4J8BA

Crystal structure of alpha-cop/emp47p complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
327
structure length
298
Chain Sequence
b'MAMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIAFHPTQPIFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRADAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRANDRFWFITVHPKLNLFAAAHDSGVMVFKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coatomer alpha subunit
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 75
structure length 298
sequence length 327
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j8bA00
3V7DB 2P9SC 4CZXA 2TRCB 3MXXA 2P9NC 4GM9A 1NR0A 2H3XA 2HJ4A 2H9LA 3C9CA 5C9ZB 3EI2B 5IJ7E 3AH8B 2IUVA 3EI4A 3MZKA 1JMXB 3PVUB 2UZYB 3MZLA 3SXTD 5EMKB 2YB8B 3MKSB 2J56H 3AL9A 4CZVA 3JB9L 1A0RB 3SWSD 3PSLA 2XL2A 2HXCA 3K26A 3JZNA 4J86A 4J0XA 2W18A 2J55H 1OLZA 4CY2A 2CE8A 1PEVA 3JRPA 3UVNA 4H5JA 2AGLA 4A08B 1OMWB 3PSCB 2I0TA 4PSWB 1RI6A 4GQ2P 4R7AB 1QNIA 3JROA 3RSEC 3OKYB 2IAAA 5CXBB 4A09A 4PBZA 2P9LC 4JD2C 2P9IC 3GFCA 4J82A 5EMJB 5HE1B 4CI8A 3V9FA 5IT9g 3I7LA 1XKSA 4CI1A 2G9AA 4LGNA 3SBQA 4J73A 5C2VB 2OIZA 3I7KA 3N0EA 2PM7B 5GXIA 2H6NA 2BCJB 3EU7A 3VH0A 4A0AA 5KDOB 5AJAA 3SN6B 1B9YA 1P22A 5FKSA 4ERZA 1SQJA 2HKMA 4HDJA 3KRXB 1SHYB 1JOFA 3I7OA 2OVRB 3I7HA 4U1EI 5CXCA 3IIWA 5EMLB 3SFZA 3I7NA 3OL2B 4A7JA 5HQGA 2OK6A 2GNQA 5CYKB 3DWLC 1K8KC 3KRWB 3I89A 5FA5B 4O3UB 3SLED 2AH1A 4L3HD 3HFQA 4JXMA 5JWZA 4E54A 4FA4D 4J87A 3C99A 4GM3A 3DM0A 3JAMg 4ZOYA 4CY1A 1PI6A 3IJ1A 4A0BA 4FA1D 5HE0B 3I8EA 4AEZA 2YBAA 3EWEA 2CO0A 3NVXA 3EI4B 5C2WB 4KFMB 1GG2B 3W15A 2I3TA 4D0KA 3F3GA 5THAA 4L3GD 3CIKB 4GMBA 2B4EA 3P4FA 4BH6A 3EI1B 5IGOA 3E0CA 2H6KA 2YMUA 4AOWA 2B5MA 3F3PA 5HYNB 3PE7A 4FA9D 5EMMB 4L9OA 3CFSB 3EI3B 3RRMC 1YFQA 4ESGA 4J78A 2H9NA 3MMYA 4FHLA 5FLXg 4O3TB 2AGYA 2I0SA 3ORVD 2EBSA 4ZN4A 3K27A 5EM2B 4U7AA 5H1MA 5FKQA 2QXVA 4PSXB 4X63B 3EI2A 3B7FA 4A09B 5GXHA 4E5ZB 1U4CA 5H14A 3SJLD 5EAPA 2H13A 4A11A 3SVWD 3RFHA 2YNPA 2P9KC 5I5IA 3UVOA 3NVNA 1MG3A 3CFVA 2B5LA 2CE9A 5AMSA 3RLMD 3UR4A 2AGWA 4TZ4A 4J8BA 2I0RA 1XHMA 1NEXB 4G56B 3EG6A 4GGDA 3FGBA 4FAVD 3ODTA 2PM6B 5CXCB 2IWFA 3VGZA 2OK4A 2H9PA 4ES0A 5HE2B 5IC7A 2H68A 2G99A 4GGAA 4Z8LA 5FKRA 1Q47A 3PXWD 2B5NA 3PVWB 3ZWLB 5EARA 3J81g 2HESX 3PXTD 1MDAH 1PGUA 4FWWA 4L1QD 5H17A 2PBIB 2Q7QA 1N6DA 3U4YA 4GQ1A 4A0BB 3JPXA 2PM9A 5K19A 2P9UC 3BWSA 5GMKn 3AL8A 4N14A 4J79A 4X3EA 5FQDA 3RN1D 3UVMA 5B4WA 3PXSD 2MTAH 4XYIA 5EALA 4FA5D 2HYEA 4K3ID 1L0QA 4OZUA 3DXKC 3I7PA 3OTTA 1JMZB 3SCYA 4J77A 4FAND 4ERQA 1MG2A 3FM0A 2IURA 3OKTA 2Z2OA 4A2MA 2AGZA 4GQBB 3A0FA 3I8CA 3RMZD 4CC9A 3SBRA 3UVLA 4CI3A 3I2NA 3J80g 4JT5C 3UKRC 1U2VC 3RFGA 4O9DA 4Y7RA 1GOTB 2AGXA 4XEIC 2GC7A 4K3JB 4GZ8A 1S4UX 4GM8A 4JSXC 3EI1A 4QT8A 4Y5RD 2XYIA 4QQEA 5FXYA 3C75H 5TDHB 5TEFA 4A11B 4JSPC 4X60B 4ZOZA 4GGCA 4ZOXA 3SMRA 3OW8A 3EI3A 4J84A 1ERJA 2I3SA 4JSVC 2GC4A 3L4OD 2OJYA 3DSMA 2Z2PA 4QL1A 1B9XA 2YNOA 4CY3A 3AFCA 5SXMA 1JJUB 3DXMC 4J81A 4A2LA 2CN3A 2H6QA 4A0AB 4QRJA 2P9PC 3IIYA 5FKTA 5EM2A 5IJ8E 4CY5A 4YVDA 1SQ9A 4A08A 2IUPA 2IUQA 4JSNC 4PXWA 4E5ZA 2Z2NA 4IA9A 4IMMA 4PNKB 4BUJC 4O45A 5K1CC 4UI9R 1GP2B 2BBKH 4NSXA 3OKYA 4LG9A 5CXBA 5TF2A 4H5IA 1PBYB 4I79A 5I5MA 5IGQA 4ZOVA 2YNNA 2OVPB 2OVQB 4J0WA 5TEEA 4PBYA 3SBPA 5AFU3 3BG0A 3IJCA 2QC5A 4MK0B 5EAMA 3OKWA 3UVKA 4CI2A 3L4MD 4E54B 1N6FA 3GREA 4X61B 4FB1D 2PM9B 1K32A 4ERYA 5HE3B 4XYHA 3NVQA 1TYQC 2IWKA 3IKOA 4LG8A 4OWRA 3AL8B 4CZYA 2CO0C 3SHFA 3IJ0A 2HKRA 2J57G 4J8GA 2H47A 2AQ5A 5I5JA 3OL2A 5A2Qg 1FWXA 2XU7A 3FRXA 3BG1A 1N6EA 3F3FA 4PC0A 3RN0D 4O1QD 4JT6C 5CYKA 2H9MA 4D6VA 2HJBA 3V5WB 3VA6A 4BL0A 4EWRA 2CN2A 3JZHA 3JZGA 3UKUC 2O9KA 5GSAA 3N0DA 2H14A 2AH0A 2XL3A 3ULEC 3C5MA 1R5MA 1XIPA 1TBGA 1GXRA 3EMHA 2CNXA 2UZXB 1VYHC 3MKQA
chains in the Genus database with same CATH superfamily
3V7DB 3IJEA 2P9SC 4UM8A 4CZXA 3IURA 2TRCB 3MXXA 3ZDZA 2XZGA 3ZDXA 2P9NC 4GM9A 2VDOA 1NR0A 2H3XA 2HJ4A 3QI0A 2H9LA 2EIEA 3C9CA 4AMZA 5C9ZB 3EI2B 5IJ7E 3AH8B 3T3PA 2IUVA 1T2XA 3EI4A 3MZKA 1JMXB 3PVUB 1QFSA 2UZYB 3MZLA 3SXTD 5EMKB 2YB8B 3MKSB 2J56H 3AL9A 4CZVA 2VDRA 3JB9L 1A0RB 3SWSD 4BCDA 3PSLA 4D9SA 3K6SA 2XL2A 2HXCA 3K26A 3JZNA 4J86A 4J0XA 2W18A 2J55H 1JV2A 1OLZA 4CY2A 2CE8A 1PEVA 3JRPA 3UVNA 4H5JA 4BP9A 2AGLA 1YR2A 4A08B 2VDPA 1OMWB 4IRZA 3PSCB 2I0TA 3O4IA 4PSWB 1RI6A 4GQ2P 3FCUA 4R7AB 1QNIA 3JROA 3RSEC 3OKYB 2IAAA 3NIGA 5CXBB 4A09A 1VYHC 4PBZA 4O02A 2HU8A 4G1MA 2P9LC 4JD2C 2P9IC 3GFCA 4J82A 5EMJB 5HE1B 4CI8A 3V9FA 5IT9g 1A12A 3I7LA 1XKSA 4CI1A 2G9AA 4LGNA 3IUMA 3SBQA 4J73A 5C2VB 1UOQA 2OIZA 3I7KA 3N0EA 2PM7B 1O6FA 5GXIA 2H6NA 2BCJB 3EU7A 3VH0A 4A0AA 2VZ1A 5KDOB 5AJAA 1UOOA 3SN6B 4WJKA 1TYEA 1B9YA 1P22A 5FKSA 1U8CA 4ERZA 1SQJA 2HKMA 4HDJA 3KRXB 1SHYB 1JOFA 3I7OA 2OVRB 3I7HA 4U1EI 2JKXA 5CXCA 3IIWA 5EMLB 3SFZA 3I7NA 3OL2B 4A7JA 5HQGA 2OK6A 2GNQA 5E6SA 2VDNA 4NAAA 5CYKB 1JTDB 3DWLC 1K8KC 3KRWB 3I89A 1L5GA 1UOPA 5FA5B 4NC4A 4O3UB 3SLED 2AH1A 4L3HD 3HFQA 4JXMA 3V4PA 5JWZA 4E54A 4FA4D 4RE5A 2QR5A 4J87A 3C99A 4GM3A 3DM0A 3JAMg 5E6UA 4ZOYA 4CY1A 3FCSA 1PI6A 3IJ1A 4A0BA 4FA1D 5HE0B 3MVDK 3I8EA 1C9IA 5M5RA 4AEZA 2YBAA 3EWEA 2CO0A 3NVXA 3ZE2A 3EI4B 5C2WB 4KFMB 1GG2B 3IUNA 3W15A 2I3TA 4D0KA 3F3GA 5THAA 4L3GD 3CIKB 4GMBA 2B4EA 3P4FA 4BH6A 3ZE1A 3EI1B 5IGOA 3E0CA 3EQ8A 2HU5A 2H6KA 2YMUA 4AOWA 2B5MA 4DNWA 3F3PA 5HYNB 3PE7A 4FA9D 5EMMB 4L9OA 3CFSB 3EI3B 3RRMC 1YFQA 4ESGA 4O2WA 4J78A 3OF7A 2H9NA 4Z7QA 4QAMA 3MMYA 4FHLA 5FLXg 3VI3A 4O3TB 1C9LA 1K3IA 4RE6A 4JHNA 2AGYA 2I0SA 3ORVD 2EBSA 5FFOA 4AN1A 4ZN4A 3K27A 5EM2B 4U7AA 5H1MA 5FKQA 2QXVA 4PSXB 4X63B 3EI2A 3B7FA 3MUNA 1H2YA 4A09B 5GXHA 4WK4A 5M5VA 4E5ZB 1U4CA 5H14A 4NENA 3SJLD 5EAPA 2H13A 4UM9A 4A11A 3SVWD 4JHPC 3RFHA 1GOFA 2YNPA 3QHYB 3VI4A 2P9KC 5I5IA 3UVOA 3NVNA 1MG3A 2EIBA 3CFVA 2B5LA 5HDBA 2CE9A 5AMSA 4BCCA 3O4GA 1I2MB 3RLMD 3UR4A 1M1XA 2AGWA 4DNVA 4TZ4A 4J8BA 2I0RA 1XHMA 4AX4A 1NEXB 4G56B 3EG6A 4GGDA 3FGBA 4FAVD 3ODTA 2PM6B 5CXCB 2IWFA 4L1MA 3VGZA 2OK4A 2H9PA 4ES0A 5HE2B 5IC7A 2H68A 2G99A 4GGAA 4Z8LA 5FKRA 1Q47A 1VZ2A 3PXWD 2B5NA 4BCBA 3PVWB 5E6RA 3ZWLB 5EARA 3J81g 2HESX 3PXTD 1MDAH 1PGUA 1E5TA 3IULA 4FWWA 4L1QD 5H17A 2PBIB 2Q7QA 1E8NA 1N6DA 1BPOA 4BP8A 3U4YA 4GQ1A 4A0BB 3JPXA 2PM9A 1H2WA 2P9UC 3BWSA 5K19A 2XE4A 1GOGA 5GMKn 3ZE0A 3O4HA 3AL8A 4N14A 4J79A 2VC2A 4X3EA 5FQDA 3RN1D 3UVMA 5B4WA 3PXSD 2MTAH 4XYIA 4WK2A 3V4VA 5EALA 4Z7NA 4FA5D 2HYEA 4K3ID 1L0QA 4OZUA 3NIFA 3DXKC 3I7PA 3OTTA 1JMZB 3SCYA 4J77A 4FAND 4ERQA 1MG2A 3FM0A 2IURA 3OKTA 4MMZA 2Z2OA 4A2MA 3IUQA 2AGZA 2QZPA 4GQBB 3A0FA 3I8CA 3RMZD 3ZDYA 4WK0A 4NBMA 4CC9A 3SBRA 3UVLA 4CI3A 3I2NA 1VE7A 3J80g 4JT5C 3UKRC 1U2VC 3RFGA 2VDKA 4O9DA 4Y7RA 1QFMA 1GOTB 2AGXA 4XEIC 2GC7A 4K3JB 4GZ8A 1O6GA 3MUOA 1S4UX 2VZ3A 4GM8A 4AMYA 2VDQA 4JSXC 3EI1A 4QT8A 4Y5RD 2XYIA 4QQEA 5FXYA 3C75H 5TDHB 5TEFA 4A11B 4JSPC 4X60B 4ZOZA 4GGCA 1E8MA 4ZOXA 3SMRA 3OW8A 3EI3A 4J84A 1ERJA 2I3SA 4JSVC 2GC4A 1H2XA 3L4OD 2OJYA 3DSMA 3KCIA 2Z2PA 4QL1A 1B9XA 2YNOA 4CY3A 3AFCA 5SXMA 1JJUB 3DXMC 4J81A 4A2LA 3DDUA 2H6QA 4A0AB 4QRJA 2P9PC 3IIYA 4Z7OA 5FKTA 5EM2A 5IJ8E 4CY5A 4YVDA 2BKLA 1SQ9A 4A08A 3K72A 2IUPA 2IUQA 4JSNC 4AN0A 4PXWA 3EQ9A 4E5ZA 2Z2NA 4IA9A 4IMMA 4PNKB 4G1EA 4BUJC 1H2ZA 4O45A 2WQ8A 4UI9R 1GP2B 5K1CC 2BBKH 3O4JA 2VDLA 4NSXA 3OKYA 4LG9A 5CXBA 5TF2A 4H5IA 1PBYB 3GC3B 4I79A 4DNUA 4ZOVA 5I5MA 5IGQA 2YNNA 2OVPB 2OVQB 4J0WA 5TEEA 1VZ3A 4PBYA 5M5TA 3SBPA 5AFU3 3BG0A 3K71A 3IUJA 3IVMA 2XDWA 3IJCA 2QC5A 4MK0B 5EAMA 3OKWA 3UVKA 4CI2A 3L4MD 4E54B 4G55A 1N6FA 3GREA 4X61B 4FB1D 2PM9B 1K32A 5M61A 4ERYA 5HE3B 1GOHA 4XYHA 3NVQA 1TYQC 2IWKA 3IKOA 4LG8A 4OWRA 3AL8B 4MMYA 4CZYA 2CO0C 3SHFA 1VE6A 3IJ0A 2HKRA 2J57G 5C92A 4J8GA 2H47A 3GD1I 2AQ5A 5I5JA 3OL2A 5A2Qg 1FWXA 2XU7A 1UTCA 3FRXA 3BG1A 5C86A 1N6EA 2VDMA 3F3FA 4PC0A 3RN0D 4O1QD 4JT6C 5CYKA 2H9MA 4D6VA 2HJBA 3T3MA 3V5WB 3VA6A 4BL0A 4EWRA 5M5UA 2CN2A 3JZHA 5M5SA 3JZGA 3UKUC 2O9KA 2HU7A 5GSAA 3N0DA 2H14A 3NIDA 2AH0A 2EIDA 2XL3A 3ULEC 3C5MA 1R5MA 1XIPA 1TBGA 1GXRA 3EMHA 2CNXA 3EQ7A 2EICA 2UZXB 2CN3A 5FFGA 4MMXA 3MKQA
chains in the Genus database with same CATH topology
3V7DB 2P9SC 4CZXA 2TRCB 3MXXA 2P9NC 4GM9A 1NR0A 2H3XA 2HJ4A 2H9LA 3C9CA 5C9ZB 3EI2B 5IJ7E 3AH8B 2IUVA 3EI4A 3MZKA 1JMXB 3PVUB 2UZYB 3MZLA 3SXTD 5EMKB 2YB8B 3MKSB 2J56H 3AL9A 4CZVA 3JB9L 1A0RB 3SWSD 3PSLA 2XL2A 2HXCA 3K26A 3JZNA 4J86A 4J0XA 2W18A 2J55H 1OLZA 4CY2A 2CE8A 1PEVA 3JRPA 3UVNA 4H5JA 2AGLA 4A08B 1OMWB 3PSCB 2I0TA 4PSWB 1RI6A 4GQ2P 4R7AB 1QNIA 3JROA 3RSEC 3OKYB 2IAAA 5CXBB 4A09A 4PBZA 2P9LC 4JD2C 2P9IC 3GFCA 4J82A 5EMJB 5HE1B 4CI8A 3V9FA 5IT9g 3I7LA 1XKSA 4CI1A 2G9AA 4LGNA 3SBQA 4J73A 5C2VB 2OIZA 3I7KA 3N0EA 2PM7B 5GXIA 2H6NA 2BCJB 3EU7A 3VH0A 4A0AA 5KDOB 5AJAA 3SN6B 1B9YA 1P22A 5FKSA 4ERZA 1SQJA 2HKMA 4HDJA 3KRXB 1SHYB 1JOFA 3I7OA 2OVRB 3I7HA 4U1EI 5CXCA 3IIWA 5EMLB 3SFZA 3I7NA 3OL2B 4A7JA 5HQGA 2OK6A 2GNQA 5CYKB 3DWLC 1K8KC 3KRWB 3I89A 5FA5B 4O3UB 3SLED 2AH1A 4L3HD 3HFQA 4JXMA 5JWZA 4E54A 4FA4D 4J87A 3C99A 4GM3A 3DM0A 3JAMg 4ZOYA 4CY1A 1PI6A 3IJ1A 4A0BA 4FA1D 5HE0B 3I8EA 4AEZA 2YBAA 3EWEA 2CO0A 3NVXA 3EI4B 5C2WB 4KFMB 1GG2B 3W15A 2I3TA 4D0KA 3F3GA 5THAA 4L3GD 3CIKB 4GMBA 2B4EA 3P4FA 4BH6A 3EI1B 5IGOA 3E0CA 2H6KA 2YMUA 4AOWA 2B5MA 3F3PA 5HYNB 3PE7A 4FA9D 5EMMB 4L9OA 3CFSB 3EI3B 3RRMC 1YFQA 4ESGA 4J78A 2H9NA 3MMYA 4FHLA 5FLXg 4O3TB 2AGYA 2I0SA 3ORVD 2EBSA 4ZN4A 3K27A 5EM2B 4U7AA 5H1MA 5FKQA 2QXVA 4PSXB 4X63B 3EI2A 3B7FA 4A09B 5GXHA 4E5ZB 1U4CA 5H14A 3SJLD 5EAPA 2H13A 4A11A 3SVWD 3RFHA 2YNPA 2P9KC 5I5IA 3UVOA 3NVNA 1MG3A 3CFVA 2B5LA 2CE9A 5AMSA 3RLMD 3UR4A 2AGWA 4TZ4A 4J8BA 2I0RA 1XHMA 1NEXB 4G56B 3EG6A 4GGDA 3FGBA 4FAVD 3ODTA 2PM6B 5CXCB 2IWFA 3VGZA 2OK4A 2H9PA 4ES0A 5HE2B 5IC7A 2H68A 2G99A 4GGAA 4Z8LA 5FKRA 1Q47A 3PXWD 2B5NA 3PVWB 3ZWLB 5EARA 3J81g 2HESX 3PXTD 1MDAH 1PGUA 4FWWA 4L1QD 5H17A 2PBIB 2Q7QA 1N6DA 3U4YA 4GQ1A 4A0BB 3JPXA 2PM9A 5K19A 2P9UC 3BWSA 5GMKn 3AL8A 4N14A 4J79A 4X3EA 5FQDA 3RN1D 3UVMA 5B4WA 3PXSD 2MTAH 4XYIA 5EALA 4FA5D 2HYEA 4K3ID 1L0QA 4OZUA 3DXKC 3I7PA 3OTTA 1JMZB 3SCYA 4J77A 4FAND 4ERQA 1MG2A 3FM0A 2IURA 3OKTA 2Z2OA 4A2MA 2AGZA 4GQBB 3A0FA 3I8CA 3RMZD 4CC9A 3SBRA 3UVLA 4CI3A 3I2NA 3J80g 4JT5C 3UKRC 1U2VC 3RFGA 4O9DA 4Y7RA 1GOTB 2AGXA 4XEIC 2GC7A 4K3JB 4GZ8A 1S4UX 4GM8A 4JSXC 3EI1A 4QT8A 4Y5RD 2XYIA 4QQEA 5FXYA 3C75H 5TDHB 5TEFA 4A11B 4JSPC 4X60B 4ZOZA 4GGCA 4ZOXA 3SMRA 3OW8A 3EI3A 4J84A 1ERJA 2I3SA 4JSVC 2GC4A 3L4OD 2OJYA 3DSMA 2Z2PA 4QL1A 1B9XA 2YNOA 4CY3A 3AFCA 5SXMA 1JJUB 3DXMC 4J81A 4A2LA 2CN3A 2H6QA 4A0AB 4QRJA 2P9PC 3IIYA 5FKTA 5EM2A 5IJ8E 4CY5A 4YVDA 1SQ9A 4A08A 2IUPA 2IUQA 4JSNC 4PXWA 4E5ZA 2Z2NA 4IA9A 4IMMA 4PNKB 4BUJC 4O45A 5K1CC 4UI9R 1GP2B 2BBKH 4NSXA 3OKYA 4LG9A 5CXBA 5TF2A 4H5IA 1PBYB 4I79A 5I5MA 5IGQA 4ZOVA 2YNNA 2OVPB 2OVQB 4J0WA 5TEEA 4PBYA 3SBPA 5AFU3 3BG0A 3IJCA 2QC5A 4MK0B 5EAMA 3OKWA 3UVKA 4CI2A 3L4MD 4E54B 1N6FA 3GREA 4X61B 4FB1D 2PM9B 1K32A 4ERYA 5HE3B 4XYHA 3NVQA 1TYQC 2IWKA 3IKOA 4LG8A 4OWRA 3AL8B 4CZYA 2CO0C 3SHFA 3IJ0A 2HKRA 2J57G 4J8GA 2H47A 2AQ5A 5I5JA 3OL2A 5A2Qg 1FWXA 2XU7A 3FRXA 3BG1A 1N6EA 3F3FA 4PC0A 3RN0D 4O1QD 4JT6C 5CYKA 2H9MA 4D6VA 2HJBA 3V5WB 3VA6A 4BL0A 4EWRA 2CN2A 3JZHA 3JZGA 3UKUC 2O9KA 5GSAA 3N0DA 2H14A 2AH0A 2XL3A 3ULEC 3C5MA 1R5MA 1XIPA 1TBGA 1GXRA 3EMHA 2CNXA 2UZXB 1VYHC 3MKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7D B;  2P9S C;  4CZX A;  2TRC B;  3MXX A;  2P9N C;  4GM9 A;  1NR0 A;  2H3X A;  2HJ4 A;  2H9L A;  3C9C A;  5C9Z B;  3EI2 B;  5IJ7 E;  3AH8 B;  2IUV A;  3EI4 A;  3MZK A;  1JMX B;  3PVU B;  2UZY B;  3MZL A;  3SXT D;  5EMK B;  2YB8 B;  3MKS B;  2J56 H;  3AL9 A;  4CZV A;  3JB9 L;  1A0R B;  3SWS D;  3PSL A;  2XL2 A;  2HXC A;  3K26 A;  3JZN A;  4J86 A;  4J0X A;  2W18 A;  2J55 H;  1OLZ A;  4CY2 A;  2CE8 A;  1PEV A;  3JRP A;  3UVN A;  4H5J A;  2AGL A;  4A08 B;  1OMW B;  3PSC B;  2I0T A;  4PSW B;  1RI6 A;  4GQ2 P;  4R7A B;  1QNI A;  3JRO A;  3RSE C;  3OKY B;  2IAA A;  5CXB B;  4A09 A;  4PBZ A;  2P9L C;  4JD2 C;  2P9I C;  3GFC A;  4J82 A;  5EMJ B;  5HE1 B;  4CI8 A;  3V9F A;  5IT9 g;  3I7L A;  1XKS A;  4CI1 A;  2G9A A;  4LGN A;  3SBQ A;  4J73 A;  5C2V B;  2OIZ A;  3I7K A;  3N0E A;  2PM7 B;  5GXI A;  2H6N A;  2BCJ B;  3EU7 A;  3VH0 A;  4A0A A;  5KDO B;  5AJA A;  3SN6 B;  1B9Y A;  1P22 A;  5FKS A;  4ERZ A;  1SQJ A;  2HKM A;  4HDJ A;  3KRX B;  1SHY B;  1JOF A;  3I7O A;  2OVR B;  3I7H A;  4U1E I;  5CXC A;  3IIW A;  5EML B;  3SFZ A;  3I7N A;  3OL2 B;  4A7J A;  5HQG A;  2OK6 A;  2GNQ A;  5CYK B;  3DWL C;  1K8K C;  3KRW B;  3I89 A;  5FA5 B;  4O3U B;  3SLE D;  2AH1 A;  4L3H D;  3HFQ A;  4JXM A;  5JWZ A;  4E54 A;  4FA4 D;  4J87 A;  3C99 A;  4GM3 A;  3DM0 A;  3JAM g;  4ZOY A;  4CY1 A;  1PI6 A;  3IJ1 A;  4A0B A;  4FA1 D;  5HE0 B;  3I8E A;  4AEZ A;  2YBA A;  3EWE A;  2CO0 A;  3NVX A;  3EI4 B;  5C2W B;  4KFM B;  1GG2 B;  3W15 A;  2I3T A;  4D0K A;  3F3G A;  5THA A;  4L3G D;  3CIK B;  4GMB A;  2B4E A;  3P4F A;  4BH6 A;  3EI1 B;  5IGO A;  3E0C A;  2H6K A;  2YMU A;  4AOW A;  2B5M A;  3F3P A;  5HYN B;  3PE7 A;  4FA9 D;  5EMM B;  4L9O A;  3CFS B;  3EI3 B;  3RRM C;  1YFQ A;  4ESG A;  4J78 A;  2H9N A;  3MMY A;  4FHL A;  5FLX g;  4O3T B;  2AGY A;  2I0S A;  3ORV D;  2EBS A;  4ZN4 A;  3K27 A;  5EM2 B;  4U7A A;  5H1M A;  5FKQ A;  2QXV A;  4PSX B;  4X63 B;  3EI2 A;  3B7F A;  4A09 B;  5GXH A;  4E5Z B;  1U4C A;  5H14 A;  3SJL D;  5EAP A;  2H13 A;  4A11 A;  3SVW D;  3RFH A;  2YNP A;  2P9K C;  5I5I A;  3UVO A;  3NVN A;  1MG3 A;  3CFV A;  2B5L A;  2CE9 A;  5AMS A;  3RLM D;  3UR4 A;  2AGW A;  4TZ4 A;  4J8B A;  2I0R A;  1XHM A;  1NEX B;  4G56 B;  3EG6 A;  4GGD A;  3FGB A;  4FAV D;  3ODT A;  2PM6 B;  5CXC B;  2IWF A;  3VGZ A;  2OK4 A;  2H9P A;  4ES0 A;  5HE2 B;  5IC7 A;  2H68 A;  2G99 A;  4GGA A;  4Z8L A;  5FKR A;  1Q47 A;  3PXW D;  2B5N A;  3PVW B;  3ZWL B;  5EAR A;  3J81 g;  2HES X;  3PXT D;  1MDA H;  1PGU A;  4FWW A;  4L1Q D;  5H17 A;  2PBI B;  2Q7Q A;  1N6D A;  3U4Y A;  4GQ1 A;  4A0B B;  3JPX A;  2PM9 A;  5K19 A;  2P9U C;  3BWS A;  5GMK n;  3AL8 A;  4N14 A;  4J79 A;  4X3E A;  5FQD A;  3RN1 D;  3UVM A;  5B4W A;  3PXS D;  2MTA H;  4XYI A;  5EAL A;  4FA5 D;  2HYE A;  4K3I D;  1L0Q A;  4OZU A;  3DXK C;  3I7P A;  3OTT A;  1JMZ B;  3SCY A;  4J77 A;  4FAN D;  4ERQ A;  1MG2 A;  3FM0 A;  2IUR A;  3OKT A;  2Z2O A;  4A2M A;  2AGZ A;  4GQB B;  3A0F A;  3I8C A;  3RMZ D;  4CC9 A;  3SBR A;  3UVL A;  4CI3 A;  3I2N A;  3J80 g;  4JT5 C;  3UKR C;  1U2V C;  3RFG A;  4O9D A;  4Y7R A;  1GOT B;  2AGX A;  4XEI C;  2GC7 A;  4K3J B;  4GZ8 A;  1S4U X;  4GM8 A;  4JSX C;  3EI1 A;  4QT8 A;  4Y5R D;  2XYI A;  4QQE A;  5FXY A;  3C75 H;  5TDH B;  5TEF A;  4A11 B;  4JSP C;  4X60 B;  4ZOZ A;  4GGC A;  4ZOX A;  3SMR A;  3OW8 A;  3EI3 A;  4J84 A;  1ERJ A;  2I3S A;  4JSV C;  2GC4 A;  3L4O D;  2OJY A;  3DSM A;  2Z2P A;  4QL1 A;  1B9X A;  2YNO A;  4CY3 A;  3AFC A;  5SXM A;  1JJU B;  3DXM C;  4J81 A;  4A2L A;  2CN3 A;  2H6Q A;  4A0A B;  4QRJ A;  2P9P C;  3IIY A;  5FKT A;  5EM2 A;  5IJ8 E;  4CY5 A;  4YVD A;  1SQ9 A;  4A08 A;  2IUP A;  2IUQ A;  4JSN C;  4PXW A;  4E5Z A;  2Z2N A;  4IA9 A;  4IMM A;  4PNK B;  4BUJ C;  4O45 A;  5K1C C;  4UI9 R;  1GP2 B;  2BBK H;  4NSX A;  3OKY A;  4LG9 A;  5CXB A;  5TF2 A;  4H5I A;  1PBY B;  4I79 A;  5I5M A;  5IGQ A;  4ZOV A;  2YNN A;  2OVP B;  2OVQ B;  4J0W A;  5TEE A;  4PBY A;  3SBP A;  5AFU 3;  3BG0 A;  3IJC A;  2QC5 A;  4MK0 B;  5EAM A;  3OKW A;  3UVK A;  4CI2 A;  3L4M D;  4E54 B;  1N6F A;  3GRE A;  4X61 B;  4FB1 D;  2PM9 B;  1K32 A;  4ERY A;  5HE3 B;  4XYH A;  3NVQ A;  1TYQ C;  2IWK A;  3IKO A;  4LG8 A;  4OWR A;  3AL8 B;  4CZY A;  2CO0 C;  3SHF A;  3IJ0 A;  2HKR A;  2J57 G;  4J8G A;  2H47 A;  2AQ5 A;  5I5J A;  3OL2 A;  5A2Q g;  1FWX A;  2XU7 A;  3FRX A;  3BG1 A;  1N6E A;  3F3F A;  4PC0 A;  3RN0 D;  4O1Q D;  4JT6 C;  5CYK A;  2H9M A;  4D6V A;  2HJB A;  3V5W B;  3VA6 A;  4BL0 A;  4EWR A;  2CN2 A;  3JZH A;  3JZG A;  3UKU C;  2O9K A;  5GSA A;  3N0D A;  2H14 A;  2AH0 A;  2XL3 A;  3ULE C;  3C5M A;  1R5M A;  1XIP A;  1TBG A;  1GXR A;  3EMH A;  2CNX A;  2UZX B;  1VYH C;  3MKQ A; 
#chains in the Genus database with same CATH topology
 3V7D B;  3IJE A;  2P9S C;  4UM8 A;  4CZX A;  3IUR A;  2TRC B;  3MXX A;  3ZDZ A;  2XZG A;  3ZDX A;  2P9N C;  4GM9 A;  2VDO A;  1NR0 A;  2H3X A;  2HJ4 A;  3QI0 A;  2H9L A;  2EIE A;  3C9C A;  4AMZ A;  5C9Z B;  3EI2 B;  5IJ7 E;  3AH8 B;  3T3P A;  2IUV A;  1T2X A;  3EI4 A;  3MZK A;  1JMX B;  3PVU B;  1QFS A;  2UZY B;  3MZL A;  3SXT D;  5EMK B;  2YB8 B;  3MKS B;  2J56 H;  3AL9 A;  4CZV A;  2VDR A;  3JB9 L;  1A0R B;  3SWS D;  4BCD A;  3PSL A;  4D9S A;  3K6S A;  2XL2 A;  2HXC A;  3K26 A;  3JZN A;  4J86 A;  4J0X A;  2W18 A;  2J55 H;  1JV2 A;  1OLZ A;  4CY2 A;  2CE8 A;  1PEV A;  3JRP A;  3UVN A;  4H5J A;  4BP9 A;  2AGL A;  1YR2 A;  4A08 B;  2VDP A;  1OMW B;  4IRZ A;  3PSC B;  2I0T A;  3O4I A;  4PSW B;  1RI6 A;  4GQ2 P;  3FCU A;  4R7A B;  1QNI A;  3JRO A;  3RSE C;  3OKY B;  2IAA A;  3NIG A;  5CXB B;  4A09 A;  1VYH C;  4PBZ A;  4O02 A;  2HU8 A;  4G1M A;  2P9L C;  4JD2 C;  2P9I C;  3GFC A;  4J82 A;  5EMJ B;  5HE1 B;  4CI8 A;  3V9F A;  5IT9 g;  1A12 A;  3I7L A;  1XKS A;  4CI1 A;  2G9A A;  4LGN A;  3IUM A;  3SBQ A;  4J73 A;  5C2V B;  1UOQ A;  2OIZ A;  3I7K A;  3N0E A;  2PM7 B;  1O6F A;  5GXI A;  2H6N A;  2BCJ B;  3EU7 A;  3VH0 A;  4A0A A;  2VZ1 A;  5KDO B;  5AJA A;  1UOO A;  3SN6 B;  4WJK A;  1TYE A;  1B9Y A;  1P22 A;  5FKS A;  1U8C A;  4ERZ A;  1SQJ A;  2HKM A;  4HDJ A;  3KRX B;  1SHY B;  1JOF A;  3I7O A;  2OVR B;  3I7H A;  4U1E I;  2JKX A;  5CXC A;  3IIW A;  5EML B;  3SFZ A;  3I7N A;  3OL2 B;  4A7J A;  5HQG A;  2OK6 A;  2GNQ A;  5E6S A;  2VDN A;  4NAA A;  5CYK B;  1JTD B;  3DWL C;  1K8K C;  3KRW B;  3I89 A;  1L5G A;  1UOP A;  5FA5 B;  4NC4 A;  4O3U B;  3SLE D;  2AH1 A;  4L3H D;  3HFQ A;  4JXM A;  3V4P A;  5JWZ A;  4E54 A;  4FA4 D;  4RE5 A;  2QR5 A;  4J87 A;  3C99 A;  4GM3 A;  3DM0 A;  3JAM g;  5E6U A;  4ZOY A;  4CY1 A;  3FCS A;  1PI6 A;  3IJ1 A;  4A0B A;  4FA1 D;  5HE0 B;  3MVD K;  3I8E A;  1C9I A;  5M5R A;  4AEZ A;  2YBA A;  3EWE A;  2CO0 A;  3NVX A;  3ZE2 A;  3EI4 B;  5C2W B;  4KFM B;  1GG2 B;  3IUN A;  3W15 A;  2I3T A;  4D0K A;  3F3G A;  5THA A;  4L3G D;  3CIK B;  4GMB A;  2B4E A;  3P4F A;  4BH6 A;  3ZE1 A;  3EI1 B;  5IGO A;  3E0C A;  3EQ8 A;  2HU5 A;  2H6K A;  2YMU A;  4AOW A;  2B5M A;  4DNW A;  3F3P A;  5HYN B;  3PE7 A;  4FA9 D;  5EMM B;  4L9O A;  3CFS B;  3EI3 B;  3RRM C;  1YFQ A;  4ESG A;  4O2W A;  4J78 A;  3OF7 A;  2H9N A;  4Z7Q A;  4QAM A;  3MMY A;  4FHL A;  5FLX g;  3VI3 A;  4O3T B;  1C9L A;  1K3I A;  4RE6 A;  4JHN A;  2AGY A;  2I0S A;  3ORV D;  2EBS A;  5FFO A;  4AN1 A;  4ZN4 A;  3K27 A;  5EM2 B;  4U7A A;  5H1M A;  5FKQ A;  2QXV A;  4PSX B;  4X63 B;  3EI2 A;  3B7F A;  3MUN A;  1H2Y A;  4A09 B;  5GXH A;  4WK4 A;  5M5V A;  4E5Z B;  1U4C A;  5H14 A;  4NEN A;  3SJL D;  5EAP A;  2H13 A;  4UM9 A;  4A11 A;  3SVW D;  4JHP C;  3RFH A;  1GOF A;  2YNP A;  3QHY B;  3VI4 A;  2P9K C;  5I5I A;  3UVO A;  3NVN A;  1MG3 A;  2EIB A;  3CFV A;  2B5L A;  5HDB A;  2CE9 A;  5AMS A;  4BCC A;  3O4G A;  1I2M B;  3RLM D;  3UR4 A;  1M1X A;  2AGW A;  4DNV A;  4TZ4 A;  4J8B A;  2I0R A;  1XHM A;  4AX4 A;  1NEX B;  4G56 B;  3EG6 A;  4GGD A;  3FGB A;  4FAV D;  3ODT A;  2PM6 B;  5CXC B;  2IWF A;  4L1M A;  3VGZ A;  2OK4 A;  2H9P A;  4ES0 A;  5HE2 B;  5IC7 A;  2H68 A;  2G99 A;  4GGA A;  4Z8L A;  5FKR A;  1Q47 A;  1VZ2 A;  3PXW D;  2B5N A;  4BCB A;  3PVW B;  5E6R A;  3ZWL B;  5EAR A;  3J81 g;  2HES X;  3PXT D;  1MDA H;  1PGU A;  1E5T A;  3IUL A;  4FWW A;  4L1Q D;  5H17 A;  2PBI B;  2Q7Q A;  1E8N A;  1N6D A;  1BPO A;  4BP8 A;  3U4Y A;  4GQ1 A;  4A0B B;  3JPX A;  2PM9 A;  1H2W A;  2P9U C;  3BWS A;  5K19 A;  2XE4 A;  1GOG A;  5GMK n;  3ZE0 A;  3O4H A;  3AL8 A;  4N14 A;  4J79 A;  2VC2 A;  4X3E A;  5FQD A;  3RN1 D;  3UVM A;  5B4W A;  3PXS D;  2MTA H;  4XYI A;  4WK2 A;  3V4V A;  5EAL A;  4Z7N A;  4FA5 D;  2HYE A;  4K3I D;  1L0Q A;  4OZU A;  3NIF A;  3DXK C;  3I7P A;  3OTT A;  1JMZ B;  3SCY A;  4J77 A;  4FAN D;  4ERQ A;  1MG2 A;  3FM0 A;  2IUR A;  3OKT A;  4MMZ A;  2Z2O A;  4A2M A;  3IUQ A;  2AGZ A;  2QZP A;  4GQB B;  3A0F A;  3I8C A;  3RMZ D;  3ZDY A;  4WK0 A;  4NBM A;  4CC9 A;  3SBR A;  3UVL A;  4CI3 A;  3I2N A;  1VE7 A;  3J80 g;  4JT5 C;  3UKR C;  1U2V C;  3RFG A;  2VDK A;  4O9D A;  4Y7R A;  1QFM A;  1GOT B;  2AGX A;  4XEI C;  2GC7 A;  4K3J B;  4GZ8 A;  1O6G A;  3MUO A;  1S4U X;  2VZ3 A;  4GM8 A;  4AMY A;  2VDQ A;  4JSX C;  3EI1 A;  4QT8 A;  4Y5R D;  2XYI A;  4QQE A;  5FXY A;  3C75 H;  5TDH B;  5TEF A;  4A11 B;  4JSP C;  4X60 B;  4ZOZ A;  4GGC A;  1E8M A;  4ZOX A;  3SMR A;  3OW8 A;  3EI3 A;  4J84 A;  1ERJ A;  2I3S A;  4JSV C;  2GC4 A;  1H2X A;  3L4O D;  2OJY A;  3DSM A;  3KCI A;  2Z2P A;  4QL1 A;  1B9X A;  2YNO A;  4CY3 A;  3AFC A;  5SXM A;  1JJU B;  3DXM C;  4J81 A;  4A2L A;  3DDU A;  2H6Q A;  4A0A B;  4QRJ A;  2P9P C;  3IIY A;  4Z7O A;  5FKT A;  5EM2 A;  5IJ8 E;  4CY5 A;  4YVD A;  2BKL A;  1SQ9 A;  4A08 A;  3K72 A;  2IUP A;  2IUQ A;  4JSN C;  4AN0 A;  4PXW A;  3EQ9 A;  4E5Z A;  2Z2N A;  4IA9 A;  4IMM A;  4PNK B;  4G1E A;  4BUJ C;  1H2Z A;  4O45 A;  2WQ8 A;  4UI9 R;  1GP2 B;  5K1C C;  2BBK H;  3O4J A;  2VDL A;  4NSX A;  3OKY A;  4LG9 A;  5CXB A;  5TF2 A;  4H5I A;  1PBY B;  3GC3 B;  4I79 A;  4DNU A;  4ZOV A;  5I5M A;  5IGQ A;  2YNN A;  2OVP B;  2OVQ B;  4J0W A;  5TEE A;  1VZ3 A;  4PBY A;  5M5T A;  3SBP A;  5AFU 3;  3BG0 A;  3K71 A;  3IUJ A;  3IVM A;  2XDW A;  3IJC A;  2QC5 A;  4MK0 B;  5EAM A;  3OKW A;  3UVK A;  4CI2 A;  3L4M D;  4E54 B;  4G55 A;  1N6F A;  3GRE A;  4X61 B;  4FB1 D;  2PM9 B;  1K32 A;  5M61 A;  4ERY A;  5HE3 B;  1GOH A;  4XYH A;  3NVQ A;  1TYQ C;  2IWK A;  3IKO A;  4LG8 A;  4OWR A;  3AL8 B;  4MMY A;  4CZY A;  2CO0 C;  3SHF A;  1VE6 A;  3IJ0 A;  2HKR A;  2J57 G;  5C92 A;  4J8G A;  2H47 A;  3GD1 I;  2AQ5 A;  5I5J A;  3OL2 A;  5A2Q g;  1FWX A;  2XU7 A;  1UTC A;  3FRX A;  3BG1 A;  5C86 A;  1N6E A;  2VDM A;  3F3F A;  4PC0 A;  3RN0 D;  4O1Q D;  4JT6 C;  5CYK A;  2H9M A;  4D6V A;  2HJB A;  3T3M A;  3V5W B;  3VA6 A;  4BL0 A;  4EWR A;  5M5U A;  2CN2 A;  3JZH A;  5M5S A;  3JZG A;  3UKU C;  2O9K A;  2HU7 A;  5GSA A;  3N0D A;  2H14 A;  3NID A;  2AH0 A;  2EID A;  2XL3 A;  3ULE C;  3C5M A;  1R5M A;  1XIP A;  1TBG A;  1GXR A;  3EMH A;  2CNX A;  3EQ7 A;  2EIC A;  2UZX B;  2CN3 A;  5FFG A;  4MMX A;  3MKQ A; 
#chains in the Genus database with same CATH homology
 3V7D B;  2P9S C;  4CZX A;  2TRC B;  3MXX A;  2P9N C;  4GM9 A;  1NR0 A;  2H3X A;  2HJ4 A;  2H9L A;  3C9C A;  5C9Z B;  3EI2 B;  5IJ7 E;  3AH8 B;  2IUV A;  3EI4 A;  3MZK A;  1JMX B;  3PVU B;  2UZY B;  3MZL A;  3SXT D;  5EMK B;  2YB8 B;  3MKS B;  2J56 H;  3AL9 A;  4CZV A;  3JB9 L;  1A0R B;  3SWS D;  3PSL A;  2XL2 A;  2HXC A;  3K26 A;  3JZN A;  4J86 A;  4J0X A;  2W18 A;  2J55 H;  1OLZ A;  4CY2 A;  2CE8 A;  1PEV A;  3JRP A;  3UVN A;  4H5J A;  2AGL A;  4A08 B;  1OMW B;  3PSC B;  2I0T A;  4PSW B;  1RI6 A;  4GQ2 P;  4R7A B;  1QNI A;  3JRO A;  3RSE C;  3OKY B;  2IAA A;  5CXB B;  4A09 A;  4PBZ A;  2P9L C;  4JD2 C;  2P9I C;  3GFC A;  4J82 A;  5EMJ B;  5HE1 B;  4CI8 A;  3V9F A;  5IT9 g;  3I7L A;  1XKS A;  4CI1 A;  2G9A A;  4LGN A;  3SBQ A;  4J73 A;  5C2V B;  2OIZ A;  3I7K A;  3N0E A;  2PM7 B;  5GXI A;  2H6N A;  2BCJ B;  3EU7 A;  3VH0 A;  4A0A A;  5KDO B;  5AJA A;  3SN6 B;  1B9Y A;  1P22 A;  5FKS A;  4ERZ A;  1SQJ A;  2HKM A;  4HDJ A;  3KRX B;  1SHY B;  1JOF A;  3I7O A;  2OVR B;  3I7H A;  4U1E I;  5CXC A;  3IIW A;  5EML B;  3SFZ A;  3I7N A;  3OL2 B;  4A7J A;  5HQG A;  2OK6 A;  2GNQ A;  5CYK B;  3DWL C;  1K8K C;  3KRW B;  3I89 A;  5FA5 B;  4O3U B;  3SLE D;  2AH1 A;  4L3H D;  3HFQ A;  4JXM A;  5JWZ A;  4E54 A;  4FA4 D;  4J87 A;  3C99 A;  4GM3 A;  3DM0 A;  3JAM g;  4ZOY A;  4CY1 A;  1PI6 A;  3IJ1 A;  4A0B A;  4FA1 D;  5HE0 B;  3I8E A;  4AEZ A;  2YBA A;  3EWE A;  2CO0 A;  3NVX A;  3EI4 B;  5C2W B;  4KFM B;  1GG2 B;  3W15 A;  2I3T A;  4D0K A;  3F3G A;  5THA A;  4L3G D;  3CIK B;  4GMB A;  2B4E A;  3P4F A;  4BH6 A;  3EI1 B;  5IGO A;  3E0C A;  2H6K A;  2YMU A;  4AOW A;  2B5M A;  3F3P A;  5HYN B;  3PE7 A;  4FA9 D;  5EMM B;  4L9O A;  3CFS B;  3EI3 B;  3RRM C;  1YFQ A;  4ESG A;  4J78 A;  2H9N A;  3MMY A;  4FHL A;  5FLX g;  4O3T B;  2AGY A;  2I0S A;  3ORV D;  2EBS A;  4ZN4 A;  3K27 A;  5EM2 B;  4U7A A;  5H1M A;  5FKQ A;  2QXV A;  4PSX B;  4X63 B;  3EI2 A;  3B7F A;  4A09 B;  5GXH A;  4E5Z B;  1U4C A;  5H14 A;  3SJL D;  5EAP A;  2H13 A;  4A11 A;  3SVW D;  3RFH A;  2YNP A;  2P9K C;  5I5I A;  3UVO A;  3NVN A;  1MG3 A;  3CFV A;  2B5L A;  2CE9 A;  5AMS A;  3RLM D;  3UR4 A;  2AGW A;  4TZ4 A;  4J8B A;  2I0R A;  1XHM A;  1NEX B;  4G56 B;  3EG6 A;  4GGD A;  3FGB A;  4FAV D;  3ODT A;  2PM6 B;  5CXC B;  2IWF A;  3VGZ A;  2OK4 A;  2H9P A;  4ES0 A;  5HE2 B;  5IC7 A;  2H68 A;  2G99 A;  4GGA A;  4Z8L A;  5FKR A;  1Q47 A;  3PXW D;  2B5N A;  3PVW B;  3ZWL B;  5EAR A;  3J81 g;  2HES X;  3PXT D;  1MDA H;  1PGU A;  4FWW A;  4L1Q D;  5H17 A;  2PBI B;  2Q7Q A;  1N6D A;  3U4Y A;  4GQ1 A;  4A0B B;  3JPX A;  2PM9 A;  5K19 A;  2P9U C;  3BWS A;  5GMK n;  3AL8 A;  4N14 A;  4J79 A;  4X3E A;  5FQD A;  3RN1 D;  3UVM A;  5B4W A;  3PXS D;  2MTA H;  4XYI A;  5EAL A;  4FA5 D;  2HYE A;  4K3I D;  1L0Q A;  4OZU A;  3DXK C;  3I7P A;  3OTT A;  1JMZ B;  3SCY A;  4J77 A;  4FAN D;  4ERQ A;  1MG2 A;  3FM0 A;  2IUR A;  3OKT A;  2Z2O A;  4A2M A;  2AGZ A;  4GQB B;  3A0F A;  3I8C A;  3RMZ D;  4CC9 A;  3SBR A;  3UVL A;  4CI3 A;  3I2N A;  3J80 g;  4JT5 C;  3UKR C;  1U2V C;  3RFG A;  4O9D A;  4Y7R A;  1GOT B;  2AGX A;  4XEI C;  2GC7 A;  4K3J B;  4GZ8 A;  1S4U X;  4GM8 A;  4JSX C;  3EI1 A;  4QT8 A;  4Y5R D;  2XYI A;  4QQE A;  5FXY A;  3C75 H;  5TDH B;  5TEF A;  4A11 B;  4JSP C;  4X60 B;  4ZOZ A;  4GGC A;  4ZOX A;  3SMR A;  3OW8 A;  3EI3 A;  4J84 A;  1ERJ A;  2I3S A;  4JSV C;  2GC4 A;  3L4O D;  2OJY A;  3DSM A;  2Z2P A;  4QL1 A;  1B9X A;  2YNO A;  4CY3 A;  3AFC A;  5SXM A;  1JJU B;  3DXM C;  4J81 A;  4A2L A;  2CN3 A;  2H6Q A;  4A0A B;  4QRJ A;  2P9P C;  3IIY A;  5FKT A;  5EM2 A;  5IJ8 E;  4CY5 A;  4YVD A;  1SQ9 A;  4A08 A;  2IUP A;  2IUQ A;  4JSN C;  4PXW A;  4E5Z A;  2Z2N A;  4IA9 A;  4IMM A;  4PNK B;  4BUJ C;  4O45 A;  5K1C C;  4UI9 R;  1GP2 B;  2BBK H;  4NSX A;  3OKY A;  4LG9 A;  5CXB A;  5TF2 A;  4H5I A;  1PBY B;  4I79 A;  5I5M A;  5IGQ A;  4ZOV A;  2YNN A;  2OVP B;  2OVQ B;  4J0W A;  5TEE A;  4PBY A;  3SBP A;  5AFU 3;  3BG0 A;  3IJC A;  2QC5 A;  4MK0 B;  5EAM A;  3OKW A;  3UVK A;  4CI2 A;  3L4M D;  4E54 B;  1N6F A;  3GRE A;  4X61 B;  4FB1 D;  2PM9 B;  1K32 A;  4ERY A;  5HE3 B;  4XYH A;  3NVQ A;  1TYQ C;  2IWK A;  3IKO A;  4LG8 A;  4OWR A;  3AL8 B;  4CZY A;  2CO0 C;  3SHF A;  3IJ0 A;  2HKR A;  2J57 G;  4J8G A;  2H47 A;  2AQ5 A;  5I5J A;  3OL2 A;  5A2Q g;  1FWX A;  2XU7 A;  3FRX A;  3BG1 A;  1N6E A;  3F3F A;  4PC0 A;  3RN0 D;  4O1Q D;  4JT6 C;  5CYK A;  2H9M A;  4D6V A;  2HJB A;  3V5W B;  3VA6 A;  4BL0 A;  4EWR A;  2CN2 A;  3JZH A;  3JZG A;  3UKU C;  2O9K A;  5GSA A;  3N0D A;  2H14 A;  2AH0 A;  2XL3 A;  3ULE C;  3C5M A;  1R5M A;  1XIP A;  1TBG A;  1GXR A;  3EMH A;  2CNX A;  2UZX B;  1VYH C;  3MKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...