 5IC7A 3P4FA 3AFCA 3HFQA 1QFMA 4DNUA 3IUMA 2Q7QA 5FA5B 3ZE0A 3A0FA 4G56B 3RSEC 1VZ3A 4J8GA 1E8MA 5A2Qg 1GOFA 1VE7A 3JB9L 3ULEC 1M1XA 4OZUA 4L3GD 3V5WB 5HE3B 4G55A 3RN0D 3UKRC 4I79A 1FWXA 3I8EA 5EAMA 5I5JA 1C9IA 1XHMA 3EI4A 2P9LC 2CNXA 5EM2A 4JXMA 4A09B 4H5IA 5TDHB 1XIPA 5EMLB 3EMHA 3FM0A 2YNNA 4NC4A 5EMJB 4NAAA 3O4JA 5TEEA 1H2WA 1N6FA 4JSVC 2H9LA 3PVUB 1B9XA 4LG8A 5CYKB 3OL2A 5HYNB 1VYHC 2BCJB 3EU7A 2IAAA 2XL2A 2YBAA 4A0BA 3PXTD 5EALA 3GD1I 4J0WA 4ZOXA 2H6NA 4GQ2P 2AGZA 3ODTA 4RE6A 3QI0A 2H6KA 3N0DA 2UZXB 1YR2A 4NENA 2Z2OA 3JAMg 2XL3A 4X3EA 3UVMA 3E0CA 4ZOVA 2HKRA 3K72A 3GFCA 3PVWB 5TEFA 1JMXB 1NEXB 3ZDXA 4E54B 2CN2A 2XDWA 3F3FA 4A7JA 3OTTA 3DXKC 3PXWD 2B4EA 1T2XA 4BCDA 4AEZA 3IURA 5GXHA 1E8NA 3ZE1A 1O6GA 2H9MA 2HJ4A 4A2MA 4Y5RD 4AOWA 5AJAA 3SWSD 3I7KA 2EIBA 3JROA 4FA9D 5I5MA 5IGOA 2BBKH 2I0TA 3ZDYA 2I0RA 3SBRA 1MG2A 4WJKA 2GC4A 4CI2A 3JRPA 4BUJC 4A09A 1QNIA 2AGWA 3O4GA 5GMKn 3EWEA 1K32A 3OF7A 2HESX 4FWWA 3UVNA 5I5IA 4J84A 5K1CC 3FGBA 2BKLA 5CYKA 2CN3A 1GOTB 5GSAA 5K19A 4CY2A 1U4CA 1SHYB 2HU8A 5FLXg 4A0AB 1TYQC 2I0SA 4X63B 1YFQA 2H47A 2P9IC 3JZNA 4JHNA 3L4OD 4LG9A 3PSCB 4FA5D 1B9YA 3O4HA 4CZVA 3JPXA 5GXIA 5SXMA 4O1QD 4DNWA 3V4PA 3MUNA 2IUPA 1PGUA 2YNOA 5AMSA 3DSMA 3VGZA 1PEVA 4E54A 3I2NA 3NIDA 2J56H 4EWRA 3SCYA 5FKRA 3MKSB 3I7HA 5FKTA 2HYEA 2Z2PA 1UOOA
chains in the Genus database with same CATH topology
1R5MA 4BL0A 2EBSA 2PBIB 3IIYA 1N6DA 3N0EA 3SN6B 3VA6A 5C9ZB 5JWZA 2IURA 4UI9R 1OLZA 2IUQA 4U7AA 5FKQA 2CO0C 1N6EA 4PSXB 5HE2B 1NR0A 2B5NA 2OVPB 4GQBB 3AL8B 3V9FA 3F3GA 3RLMD 4XYIA 3W15A 3RFHA 4CZYA 3L4MD 2P9PC 4YVDA 3PSLA 4PSWB 2H9NA 4J78A 4X61B 3CIKB 4D0KA 4A0AA 1GXRA 3EI2B 3EI3B 1SQJA 4FAND 5FKSA 4R7AB 2P9UC 4O3TB 3PE7A 4CY1A 4CI8A 2H14A 3SVWD 3B7FA 1L0QA 3OKTA 4XEIC 4ZOYA 2OIZA 5C2VB 1A0RB 1S4UX 4PC0A 4JT5C 1XKSA 1RI6A 2I3TA 3U4YA 4QT8A 2QC5A 5EARA 3UKUC 4FAVD 3SHFA 2OK6A 4PXWA 5AFU3 2PM9B 3FRXA 4ZN4A 3I7PA 2B5MA 5CXCB 2O9KA 3EG6A 5HQGA 3J81g 1PBYB 3AL8A 5IJ7E 5FXYA 3CFVA 4MK0B 2CE9A 5TF2A 2CE8A 2Z2NA 3PXSD 2GC7A 2I3SA 3MKQA 4NSXA 4CY5A 2XU7A 2G99A 4L9OA 4J82A 3EI2A 3EI1B 3RN1D 3EI3A 3MZKA 2AH1A 4N14A 3C99A 1GP2B 2J55H 2H6QA 4FA1D 4ES0A 4JSPC 3SBQA 2P9NC 2HKMA 3NVNA 3OKYB 3AH8B 4GQ1A 3DWLC 4GGDA 2AGLA 5EM2B 5H17A 4GZ8A 4CI3A 3MXXA 4U1EI 3GREA 4OWRA 2AGYA 1GG2B 3IIWA 4XYHA 3DM0A 1PI6A 5CXBB 2PM9A 3SXTD 3I7LA 2PM7B 5CXCA 4H5JA 2H68A 5KDOB 3BWSA 3NVXA 5C2WB 3OW8A 5H14A 2IUVA 5HE1B 2XYIA 1MDAH 4CC9A 4K3ID 3BG1A 3RMZD 4J8BA 3SLED 4FHLA 3KRWB 5B4WA 3EI1A 1OMWB 3UR4A 2G9AA 3OKWA 3UVLA 2OVQB 4Z8LA 4QL1A 2B5LA 2GNQA 3C9CA 4JD2C 2OK4A 1JMZB 4FA4D 3SJLD 4O3UB 3IKOA 4GM9A 5THAA 3NVQA 4K3JB 4A11B 4E5ZB 3C5MA 3OKYA 4PBZA 2QXVA 1ERJA 1SQ9A 3JZGA 3K26A 3BG0A 2H9PA 4GGCA 4O9DA 2P9SC 4CY3A 5EMMB 4J79A 4O45A 2CO0A 1TBGA 2UZYB 5IJ8E 1K8KC 2MTAH 4QRJA 1JJUB 3ZWLB 5CXBA 3IJCA 4J73A 4FB1D 4A08B 2YNPA 3C75H 4IMMA 3AL9A 2HJBA 3IJ0A 3SBPA 4J87A 3SMRA 3MZLA 4QQEA 1MG3A 3SFZA 4ESGA 4L1QD 4A2LA 4CZXA 5EMKB 2YMUA 3I89A 4GGAA 4J86A 4HDJA 2H13A 4X60B 1U2VC 4GMBA 5EAPA 3IJ1A 4BH6A 3RRMC 3J80g 4IA9A 3I7OA 4TZ4A 4GM8A 4JSNC 3RFGA 2AQ5A 2P9KC 2H3XA 1P22A 4ERYA 4J77A 4J81A 3I8CA 4JSXC 4A11A 4E5ZA 3K27A 2TRCB 3F3PA 5H1MA 2AH0A 4PNKB 2PM6B 4CI1A 3MMYA 1JOFA 2OVRB 2IWFA 3EI4B 4PBYA 2W18A 3CFSB 4ERQA 3VH0A 4LGNA 3JZHA 4ZOZA 2HXCA 5HE0B 3ORVD 3UVOA 3V7DB 5IGQA 4A08A 2AGXA 4J0XA 4L3HD 3I7NA 1Q47A 3OL2B 3DXMC 3KRXB 4ERZA 4A0BB 4Y7RA 2YB8B 4GM3A 4JT6C 5IT9g 4D6VA 3UVKA 2J57G 2IWKA 2OJYA 4KFMB 5FQDA 5IC7A 3P4FA 3AFCA 3HFQA 2Q7QA 5FA5B 3A0FA 4G56B 3RSEC 4J8GA 5A2Qg 3JB9L 3ULEC 4OZUA 4L3GD 3V5WB 5HE3B 3RN0D 3UKRC 4I79A 1FWXA 3I8EA 5EAMA 5I5JA 1XHMA 3EI4A 2P9LC 2CNXA 5EM2A 4JXMA 4A09B 4H5IA 5TDHB 1XIPA 5EMLB 3EMHA 3FM0A 2YNNA 5EMJB 5TEEA 1N6FA 4JSVC 2H9LA 3PVUB 1B9XA 4LG8A 5CYKB 3OL2A 5HYNB 1VYHC 2BCJB 3EU7A 2IAAA 2XL2A 2YBAA 4A0BA 3PXTD 5EALA 4J0WA 4ZOXA 2H6NA 4GQ2P 2AGZA 3ODTA 2H6KA 3N0DA 2UZXB 2Z2OA 3JAMg 2XL3A 4X3EA 3UVMA 3E0CA 4ZOVA 2HKRA 3GFCA 3PVWB 5TEFA 1JMXB 1NEXB 4E54B 2CN2A 3F3FA 4A7JA 3OTTA 3DXKC 3PXWD 2B4EA 5GXHA 4AEZA 2H9MA 2HJ4A 4A2MA 4Y5RD 4AOWA 5AJAA 3SWSD 3I7KA 3JROA 4FA9D 5I5MA 5IGOA 2BBKH 2I0TA 2I0RA 3SBRA 1MG2A 4CI2A 2GC4A 3JRPA 4BUJC 4A09A 1QNIA 2AGWA 5GMKn 3EWEA 1K32A 2HESX 4FWWA 3UVNA 5I5IA 4J84A 5K1CC 3FGBA 5CYKA 2CN3A 1GOTB 5GSAA 5K19A 4CY2A 1U4CA 1SHYB 5FLXg 4A0AB 1TYQC 2I0SA 4X63B 1YFQA 2H47A 2P9IC 3JZNA 3L4OD 4LG9A 3PSCB 4FA5D 1B9YA 4CZVA 3JPXA 5GXIA 5SXMA 4O1QD 2IUPA 1PGUA 2YNOA 5AMSA 3DSMA 3VGZA 1PEVA 4E54A 3I2NA 2J56H 4EWRA 3SCYA 5FKRA 3MKSB 3I7HA 5FKTA 2HYEA 2Z2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5M A;  4BL0 A;  2EBS A;  2PBI B;  3IIY A;  1N6D A;  3N0E A;  3SN6 B;  3VA6 A;  5C9Z B;  5JWZ A;  2IUR A;  4UI9 R;  1OLZ A;  2IUQ A;  4U7A A;  5FKQ A;  2CO0 C;  1N6E A;  4PSX B;  5HE2 B;  1NR0 A;  2B5N A;  2OVP B;  4GQB B;  3AL8 B;  3V9F A;  3F3G A;  3RLM D;  4XYI A;  3W15 A;  3RFH A;  4CZY A;  3L4M D;  2P9P C;  4YVD A;  3PSL A;  4PSW B;  2H9N A;  4J78 A;  4X61 B;  3CIK B;  4D0K A;  4A0A A;  1GXR A;  3EI2 B;  3EI3 B;  1SQJ A;  4FAN D;  5FKS A;  4R7A B;  2P9U C;  4O3T B;  3PE7 A;  4CY1 A;  4CI8 A;  2H14 A;  3SVW D;  3B7F A;  1L0Q A;  3OKT A;  4XEI C;  4ZOY A;  2OIZ A;  5C2V B;  1A0R B;  1S4U X;  4PC0 A;  4JT5 C;  1XKS A;  1RI6 A;  2I3T A;  3U4Y A;  4QT8 A;  2QC5 A;  5EAR A;  3UKU C;  4FAV D;  3SHF A;  2OK6 A;  4PXW A;  5AFU 3;  2PM9 B;  3FRX A;  4ZN4 A;  3I7P A;  2B5M A;  5CXC B;  2O9K A;  3EG6 A;  5HQG A;  3J81 g;  1PBY B;  3AL8 A;  5IJ7 E;  5FXY A;  3CFV A;  4MK0 B;  2CE9 A;  5TF2 A;  2CE8 A;  2Z2N A;  3PXS D;  2GC7 A;  2I3S A;  3MKQ A;  4NSX A;  4CY5 A;  2XU7 A;  2G99 A;  4L9O A;  4J82 A;  3EI2 A;  3EI1 B;  3RN1 D;  3EI3 A;  3MZK A;  2AH1 A;  4N14 A;  3C99 A;  1GP2 B;  2J55 H;  2H6Q A;  4FA1 D;  4ES0 A;  4JSP C;  3SBQ A;  2P9N C;  2HKM A;  3NVN A;  3OKY B;  3AH8 B;  4GQ1 A;  3DWL C;  4GGD A;  2AGL A;  5EM2 B;  5H17 A;  4GZ8 A;  4CI3 A;  3MXX A;  4U1E I;  3GRE A;  4OWR A;  2AGY A;  1GG2 B;  3IIW A;  4XYH A;  3DM0 A;  1PI6 A;  5CXB B;  2PM9 A;  3SXT D;  3I7L A;  2PM7 B;  5CXC A;  4H5J A;  2H68 A;  5KDO B;  3BWS A;  3NVX A;  5C2W B;  3OW8 A;  5H14 A;  2IUV A;  5HE1 B;  2XYI A;  1MDA H;  4CC9 A;  4K3I D;  3BG1 A;  3RMZ D;  4J8B A;  3SLE D;  4FHL A;  3KRW B;  5B4W A;  3EI1 A;  1OMW B;  3UR4 A;  2G9A A;  3OKW A;  3UVL A;  2OVQ B;  4Z8L A;  4QL1 A;  2B5L A;  2GNQ A;  3C9C A;  4JD2 C;  2OK4 A;  1JMZ B;  4FA4 D;  3SJL D;  4O3U B;  3IKO A;  4GM9 A;  5THA A;  3NVQ A;  4K3J B;  4A11 B;  4E5Z B;  3C5M A;  3OKY A;  4PBZ A;  2QXV A;  1ERJ A;  1SQ9 A;  3JZG A;  3K26 A;  3BG0 A;  2H9P A;  4GGC A;  4O9D A;  2P9S C;  4CY3 A;  5EMM B;  4J79 A;  4O45 A;  2CO0 A;  1TBG A;  2UZY B;  5IJ8 E;  1K8K C;  2MTA H;  4QRJ A;  1JJU B;  3ZWL B;  5CXB A;  3IJC A;  4J73 A;  4FB1 D;  4A08 B;  2YNP A;  3C75 H;  4IMM A;  3AL9 A;  2HJB A;  3IJ0 A;  3SBP A;  4J87 A;  3SMR A;  3MZL A;  4QQE A;  1MG3 A;  3SFZ A;  4ESG A;  4L1Q D;  4A2L A;  4CZX A;  5EMK B;  2YMU A;  3I89 A;  4GGA A;  4J86 A;  4HDJ A;  2H13 A;  4X60 B;  1U2V C;  4GMB A;  5EAP A;  3IJ1 A;  4BH6 A;  3RRM C;  3J80 g;  4IA9 A;  3I7O A;  4TZ4 A;  4GM8 A;  4JSN C;  3RFG A;  2AQ5 A;  2P9K C;  2H3X A;  1P22 A;  4ERY A;  4J77 A;  4J81 A;  3I8C A;  4JSX C;  4A11 A;  4E5Z A;  3K27 A;  2TRC B;  3F3P A;  5H1M A;  2AH0 A;  4PNK B;  2PM6 B;  4CI1 A;  3MMY A;  1JOF A;  2OVR B;  2IWF A;  3EI4 B;  4PBY A;  2W18 A;  3CFS B;  4ERQ A;  3VH0 A;  4LGN A;  3JZH A;  4ZOZ A;  2HXC A;  5HE0 B;  3ORV D;  3UVO A;  3V7D B;  5IGQ A;  4A08 A;  2AGX A;  4J0X A;  4L3H D;  3I7N A;  1Q47 A;  3OL2 B;  3DXM C;  3KRX B;  4ERZ A;  4A0B B;  4Y7R A;  2YB8 B;  4GM3 A;  4JT6 C;  5IT9 g;  4D6V A;  3UVK A;  2J57 G;  2IWK A;  2OJY A;  4KFM B;  5FQD A;  5IC7 A;  3P4F A;  3AFC A;  3HFQ A;  2Q7Q A;  5FA5 B;  3A0F A;  4G56 B;  3RSE C;  4J8G A;  5A2Q g;  3JB9 L;  3ULE C;  4OZU A;  4L3G D;  3V5W B;  5HE3 B;  3RN0 D;  3UKR C;  4I79 A;  1FWX A;  3I8E A;  5EAM A;  5I5J A;  1XHM A;  3EI4 A;  2P9L C;  2CNX A;  5EM2 A;  4JXM A;  4A09 B;  4H5I A;  5TDH B;  1XIP A;  5EML B;  3EMH A;  3FM0 A;  2YNN A;  5EMJ B;  5TEE A;  1N6F A;  4JSV C;  2H9L A;  3PVU B;  1B9X A;  4LG8 A;  5CYK B;  3OL2 A;  5HYN B;  1VYH C;  2BCJ B;  3EU7 A;  2IAA A;  2XL2 A;  2YBA A;  4A0B A;  3PXT D;  5EAL A;  4J0W A;  4ZOX A;  2H6N A;  4GQ2 P;  2AGZ A;  3ODT A;  2H6K A;  3N0D A;  2UZX B;  2Z2O A;  3JAM g;  2XL3 A;  4X3E A;  3UVM A;  3E0C A;  4ZOV A;  2HKR A;  3GFC A;  3PVW B;  5TEF A;  1JMX B;  1NEX B;  4E54 B;  2CN2 A;  3F3F A;  4A7J A;  3OTT A;  3DXK C;  3PXW D;  2B4E A;  5GXH A;  4AEZ A;  2H9M A;  2HJ4 A;  4A2M A;  4Y5R D;  4AOW A;  5AJA A;  3SWS D;  3I7K A;  3JRO A;  4FA9 D;  5I5M A;  5IGO A;  2BBK H;  2I0T A;  2I0R A;  3SBR A;  1MG2 A;  4CI2 A;  2GC4 A;  3JRP A;  4BUJ C;  4A09 A;  1QNI A;  2AGW A;  5GMK n;  3EWE A;  1K32 A;  2HES X;  4FWW A;  3UVN A;  5I5I A;  4J84 A;  5K1C C;  3FGB A;  5CYK A;  2CN3 A;  1GOT B;  5GSA A;  5K19 A;  4CY2 A;  1U4C A;  1SHY B;  5FLX g;  4A0A B;  1TYQ C;  2I0S A;  4X63 B;  1YFQ A;  2H47 A;  2P9I C;  3JZN A;  3L4O D;  4LG9 A;  3PSC B;  4FA5 D;  1B9Y A;  4CZV A;  3JPX A;  5GXI A;  5SXM A;  4O1Q D;  2IUP A;  1PGU A;  2YNO A;  5AMS A;  3DSM A;  3VGZ A;  1PEV A;  4E54 A;  3I2N A;  2J56 H;  4EWR A;  3SCY A;  5FKR A;  3MKS B;  3I7H A;  5FKT A;  2HYE A;  2Z2P A; 
#chains in the Genus database with same CATH topology
 1R5M A;  4BL0 A;  2EBS A;  2PBI B;  3IIY A;  2HU5 A;  1N6D A;  3N0E A;  3SN6 B;  1VZ2 A;  3VA6 A;  4D9S A;  5C9Z B;  5JWZ A;  1GOG A;  2IUR A;  4UM8 A;  4UI9 R;  1OLZ A;  1UTC A;  2IUQ A;  4U7A A;  4AN0 A;  5FKQ A;  2CO0 C;  1N6E A;  4PSX B;  5HE2 B;  1NR0 A;  2EIE A;  2B5N A;  2OVP B;  5E6R A;  4GQB B;  3AL8 B;  3V9F A;  1UOQ A;  3F3G A;  3RLM D;  4WK2 A;  3KCI A;  4XYI A;  3W15 A;  3RFH A;  4CZY A;  3L4M D;  2P9P C;  4YVD A;  3PSL A;  4PSW B;  2H9N A;  4J78 A;  4X61 B;  1I2M B;  3CIK B;  4D0K A;  4A0A A;  1GXR A;  3EI2 B;  3EI3 B;  1SQJ A;  4JHP C;  3T3M A;  4FAN D;  5FKS A;  4R7A B;  2P9U C;  4O3T B;  1JV2 A;  3PE7 A;  4CY1 A;  4CI8 A;  2H14 A;  3VI4 A;  4UM9 A;  3SVW D;  3T3P A;  3B7F A;  4MMZ A;  1L0Q A;  3QHY B;  3OKT A;  4IRZ A;  4XEI C;  4ZOY A;  2OIZ A;  5C2V B;  1A0R B;  1S4U X;  4PC0 A;  3IJE A;  1VE6 A;  4JT5 C;  1XKS A;  1RI6 A;  2I3T A;  3U4Y A;  4QT8 A;  2QZP A;  2QC5 A;  5EAR A;  5E6U A;  3UKU C;  2VC2 A;  4FAV D;  3SHF A;  2QR5 A;  2OK6 A;  3ZE2 A;  4PXW A;  5AFU 3;  4WK4 A;  2PM9 B;  3FRX A;  4ZN4 A;  4Z7Q A;  3I7P A;  2B5M A;  5CXC B;  2O9K A;  3EG6 A;  5HQG A;  3J81 g;  1PBY B;  3AL8 A;  1E5T A;  5IJ7 E;  1JTD B;  3CFV A;  4MK0 B;  2CE9 A;  5FXY A;  5TF2 A;  1GOH A;  2CE8 A;  2VDQ A;  3NIG A;  2VDK A;  2Z2N A;  3PXS D;  2GC7 A;  2I3S A;  3MKQ A;  4NSX A;  4BCB A;  4CY5 A;  4MMY A;  2XU7 A;  2G99 A;  4L9O A;  4J82 A;  4G1M A;  1A12 A;  3EI2 A;  3EI1 B;  3RN1 D;  3EI3 A;  3K71 A;  3MZK A;  1H2X A;  2AH1 A;  2VZ1 A;  4N14 A;  1QFS A;  3C99 A;  3MVD K;  4BP8 A;  1K3I A;  1GP2 B;  2J55 H;  2VDL A;  2H6Q A;  4FA1 D;  4ES0 A;  4JSP C;  3SBQ A;  3IUQ A;  2P9N C;  2HKM A;  3NVN A;  3OKY B;  3AH8 B;  5M5U A;  4GQ1 A;  3DWL C;  4GGD A;  4MMX A;  2AGL A;  4BCC A;  3IUN A;  5EM2 B;  5H17 A;  2VDO A;  4GZ8 A;  4O02 A;  4CI3 A;  3MXX A;  4QAM A;  4U1E I;  3GRE A;  4OWR A;  2AGY A;  3IUJ A;  1GG2 B;  1TYE A;  3IIW A;  4XYH A;  1UOP A;  3DM0 A;  1PI6 A;  5CXB B;  2PM9 A;  3SXT D;  3I7L A;  2PM7 B;  5E6S A;  5CXC A;  4H5J A;  2H68 A;  5KDO B;  3K6S A;  3BWS A;  3NVX A;  3EQ7 A;  5C2W B;  3V4V A;  3OW8 A;  4AX4 A;  3ZDZ A;  5H14 A;  2EID A;  2IUV A;  5HE1 B;  2XYI A;  1MDA H;  1U8C A;  4AMY A;  4CC9 A;  4Z7N A;  1L5G A;  4K3I D;  3BG1 A;  3RMZ D;  5C86 A;  4RE5 A;  4J8B A;  5M5V A;  3SLE D;  4FHL A;  2VDR A;  3KRW B;  5B4W A;  3EI1 A;  1OMW B;  3UR4 A;  5M61 A;  2G9A A;  3OKW A;  3UVL A;  2OVQ B;  4Z8L A;  4QL1 A;  2B5L A;  3FCS A;  2GNQ A;  5M5R A;  3VI3 A;  3C9C A;  2XZG A;  4JD2 C;  2VDP A;  2OK4 A;  1JMZ B;  4FA4 D;  3SJL D;  4O3U B;  3IKO A;  1H2Z A;  2EIC A;  4GM9 A;  5THA A;  3NVQ A;  4K3J B;  4A11 B;  4E5Z B;  3C5M A;  3OKY A;  4PBZ A;  2XE4 A;  2QXV A;  1ERJ A;  1SQ9 A;  3JZG A;  3K26 A;  3BG0 A;  2H9P A;  4GGC A;  4O9D A;  3DDU A;  2P9S C;  4CY3 A;  4NBM A;  5EMM B;  1C9L A;  4J79 A;  4O45 A;  2CO0 A;  1TBG A;  2UZY B;  5IJ8 E;  1K8K C;  2MTA H;  4QRJ A;  1JJU B;  3IUL A;  3ZWL B;  5CXB A;  3IJC A;  3MUO A;  4J73 A;  4FB1 D;  4A08 B;  2YNP A;  3C75 H;  4IMM A;  2VDM A;  3AL9 A;  2HJB A;  4BP9 A;  3IJ0 A;  3SBP A;  4J87 A;  3SMR A;  3MZL A;  4L1M A;  4QQE A;  1MG3 A;  3O4I A;  3SFZ A;  4ESG A;  4L1Q D;  3FCU A;  2WQ8 A;  4A2L A;  4CZX A;  5EMK B;  2YMU A;  3I89 A;  4GGA A;  4J86 A;  4HDJ A;  2H13 A;  4X60 B;  1U2V C;  2HU7 A;  4AMZ A;  4GMB A;  2VDN A;  3EQ8 A;  5EAP A;  3IJ1 A;  4BH6 A;  3RRM C;  3J80 g;  4IA9 A;  5C92 A;  3IVM A;  3I7O A;  4TZ4 A;  4GM8 A;  4JSN C;  3RFG A;  2AQ5 A;  2P9K C;  2H3X A;  1P22 A;  1O6F A;  4G1E A;  4J77 A;  4ERY A;  4J81 A;  3I8C A;  4JSX C;  4A11 A;  4E5Z A;  3K27 A;  2TRC B;  3F3P A;  5H1M A;  2AH0 A;  4PNK B;  2PM6 B;  4CI1 A;  3MMY A;  1JOF A;  2OVR B;  2IWF A;  3EI4 B;  4PBY A;  5M5T A;  2W18 A;  3CFS B;  4Z7O A;  4ERQ A;  3VH0 A;  4LGN A;  3JZH A;  4ZOZ A;  2HXC A;  5HE0 B;  3ORV D;  3UVO A;  3V7D B;  5IGQ A;  4A08 A;  2AGX A;  4J0X A;  4O2W A;  4L3H D;  3I7N A;  5FFO A;  3EQ9 A;  1Q47 A;  3OL2 B;  3DXM C;  4WK0 A;  3KRX B;  5HDB A;  4ERZ A;  4A0B B;  3GC3 B;  4Y7R A;  5FFG A;  2JKX A;  1BPO A;  2YB8 B;  4DNV A;  4GM3 A;  4AN1 A;  4JT6 C;  5IT9 g;  4D6V A;  2VZ3 A;  3NIF A;  2J57 G;  3UVK A;  2IWK A;  1H2Y A;  2OJY A;  5M5S A;  4KFM B;  5FQD A;  5IC7 A;  3P4F A;  3AFC A;  3HFQ A;  1QFM A;  4DNU A;  3IUM A;  2Q7Q A;  5FA5 B;  3ZE0 A;  3A0F A;  4G56 B;  3RSE C;  1VZ3 A;  4J8G A;  1E8M A;  5A2Q g;  1GOF A;  1VE7 A;  3JB9 L;  3ULE C;  1M1X A;  4OZU A;  4L3G D;  3V5W B;  5HE3 B;  4G55 A;  3RN0 D;  3UKR C;  4I79 A;  1FWX A;  3I8E A;  5EAM A;  5I5J A;  1C9I A;  1XHM A;  3EI4 A;  2P9L C;  2CNX A;  5EM2 A;  4JXM A;  4A09 B;  4H5I A;  5TDH B;  1XIP A;  5EML B;  3EMH A;  3FM0 A;  2YNN A;  4NC4 A;  5EMJ B;  4NAA A;  3O4J A;  5TEE A;  1H2W A;  1N6F A;  4JSV C;  2H9L A;  3PVU B;  1B9X A;  4LG8 A;  5CYK B;  3OL2 A;  5HYN B;  1VYH C;  2BCJ B;  3EU7 A;  2IAA A;  2XL2 A;  2YBA A;  4A0B A;  3PXT D;  5EAL A;  3GD1 I;  4J0W A;  4ZOX A;  2H6N A;  4GQ2 P;  2AGZ A;  3ODT A;  4RE6 A;  3QI0 A;  2H6K A;  3N0D A;  2UZX B;  1YR2 A;  4NEN A;  2Z2O A;  3JAM g;  2XL3 A;  4X3E A;  3UVM A;  3E0C A;  4ZOV A;  2HKR A;  3K72 A;  3GFC A;  3PVW B;  5TEF A;  1JMX B;  1NEX B;  3ZDX A;  4E54 B;  2CN2 A;  2XDW A;  3F3F A;  4A7J A;  3OTT A;  3DXK C;  3PXW D;  2B4E A;  1T2X A;  4BCD A;  4AEZ A;  3IUR A;  5GXH A;  1E8N A;  3ZE1 A;  1O6G A;  2H9M A;  2HJ4 A;  4A2M A;  4Y5R D;  4AOW A;  5AJA A;  3SWS D;  3I7K A;  2EIB A;  3JRO A;  4FA9 D;  5I5M A;  5IGO A;  2BBK H;  2I0T A;  3ZDY A;  2I0R A;  3SBR A;  1MG2 A;  4WJK A;  2GC4 A;  4CI2 A;  3JRP A;  4BUJ C;  4A09 A;  1QNI A;  2AGW A;  3O4G A;  5GMK n;  3EWE A;  1K32 A;  3OF7 A;  2HES X;  4FWW A;  3UVN A;  5I5I A;  4J84 A;  5K1C C;  3FGB A;  2BKL A;  5CYK A;  2CN3 A;  1GOT B;  5GSA A;  5K19 A;  4CY2 A;  1U4C A;  1SHY B;  2HU8 A;  5FLX g;  4A0A B;  1TYQ C;  2I0S A;  4X63 B;  1YFQ A;  2H47 A;  2P9I C;  3JZN A;  4JHN A;  3L4O D;  4LG9 A;  3PSC B;  4FA5 D;  1B9Y A;  3O4H A;  4CZV A;  3JPX A;  5GXI A;  5SXM A;  4O1Q D;  4DNW A;  3V4P A;  3MUN A;  2IUP A;  1PGU A;  2YNO A;  5AMS A;  3DSM A;  3VGZ A;  1PEV A;  4E54 A;  3I2N A;  3NID A;  2J56 H;  4EWR A;  3SCY A;  5FKR A;  3MKS B;  3I7H A;  5FKT A;  2HYE A;  2Z2P A;  1UOO A; 
#chains in the Genus database with same CATH homology
 1R5M A;  4BL0 A;  2EBS A;  2PBI B;  3IIY A;  1N6D A;  3N0E A;  3SN6 B;  3VA6 A;  5C9Z B;  5JWZ A;  2IUR A;  4UI9 R;  1OLZ A;  2IUQ A;  4U7A A;  5FKQ A;  2CO0 C;  1N6E A;  4PSX B;  5HE2 B;  1NR0 A;  2B5N A;  2OVP B;  4GQB B;  3AL8 B;  3V9F A;  3F3G A;  3RLM D;  4XYI A;  3W15 A;  3RFH A;  4CZY A;  3L4M D;  2P9P C;  4YVD A;  3PSL A;  4PSW B;  2H9N A;  4J78 A;  4X61 B;  3CIK B;  4D0K A;  4A0A A;  1GXR A;  3EI2 B;  3EI3 B;  1SQJ A;  4FAN D;  5FKS A;  4R7A B;  2P9U C;  4O3T B;  3PE7 A;  4CY1 A;  4CI8 A;  2H14 A;  3SVW D;  3B7F A;  1L0Q A;  3OKT A;  4XEI C;  4ZOY A;  2OIZ A;  5C2V B;  1A0R B;  1S4U X;  4PC0 A;  4JT5 C;  1XKS A;  1RI6 A;  2I3T A;  3U4Y A;  4QT8 A;  2QC5 A;  5EAR A;  3UKU C;  4FAV D;  3SHF A;  2OK6 A;  4PXW A;  5AFU 3;  2PM9 B;  3FRX A;  4ZN4 A;  3I7P A;  2B5M A;  5CXC B;  2O9K A;  3EG6 A;  5HQG A;  3J81 g;  1PBY B;  3AL8 A;  5IJ7 E;  5FXY A;  3CFV A;  4MK0 B;  2CE9 A;  5TF2 A;  2CE8 A;  2Z2N A;  3PXS D;  2GC7 A;  2I3S A;  3MKQ A;  4NSX A;  4CY5 A;  2XU7 A;  2G99 A;  4L9O A;  4J82 A;  3EI2 A;  3EI1 B;  3RN1 D;  3EI3 A;  3MZK A;  2AH1 A;  4N14 A;  3C99 A;  1GP2 B;  2J55 H;  2H6Q A;  4FA1 D;  4ES0 A;  4JSP C;  3SBQ A;  2P9N C;  2HKM A;  3NVN A;  3OKY B;  3AH8 B;  4GQ1 A;  3DWL C;  4GGD A;  2AGL A;  5EM2 B;  5H17 A;  4GZ8 A;  4CI3 A;  3MXX A;  4U1E I;  3GRE A;  4OWR A;  2AGY A;  1GG2 B;  3IIW A;  4XYH A;  3DM0 A;  1PI6 A;  5CXB B;  2PM9 A;  3SXT D;  3I7L A;  2PM7 B;  5CXC A;  4H5J A;  2H68 A;  5KDO B;  3BWS A;  3NVX A;  5C2W B;  3OW8 A;  5H14 A;  2IUV A;  5HE1 B;  2XYI A;  1MDA H;  4CC9 A;  4K3I D;  3BG1 A;  3RMZ D;  4J8B A;  3SLE D;  4FHL A;  3KRW B;  5B4W A;  3EI1 A;  1OMW B;  3UR4 A;  2G9A A;  3OKW A;  3UVL A;  2OVQ B;  4Z8L A;  4QL1 A;  2B5L A;  2GNQ A;  3C9C A;  4JD2 C;  2OK4 A;  1JMZ B;  4FA4 D;  3SJL D;  4O3U B;  3IKO A;  4GM9 A;  5THA A;  3NVQ A;  4K3J B;  4A11 B;  4E5Z B;  3C5M A;  3OKY A;  4PBZ A;  2QXV A;  1ERJ A;  1SQ9 A;  3JZG A;  3K26 A;  3BG0 A;  2H9P A;  4GGC A;  4O9D A;  2P9S C;  4CY3 A;  5EMM B;  4J79 A;  4O45 A;  2CO0 A;  1TBG A;  2UZY B;  5IJ8 E;  1K8K C;  2MTA H;  4QRJ A;  1JJU B;  3ZWL B;  5CXB A;  3IJC A;  4J73 A;  4FB1 D;  4A08 B;  2YNP A;  3C75 H;  4IMM A;  3AL9 A;  2HJB A;  3IJ0 A;  3SBP A;  4J87 A;  3SMR A;  3MZL A;  4QQE A;  1MG3 A;  3SFZ A;  4ESG A;  4L1Q D;  4A2L A;  4CZX A;  5EMK B;  2YMU A;  3I89 A;  4GGA A;  4J86 A;  4HDJ A;  2H13 A;  4X60 B;  1U2V C;  4GMB A;  5EAP A;  3IJ1 A;  4BH6 A;  3RRM C;  3J80 g;  4IA9 A;  3I7O A;  4TZ4 A;  4GM8 A;  4JSN C;  3RFG A;  2AQ5 A;  2P9K C;  2H3X A;  1P22 A;  4ERY A;  4J77 A;  4J81 A;  3I8C A;  4JSX C;  4A11 A;  4E5Z A;  3K27 A;  2TRC B;  3F3P A;  5H1M A;  2AH0 A;  4PNK B;  2PM6 B;  4CI1 A;  3MMY A;  1JOF A;  2OVR B;  2IWF A;  3EI4 B;  4PBY A;  2W18 A;  3CFS B;  4ERQ A;  3VH0 A;  4LGN A;  3JZH A;  4ZOZ A;  2HXC A;  5HE0 B;  3ORV D;  3UVO A;  3V7D B;  5IGQ A;  4A08 A;  2AGX A;  4J0X A;  4L3H D;  3I7N A;  1Q47 A;  3OL2 B;  3DXM C;  3KRX B;  4ERZ A;  4A0B B;  4Y7R A;  2YB8 B;  4GM3 A;  4JT6 C;  5IT9 g;  4D6V A;  3UVK A;  2J57 G;  2IWK A;  2OJY A;  4KFM B;  5FQD A;  5IC7 A;  3P4F A;  3AFC A;  3HFQ A;  2Q7Q A;  5FA5 B;  3A0F A;  4G56 B;  3RSE C;  4J8G A;  5A2Q g;  3JB9 L;  3ULE C;  4OZU A;  4L3G D;  3V5W B;  5HE3 B;  3RN0 D;  3UKR C;  4I79 A;  1FWX A;  3I8E A;  5EAM A;  5I5J A;  1XHM A;  3EI4 A;  2P9L C;  2CNX A;  5EM2 A;  4JXM A;  4A09 B;  4H5I A;  5TDH B;  1XIP A;  5EML B;  3EMH A;  3FM0 A;  2YNN A;  5EMJ B;  5TEE A;  1N6F A;  4JSV C;  2H9L A;  3PVU B;  1B9X A;  4LG8 A;  5CYK B;  3OL2 A;  5HYN B;  1VYH C;  2BCJ B;  3EU7 A;  2IAA A;  2XL2 A;  2YBA A;  4A0B A;  3PXT D;  5EAL A;  4J0W A;  4ZOX A;  2H6N A;  4GQ2 P;  2AGZ A;  3ODT A;  2H6K A;  3N0D A;  2UZX B;  2Z2O A;  3JAM g;  2XL3 A;  4X3E A;  3UVM A;  3E0C A;  4ZOV A;  2HKR A;  3GFC A;  3PVW B;  5TEF A;  1JMX B;  1NEX B;  4E54 B;  2CN2 A;  3F3F A;  4A7J A;  3OTT A;  3DXK C;  3PXW D;  2B4E A;  5GXH A;  4AEZ A;  2H9M A;  2HJ4 A;  4A2M A;  4Y5R D;  4AOW A;  5AJA A;  3SWS D;  3I7K A;  3JRO A;  4FA9 D;  5I5M A;  5IGO A;  2BBK H;  2I0T A;  2I0R A;  3SBR A;  1MG2 A;  4CI2 A;  2GC4 A;  3JRP A;  4BUJ C;  4A09 A;  1QNI A;  2AGW A;  5GMK n;  3EWE A;  1K32 A;  2HES X;  4FWW A;  3UVN A;  5I5I A;  4J84 A;  5K1C C;  3FGB A;  5CYK A;  2CN3 A;  1GOT B;  5GSA A;  5K19 A;  4CY2 A;  1U4C A;  1SHY B;  5FLX g;  4A0A B;  1TYQ C;  2I0S A;  4X63 B;  1YFQ A;  2H47 A;  2P9I C;  3JZN A;  3L4O D;  4LG9 A;  3PSC B;  4FA5 D;  1B9Y A;  4CZV A;  3JPX A;  5GXI A;  5SXM A;  4O1Q D;  2IUP A;  1PGU A;  2YNO A;  5AMS A;  3DSM A;  3VGZ A;  1PEV A;  4E54 A;  3I2N A;  2J56 H;  4EWR A;  3SCY A;  5FKR A;  3MKS B;  3I7H A;  5FKT A;  2HYE A;  2Z2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...