4JSNC

Structure of mtordeltan-mlst8 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jsnC01
5K19A 2PBIB 1JOFA 4GMBA 4FAVD 4L3GD 3SLED 1N6FA 3JB9L 4A08A 3J81g 3AH8B 3V7DB 3OKTA 2AGWA 4J82A 1XHMA 2PM9B 2J57G 1YFQA 5IT9g 3DM0A 4O3TB 4PSWB 4PC0A 3UVNA 3SN6B 2P9LC 2AH0A 4J0WA 4H5IA 4L1QD 5TDHB 1GOTB 3P4FA 4PXWA 2G99A 3OKYA 3UVKA 4D0KA 3PXWD 4GQBB 3RN1D 4ESGA 2YNOA 4CY5A 4J0XA 5IGOA 3F3FA 5EM2B 2H9LA 1K8KC 3DXKC 3N0EA 2IUPA 3N0DA 1QNIA 1NEXB 4GQ1A 4FHLA 5C9ZB 3UVMA 3UVOA 4J8GA 4FB1D 4FA5D 4X60B 5JWZA 4XYIA 2H68A 3W15A 3PE7A 2HESX 3SVWD 3ORVD 3UR4A 4A08B 3JAMg 4PSXB 4YVDA 4EWRA 5FKRA 5CYKA 5H1MA 3JPXA 2OVPB 1RI6A 3IJCA 1TYQC 1PI6A 4QQEA 3AL8A 4N14A 4X61B 4LG9A 4A2LA 4IA9A 3C99A 3OKYB 5TEFA 1PGUA 3PXTD 2PM9A 1SHYB 2I0SA 1U2VC 3RFGA 2P9KC 3AFCA 5K1CC 1FWXA 5FQDA 2CN3A 5I5JA 2CE9A 2I0TA 4PBYA 2IURA 3OTTA 3DWLC 3IJ0A 2YBAA 4JSNC 4Y7RA 2CNXA 4R7AB 4CZVA 2XL3A 3EI4A 4NSXA 2P9PC 4BL0A 3UKRC 4O45A 1L0QA 4ZOVA 3PVUB 3CFVA 2PM7B 4PNKB 3I7NA 3OL2A 5I5IA 5HE1B 4K3ID 2P9IC 5CYKB 3SCYA 4JSXC 5FKTA 3JRPA 2P9NC 5H14A 3RRMC 3AL8B 5H17A 2IUQA 1B9XA 3ODTA 4GGCA 1R5MA 3FGBA 3E0CA 2AGXA 2Q7QA 5IC7A 4CI8A 3SXTD 5AJAA 3OKWA 3EI2A 1OLZA 2OVQB 1N6EA 1MDAH 5FLXg 4CI3A 4A2MA 3K26A 4CZYA 3IIWA 2B5LA 3JZNA 3EI4B 4UI9R 2XU7A 3UVLA 4FA1D 4JD2C 2CN2A 1N6DA 2IUVA 1JJUB 2HKMA 4JSVC 3EI3A 3OL2B 4FWWA 4JXMA 4QL1A 5C2VB 2H14A 2H13A 2AGLA 5HE2B 1MG3A 4CY3A 2H3XA 3VGZA 2HKRA 4GGAA 5A2Qg 5EARA 3AL9A 1B9YA 3I2NA 2HXCA 4H5JA 4J78A 3RSEC 3ULEC 5IJ7E 5EMJB 5EAPA 5AMSA 3V9FA 4ZN4A 3K27A 4O9DA 2IAAA 4XEIC 4O1QD 4OWRA 4QT8A 2OJYA 3PXSD 4JSPC 3F3GA 4ERQA 3EI2B 3I7OA 5FXYA 3V5WB 2I0RA 5GXHA 3EMHA 4L3HD 1S4UX 2OIZA 5CXBA 2AH1A 3GFCA 1GP2B 2G9AA 4J81A 1SQ9A 2OK6A 2CO0A 3KRXB 3OW8A 1U4CA 3EI3B 2HJ4A 2GC4A 4CY2A 2H9MA 5EALA 3I7LA 4E5ZA 1K32A 3BWSA 4ZOZA 5HYNB 2YNNA 2H6QA 4ZOXA 5TEEA 1VYHC 1NR0A 2GNQA 4JT6C 3IKOA 2GC7A 4X63B 2H6KA 2P9SC 4J84A 2IWFA 4GQ2P 3NVNA 2H9PA 2BCJB 3I8CA 3L4MD 5THAA 5EMMB 3FRXA 2QC5A 4J8BA 3MKSB 2H9NA 4FA9D 5TF2A 4A09A 2B5NA 2CO0C 4A0BA 5EMLB 3I8EA 4ES0A 2YB8B 4ZOYA 4GM8A 3J80g 5CXBB 2PM6B 2I3TA 4A11A 1MG2A 2I3SA 4GM3A 2Z2PA 3SHFA 2XYIA 3VA6A 3SWSD 1XIPA 4XYHA 4GZ8A 2J55H 3GREA 3MKQA 3SMRA 1P22A 4PBZA 2YNPA 2Z2OA 4BUJC 4ERYA 3IJ1A 5C2WB 4E5ZB 4QRJA 2MTAH 3I7KA 2J56H 3B7FA 3C75H 3JZHA 1Q47A 5KDOB 2B5MA 5HE0B 3F3PA 3C5MA 5HE3B 3UKUC 3SJLD 5IGQA 2O9KA 3PVWB 2EBSA 3MMYA 4KFMB 3BG0A 5IJ8E 5GSAA 1A0RB 5FA5B 4LG8A 5GXIA 5FKSA 1GG2B 4E54A 5EAMA 5CXCA 4K3JB 4FA4D 3EU7A 3HFQA 4A09B 5HQGA 4AOWA 5FKQA 4A0BB 4J87A 4CC9A 3BG1A 2CE8A 3PSCB 4U1EI 4A0AA 3SFZA 3I7PA 4O3UB 4CZXA 1PEVA 4Y5RD 3A0FA 4JT5C 3RLMD 4CI2A 3ZWLB 4A11B 3L4OD 2TRCB 4U7AA 5AFU3 4TZ4A 3IIYA 5B4WA 3C9CA 3FM0A 1GXRA 4LGNA 3EI1A 3VH0A 2HJBA 2UZYB 3NVXA 4CI1A 2XL2A 4L9OA 1XKSA 2YMUA 2AQ5A 5I5MA 2UZXB 4IMMA 3SBPA 1JMXB 2OVRB 4J86A 4FAND 2H47A 5GMKn 2H6NA 2AGYA 3I89A 3KRWB 3RFHA 3EG6A 2OK4A 3SBRA 2BBKH 4Z8LA 3MZLA 3JZGA 1TBGA 1OMWB 2QXVA 3RN0D 3DXMC 4E54B 2W18A 5CXCB 4D6VA 3SBQA 2HYEA 4MK0B 2Z2NA 4HDJA 2P9UC 3PSLA 1PBYB 4X3EA 5EMKB 4OZUA 4GGDA 2B4EA 4ERZA 2AGZA 4BH6A 4J79A 3MZKA 4J77A 4A0AB 3EWEA 3U4YA 2IWKA 3RMZD 3I7HA 5SXMA 4AEZA 1JMZB 3DSMA 1SQJA 4GM9A 5EM2A 3CIKB 3CFSB 3JROA 3EI1B 1ERJA 4A7JA 3NVQA 4CY1A 4J73A 4I79A 4G56B 3MXXA
chains in the Genus database with same CATH superfamily
5K19A 2PBIB 1JOFA 4AMZA 4DNWA 4GMBA 4FAVD 5M5UA 4L3GD 3SLED 1N6FA 4BP8A 3JB9L 4A08A 3J81g 3AH8B 3V7DB 3OKTA 2AGWA 4J82A 1XHMA 2PM9B 3IUNA 2J57G 1YFQA 5IT9g 3DM0A 4O3TB 4PSWB 4PC0A 3UVNA 3SN6B 3NIDA 4O2WA 2P9LC 2AH0A 4DNVA 4J0WA 4H5IA 4L1QD 4WK0A 5TDHB 1GOTB 3P4FA 4PXWA 3O4HA 2G99A 3OKYA 3UVKA 4D0KA 3PXWD 4GQBB 1GOGA 3O4GA 3RN1D 4ESGA 2YNOA 4CY5A 4J0XA 5IGOA 3F3FA 5EM2B 2H9LA 1K8KC 3DXKC 3N0EA 2IUPA 3VI4A 3N0DA 1QNIA 1NEXB 3O4IA 4AMYA 5M5TA 1H2WA 3T3MA 1K3IA 1VE6A 2QZPA 4GQ1A 4FHLA 5C9ZB 3UVMA 3UVOA 4J8GA 4FB1D 3IJEA 4FA5D 4X60B 5JWZA 4XYIA 2H68A 3W15A 3PE7A 2HESX 3SVWD 3ORVD 3UR4A 4A08B 3JAMg 4PSXB 5M5VA 1VZ2A 4YVDA 4EWRA 5E6UA 5FKRA 5CYKA 5H1MA 3T3PA 3JPXA 2OVPB 1RI6A 3IJCA 1TYQC 1PI6A 4QQEA 5C92A 3AL8A 4N14A 1YR2A 2VDOA 4X61B 4LG9A 4A2LA 4IA9A 3C99A 3OKYB 5TEFA 1PGUA 3PXTD 2PM9A 5M61A 1O6GA 1SHYB 2I0SA 1U2VC 3RFGA 1O6FA 3FCUA 2VDNA 1T2XA 2P9KC 3AFCA 5K1CC 4L1MA 1FWXA 1L5GA 5FQDA 2CN3A 5I5JA 2CE9A 2I0TA 1M1XA 4PBYA 2VDQA 2IURA 4RE6A 3OTTA 2EIEA 3DWLC 3IJ0A 2YBAA 4JSNC 5C86A 4Y7RA 1GOHA 2CNXA 3GD1I 4R7AB 4CZVA 2XL3A 3EI4A 4NSXA 2P9PC 4BL0A 3UKRC 3IUJA 4O45A 1L0QA 4ZOVA 3PVUB 3CFVA 4WK2A 4BP9A 2PM7B 4PNKB 3I7NA 3OL2A 5I5IA 3EQ9A 5HE1B 4K3ID 2P9IC 5CYKB 2HU5A 3SCYA 4JSXC 5FKTA 3JRPA 2P9NC 5H14A 3RRMC 3AL8B 5H17A 4UM9A 2IUQA 1B9XA 3ODTA 4GGCA 3IURA 1R5MA 3FGBA 3E0CA 4WJKA 3IULA 2AGXA 2Q7QA 5IC7A 1JV2A 4CI8A 3ZDXA 3SXTD 5AJAA 3OKWA 3ZDZA 1UOPA 2VDPA 3EI2A 1OLZA 2OVQB 1N6EA 1UOQA 1VZ3A 1MDAH 3IVMA 5FLXg 4CI3A 4A2MA 3K26A 2QR5A 4CZYA 4NBMA 3IIWA 3V4VA 2B5LA 3ZE1A 3JZNA 3EI4B 3FCSA 3NIFA 4UI9R 2XU7A 1VE7A 3UVLA 4NC4A 4JD2C 4FA1D 1E5TA 2CN2A 1N6DA 2IUVA 1JJUB 2HKMA 3EI3A 3OL2B 4JSVC 1H2YA 4FWWA 4JXMA 4QL1A 2H14A 5C2VB 2BKLA 2H13A 2AGLA 3ZDYA 5HE2B 1MG3A 4CY3A 2H3XA 2HU7A 3VGZA 2HKRA 4GGAA 4WK4A 5A2Qg 5EARA 3AL9A 1B9YA 3I2NA 2VC2A 2HXCA 4H5JA 3GC3B 4J78A 3RSEC 2XZGA 3ULEC 4BCBA 2XE4A 5IJ7E 1I2MB 4RE5A 5EMJB 5EAPA 5AMSA 3EQ7A 3V9FA 3IUQA 4ZN4A 3QI0A 3K27A 4O9DA 2IAAA 4XEIC 4O1QD 5HDBA 3MUNA 1JTDB 4OWRA 4QT8A 2OJYA 3PXSD 4JSPC 3F3GA 4ERQA 3EI2B 3I7OA 5FXYA 3V5WB 2I0RA 5GXHA 3EMHA 4L3HD 4NENA 1S4UX 2OIZA 5E6SA 5CXBA 1UOOA 2AH1A 3GFCA 1GP2B 2G9AA 4J81A 1SQ9A 2OK6A 4AN1A 2CO0A 3KRXB 3OW8A 1U4CA 3EI3B 2HJ4A 2GC4A 3QHYB 4CY2A 2H9MA 2XDWA 5EALA 3I7LA 4E5ZA 1K32A 3BWSA 4ZOZA 5HYNB 2YNNA 2H6QA 4ZOXA 2EIBA 5TEEA 1VYHC 1NR0A 2GNQA 4JT6C 3IKOA 2GC7A 4X63B 2H6KA 4UM8A 2P9SC 3MUOA 4J84A 2IWFA 3IUMA 3NVNA 4GQ2P 4JHPC 2H9PA 5FFGA 3ZE0A 2BCJB 3I8CA 3L4MD 4AX4A 3K6SA 5THAA 5EMMB 2VDRA 3FRXA 2QC5A 4J8BA 3MKSB 2H9NA 4FA9D 5TF2A 4Z7QA 1U8CA 4A09A 2B5NA 4BCDA 2CO0C 4A0BA 1E8NA 2VDKA 5EMLB 3I8EA 4ES0A 2YB8B 4ZOYA 4GM8A 3J80g 5CXBB 2PM6B 4DNUA 2I3TA 4A11A 1MG2A 2VDMA 2I3SA 4GM3A 2Z2PA 3SHFA 2XYIA 3VA6A 3SWSD 1UTCA 1XIPA 4XYHA 3OF7A 4GZ8A 2J55H 3GREA 3MKQA 3SMRA 3V4PA 1P22A 4PBZA 3K72A 2YNPA 2Z2OA 4BUJC 4ERYA 3IJ1A 5C2WB 4E5ZB 4QRJA 2MTAH 3I7KA 2J56H 3B7FA 3MVDK 3C75H 3JZHA 1Q47A 5KDOB 4G55A 2B5MA 5HE0B 4QAMA 3F3PA 3C5MA 5HE3B 3UKUC 3SJLD 4Z7NA 2O9KA 5IGQA 3PVWB 4BCCA 2EBSA 4IRZA 3MMYA 4MMYA 4KFMB 3BG0A 5IJ8E 5GSAA 1A12A 1A0RB 2VZ3A 5FA5B 4LG8A 1GOFA 5GXIA 1H2XA 2JKXA 5FKSA 1GG2B 4E54A 5EAMA 5CXCA 4K3JB 4MMZA 4FA4D 3EU7A 3DDUA 3HFQA 4A09B 5HQGA 4AOWA 5FKQA 4A0BB 4J87A 4CC9A 3KCIA 3BG1A 2CE8A 3PSCB 4U1EI 4A0AA 3SFZA 2EICA 3I7PA 4O3UB 4CZXA 1PEVA 4Y5RD 2EIDA 1E8MA 3A0FA 4JT5C 3RLMD 4CI2A 3ZWLB 4A11B 3L4OD 2TRCB 4U7AA 5AFU3 4TZ4A 5FFOA 3IIYA 5B4WA 3C9CA 3FM0A 4D9SA 1GXRA 4LGNA 4G1MA 3EI1A 3ZE2A 3VH0A 2HJBA 2UZYB 3NVXA 4CI1A 2XL2A 4L9OA 1XKSA 2YMUA 2AQ5A 4O02A 5I5MA 2UZXB 3EQ8A 4IMMA 3SBPA 1JMXB 2VDLA 2OVRB 4J86A 4FAND 2H47A 5M5SA 5GMKn 2H6NA 2AGYA 3I89A 3KRWB 4G1EA 3RFHA 3EG6A 2OK4A 1H2ZA 3SBRA 2BBKH 5M5RA 4Z8LA 3MZLA 5E6RA 3JZGA 1TBGA 1OMWB 2QXVA 3RN0D 1QFMA 3K71A 2VZ1A 1BPOA 3DXMC 4E54B 2W18A 5CXCB 4D6VA 4AN0A 3SBQA 2HYEA 4MK0B 2Z2NA 4HDJA 2P9UC 3PSLA 1PBYB 4X3EA 5EMKB 4OZUA 1QFSA 4GGDA 2B4EA 4ERZA 2AGZA 4BH6A 4J79A 3MZKA 3VI3A 4J77A 4NAAA 4A0AB 4MMXA 3EWEA 3U4YA 2IWKA 3RMZD 3I7HA 5SXMA 1C9LA 4AEZA 1JMZB 3DSMA 3NIGA 1SQJA 4GM9A 5EM2A 2HU8A 3CIKB 4JHNA 3CFSB 3JROA 3EI1B 3O4JA 1ERJA 4A7JA 3NVQA 4CY1A 2WQ8A 1C9IA 4J73A 4I79A 4G56B 1TYEA 3MXXA 4Z7OA
chains in the Genus database with same CATH topology
5K19A 2PBIB 1JOFA 4GMBA 4FAVD 4L3GD 3SLED 1N6FA 3JB9L 4A08A 3J81g 3AH8B 3V7DB 3OKTA 2AGWA 4J82A 1XHMA 2PM9B 2J57G 1YFQA 5IT9g 3DM0A 4O3TB 4PSWB 4PC0A 3UVNA 3SN6B 2P9LC 2AH0A 4J0WA 4H5IA 4L1QD 5TDHB 1GOTB 3P4FA 4PXWA 2G99A 3OKYA 3UVKA 4D0KA 3PXWD 4GQBB 3RN1D 4ESGA 2YNOA 4CY5A 4J0XA 5IGOA 3F3FA 5EM2B 2H9LA 1K8KC 3DXKC 3N0EA 2IUPA 3N0DA 1QNIA 1NEXB 4GQ1A 4FHLA 5C9ZB 3UVMA 3UVOA 4J8GA 4FB1D 4FA5D 4X60B 5JWZA 4XYIA 2H68A 3W15A 3PE7A 2HESX 3SVWD 3ORVD 3UR4A 4A08B 3JAMg 4PSXB 4YVDA 4EWRA 5FKRA 5CYKA 5H1MA 3JPXA 2OVPB 1RI6A 3IJCA 1TYQC 1PI6A 4QQEA 3AL8A 4N14A 4X61B 4LG9A 4A2LA 4IA9A 3C99A 3OKYB 5TEFA 1PGUA 3PXTD 2PM9A 1SHYB 2I0SA 1U2VC 3RFGA 2P9KC 3AFCA 5K1CC 1FWXA 5FQDA 2CN3A 5I5JA 2CE9A 2I0TA 4PBYA 2IURA 3OTTA 3DWLC 3IJ0A 2YBAA 4JSNC 4Y7RA 2CNXA 4R7AB 4CZVA 2XL3A 3EI4A 4NSXA 2P9PC 4BL0A 3UKRC 4O45A 1L0QA 4ZOVA 3PVUB 3CFVA 2PM7B 4PNKB 3I7NA 3OL2A 5I5IA 5HE1B 4K3ID 2P9IC 5CYKB 3SCYA 4JSXC 5FKTA 3JRPA 2P9NC 5H14A 3RRMC 3AL8B 5H17A 2IUQA 1B9XA 3ODTA 4GGCA 1R5MA 3FGBA 3E0CA 2AGXA 2Q7QA 5IC7A 4CI8A 3SXTD 5AJAA 3OKWA 3EI2A 1OLZA 2OVQB 1N6EA 1MDAH 5FLXg 4CI3A 4A2MA 3K26A 4CZYA 3IIWA 2B5LA 3JZNA 3EI4B 4UI9R 2XU7A 3UVLA 4FA1D 4JD2C 2CN2A 1N6DA 2IUVA 1JJUB 2HKMA 4JSVC 3EI3A 3OL2B 4FWWA 4JXMA 4QL1A 5C2VB 2H14A 2H13A 2AGLA 5HE2B 1MG3A 4CY3A 2H3XA 3VGZA 2HKRA 4GGAA 5A2Qg 5EARA 3AL9A 1B9YA 3I2NA 2HXCA 4H5JA 4J78A 3RSEC 3ULEC 5IJ7E 5EMJB 5EAPA 5AMSA 3V9FA 4ZN4A 3K27A 4O9DA 2IAAA 4XEIC 4O1QD 4OWRA 4QT8A 2OJYA 3PXSD 4JSPC 3F3GA 4ERQA 3EI2B 3I7OA 5FXYA 3V5WB 2I0RA 5GXHA 3EMHA 4L3HD 1S4UX 2OIZA 5CXBA 2AH1A 3GFCA 1GP2B 2G9AA 4J81A 1SQ9A 2OK6A 2CO0A 3KRXB 3OW8A 1U4CA 3EI3B 2HJ4A 2GC4A 4CY2A 2H9MA 5EALA 3I7LA 4E5ZA 1K32A 3BWSA 4ZOZA 5HYNB 2YNNA 2H6QA 4ZOXA 5TEEA 1VYHC 1NR0A 2GNQA 4JT6C 3IKOA 2GC7A 4X63B 2H6KA 2P9SC 4J84A 2IWFA 4GQ2P 3NVNA 2H9PA 2BCJB 3I8CA 3L4MD 5THAA 5EMMB 3FRXA 2QC5A 4J8BA 3MKSB 2H9NA 4FA9D 5TF2A 4A09A 2B5NA 2CO0C 4A0BA 5EMLB 3I8EA 4ES0A 2YB8B 4ZOYA 4GM8A 3J80g 5CXBB 2PM6B 2I3TA 4A11A 1MG2A 2I3SA 4GM3A 2Z2PA 3SHFA 2XYIA 3VA6A 3SWSD 1XIPA 4XYHA 4GZ8A 2J55H 3GREA 3MKQA 3SMRA 1P22A 4PBZA 2YNPA 2Z2OA 4BUJC 4ERYA 3IJ1A 5C2WB 4E5ZB 4QRJA 2MTAH 3I7KA 2J56H 3B7FA 3C75H 3JZHA 1Q47A 5KDOB 2B5MA 5HE0B 3F3PA 3C5MA 5HE3B 3UKUC 3SJLD 5IGQA 2O9KA 3PVWB 2EBSA 3MMYA 4KFMB 3BG0A 5IJ8E 5GSAA 1A0RB 5FA5B 4LG8A 5GXIA 5FKSA 1GG2B 4E54A 5EAMA 5CXCA 4K3JB 4FA4D 3EU7A 3HFQA 4A09B 5HQGA 4AOWA 5FKQA 4A0BB 4J87A 4CC9A 3BG1A 2CE8A 3PSCB 4U1EI 4A0AA 3SFZA 3I7PA 4O3UB 4CZXA 1PEVA 4Y5RD 3A0FA 4JT5C 3RLMD 4CI2A 3ZWLB 4A11B 3L4OD 2TRCB 4U7AA 5AFU3 4TZ4A 3IIYA 5B4WA 3C9CA 3FM0A 1GXRA 4LGNA 3EI1A 3VH0A 2HJBA 2UZYB 3NVXA 4CI1A 2XL2A 4L9OA 1XKSA 2YMUA 2AQ5A 5I5MA 2UZXB 4IMMA 3SBPA 1JMXB 2OVRB 4J86A 4FAND 2H47A 5GMKn 2H6NA 2AGYA 3I89A 3KRWB 3RFHA 3EG6A 2OK4A 3SBRA 2BBKH 4Z8LA 3MZLA 3JZGA 1TBGA 1OMWB 2QXVA 3RN0D 3DXMC 4E54B 2W18A 5CXCB 4D6VA 3SBQA 2HYEA 4MK0B 2Z2NA 4HDJA 2P9UC 3PSLA 1PBYB 4X3EA 5EMKB 4OZUA 4GGDA 2B4EA 4ERZA 2AGZA 4BH6A 4J79A 3MZKA 4J77A 4A0AB 3EWEA 3U4YA 2IWKA 3RMZD 3I7HA 5SXMA 4AEZA 1JMZB 3DSMA 1SQJA 4GM9A 5EM2A 3CIKB 3CFSB 3JROA 3EI1B 1ERJA 4A7JA 3NVQA 4CY1A 4J73A 4I79A 4G56B 3MXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K19 A;  2PBI B;  1JOF A;  4GMB A;  4FAV D;  4L3G D;  3SLE D;  1N6F A;  3JB9 L;  4A08 A;  3J81 g;  3AH8 B;  3V7D B;  3OKT A;  2AGW A;  4J82 A;  1XHM A;  2PM9 B;  2J57 G;  1YFQ A;  5IT9 g;  3DM0 A;  4O3T B;  4PSW B;  4PC0 A;  3UVN A;  3SN6 B;  2P9L C;  2AH0 A;  4J0W A;  4H5I A;  4L1Q D;  5TDH B;  1GOT B;  3P4F A;  4PXW A;  2G99 A;  3OKY A;  3UVK A;  4D0K A;  3PXW D;  4GQB B;  3RN1 D;  4ESG A;  2YNO A;  4CY5 A;  4J0X A;  5IGO A;  3F3F A;  5EM2 B;  2H9L A;  1K8K C;  3DXK C;  3N0E A;  2IUP A;  3N0D A;  1QNI A;  1NEX B;  4GQ1 A;  4FHL A;  5C9Z B;  3UVM A;  3UVO A;  4J8G A;  4FB1 D;  4FA5 D;  4X60 B;  5JWZ A;  4XYI A;  2H68 A;  3W15 A;  3PE7 A;  2HES X;  3SVW D;  3ORV D;  3UR4 A;  4A08 B;  3JAM g;  4PSX B;  4YVD A;  4EWR A;  5FKR A;  5CYK A;  5H1M A;  3JPX A;  2OVP B;  1RI6 A;  3IJC A;  1TYQ C;  1PI6 A;  4QQE A;  3AL8 A;  4N14 A;  4X61 B;  4LG9 A;  4A2L A;  4IA9 A;  3C99 A;  3OKY B;  5TEF A;  1PGU A;  3PXT D;  2PM9 A;  1SHY B;  2I0S A;  1U2V C;  3RFG A;  2P9K C;  3AFC A;  5K1C C;  1FWX A;  5FQD A;  2CN3 A;  5I5J A;  2CE9 A;  2I0T A;  4PBY A;  2IUR A;  3OTT A;  3DWL C;  3IJ0 A;  2YBA A;  4JSN C;  4Y7R A;  2CNX A;  4R7A B;  4CZV A;  2XL3 A;  3EI4 A;  4NSX A;  2P9P C;  4BL0 A;  3UKR C;  4O45 A;  1L0Q A;  4ZOV A;  3PVU B;  3CFV A;  2PM7 B;  4PNK B;  3I7N A;  3OL2 A;  5I5I A;  5HE1 B;  4K3I D;  2P9I C;  5CYK B;  3SCY A;  4JSX C;  5FKT A;  3JRP A;  2P9N C;  5H14 A;  3RRM C;  3AL8 B;  5H17 A;  2IUQ A;  1B9X A;  3ODT A;  4GGC A;  1R5M A;  3FGB A;  3E0C A;  2AGX A;  2Q7Q A;  5IC7 A;  4CI8 A;  3SXT D;  5AJA A;  3OKW A;  3EI2 A;  1OLZ A;  2OVQ B;  1N6E A;  1MDA H;  5FLX g;  4CI3 A;  4A2M A;  3K26 A;  4CZY A;  3IIW A;  2B5L A;  3JZN A;  3EI4 B;  4UI9 R;  2XU7 A;  3UVL A;  4FA1 D;  4JD2 C;  2CN2 A;  1N6D A;  2IUV A;  1JJU B;  2HKM A;  4JSV C;  3EI3 A;  3OL2 B;  4FWW A;  4JXM A;  4QL1 A;  5C2V B;  2H14 A;  2H13 A;  2AGL A;  5HE2 B;  1MG3 A;  4CY3 A;  2H3X A;  3VGZ A;  2HKR A;  4GGA A;  5A2Q g;  5EAR A;  3AL9 A;  1B9Y A;  3I2N A;  2HXC A;  4H5J A;  4J78 A;  3RSE C;  3ULE C;  5IJ7 E;  5EMJ B;  5EAP A;  5AMS A;  3V9F A;  4ZN4 A;  3K27 A;  4O9D A;  2IAA A;  4XEI C;  4O1Q D;  4OWR A;  4QT8 A;  2OJY A;  3PXS D;  4JSP C;  3F3G A;  4ERQ A;  3EI2 B;  3I7O A;  5FXY A;  3V5W B;  2I0R A;  5GXH A;  3EMH A;  4L3H D;  1S4U X;  2OIZ A;  5CXB A;  2AH1 A;  3GFC A;  1GP2 B;  2G9A A;  4J81 A;  1SQ9 A;  2OK6 A;  2CO0 A;  3KRX B;  3OW8 A;  1U4C A;  3EI3 B;  2HJ4 A;  2GC4 A;  4CY2 A;  2H9M A;  5EAL A;  3I7L A;  4E5Z A;  1K32 A;  3BWS A;  4ZOZ A;  5HYN B;  2YNN A;  2H6Q A;  4ZOX A;  5TEE A;  1VYH C;  1NR0 A;  2GNQ A;  4JT6 C;  3IKO A;  2GC7 A;  4X63 B;  2H6K A;  2P9S C;  4J84 A;  2IWF A;  4GQ2 P;  3NVN A;  2H9P A;  2BCJ B;  3I8C A;  3L4M D;  5THA A;  5EMM B;  3FRX A;  2QC5 A;  4J8B A;  3MKS B;  2H9N A;  4FA9 D;  5TF2 A;  4A09 A;  2B5N A;  2CO0 C;  4A0B A;  5EML B;  3I8E A;  4ES0 A;  2YB8 B;  4ZOY A;  4GM8 A;  3J80 g;  5CXB B;  2PM6 B;  2I3T A;  4A11 A;  1MG2 A;  2I3S A;  4GM3 A;  2Z2P A;  3SHF A;  2XYI A;  3VA6 A;  3SWS D;  1XIP A;  4XYH A;  4GZ8 A;  2J55 H;  3GRE A;  3MKQ A;  3SMR A;  1P22 A;  4PBZ A;  2YNP A;  2Z2O A;  4BUJ C;  4ERY A;  3IJ1 A;  5C2W B;  4E5Z B;  4QRJ A;  2MTA H;  3I7K A;  2J56 H;  3B7F A;  3C75 H;  3JZH A;  1Q47 A;  5KDO B;  2B5M A;  5HE0 B;  3F3P A;  3C5M A;  5HE3 B;  3UKU C;  3SJL D;  5IGQ A;  2O9K A;  3PVW B;  2EBS A;  3MMY A;  4KFM B;  3BG0 A;  5IJ8 E;  5GSA A;  1A0R B;  5FA5 B;  4LG8 A;  5GXI A;  5FKS A;  1GG2 B;  4E54 A;  5EAM A;  5CXC A;  4K3J B;  4FA4 D;  3EU7 A;  3HFQ A;  4A09 B;  5HQG A;  4AOW A;  5FKQ A;  4A0B B;  4J87 A;  4CC9 A;  3BG1 A;  2CE8 A;  3PSC B;  4U1E I;  4A0A A;  3SFZ A;  3I7P A;  4O3U B;  4CZX A;  1PEV A;  4Y5R D;  3A0F A;  4JT5 C;  3RLM D;  4CI2 A;  3ZWL B;  4A11 B;  3L4O D;  2TRC B;  4U7A A;  5AFU 3;  4TZ4 A;  3IIY A;  5B4W A;  3C9C A;  3FM0 A;  1GXR A;  4LGN A;  3EI1 A;  3VH0 A;  2HJB A;  2UZY B;  3NVX A;  4CI1 A;  2XL2 A;  4L9O A;  1XKS A;  2YMU A;  2AQ5 A;  5I5M A;  2UZX B;  4IMM A;  3SBP A;  1JMX B;  2OVR B;  4J86 A;  4FAN D;  2H47 A;  5GMK n;  2H6N A;  2AGY A;  3I89 A;  3KRW B;  3RFH A;  3EG6 A;  2OK4 A;  3SBR A;  2BBK H;  4Z8L A;  3MZL A;  3JZG A;  1TBG A;  1OMW B;  2QXV A;  3RN0 D;  3DXM C;  4E54 B;  2W18 A;  5CXC B;  4D6V A;  3SBQ A;  2HYE A;  4MK0 B;  2Z2N A;  4HDJ A;  2P9U C;  3PSL A;  1PBY B;  4X3E A;  5EMK B;  4OZU A;  4GGD A;  2B4E A;  4ERZ A;  2AGZ A;  4BH6 A;  4J79 A;  3MZK A;  4J77 A;  4A0A B;  3EWE A;  3U4Y A;  2IWK A;  3RMZ D;  3I7H A;  5SXM A;  4AEZ A;  1JMZ B;  3DSM A;  1SQJ A;  4GM9 A;  5EM2 A;  3CIK B;  3CFS B;  3JRO A;  3EI1 B;  1ERJ A;  4A7J A;  3NVQ A;  4CY1 A;  4J73 A;  4I79 A;  4G56 B;  3MXX A; 
#chains in the Genus database with same CATH topology
 5K19 A;  2PBI B;  1JOF A;  4AMZ A;  4DNW A;  4GMB A;  4FAV D;  5M5U A;  4L3G D;  3SLE D;  1N6F A;  4BP8 A;  3JB9 L;  4A08 A;  3J81 g;  3AH8 B;  3V7D B;  3OKT A;  2AGW A;  4J82 A;  1XHM A;  2PM9 B;  3IUN A;  2J57 G;  1YFQ A;  5IT9 g;  3DM0 A;  4O3T B;  4PSW B;  4PC0 A;  3UVN A;  3SN6 B;  3NID A;  4O2W A;  2P9L C;  2AH0 A;  4DNV A;  4J0W A;  4H5I A;  4L1Q D;  4WK0 A;  5TDH B;  1GOT B;  3P4F A;  4PXW A;  3O4H A;  2G99 A;  3OKY A;  3UVK A;  4D0K A;  3PXW D;  4GQB B;  1GOG A;  3O4G A;  3RN1 D;  4ESG A;  2YNO A;  4CY5 A;  4J0X A;  5IGO A;  3F3F A;  5EM2 B;  2H9L A;  1K8K C;  3DXK C;  3N0E A;  2IUP A;  3VI4 A;  3N0D A;  1QNI A;  1NEX B;  3O4I A;  4AMY A;  5M5T A;  1H2W A;  3T3M A;  1K3I A;  1VE6 A;  2QZP A;  4GQ1 A;  4FHL A;  5C9Z B;  3UVM A;  3UVO A;  4J8G A;  4FB1 D;  3IJE A;  4FA5 D;  4X60 B;  5JWZ A;  4XYI A;  2H68 A;  3W15 A;  3PE7 A;  2HES X;  3SVW D;  3ORV D;  3UR4 A;  4A08 B;  3JAM g;  4PSX B;  5M5V A;  1VZ2 A;  4YVD A;  4EWR A;  5E6U A;  5FKR A;  5CYK A;  5H1M A;  3T3P A;  3JPX A;  2OVP B;  1RI6 A;  3IJC A;  1TYQ C;  1PI6 A;  4QQE A;  5C92 A;  3AL8 A;  4N14 A;  1YR2 A;  2VDO A;  4X61 B;  4LG9 A;  4A2L A;  4IA9 A;  3C99 A;  3OKY B;  5TEF A;  1PGU A;  3PXT D;  2PM9 A;  5M61 A;  1O6G A;  1SHY B;  2I0S A;  1U2V C;  3RFG A;  1O6F A;  3FCU A;  2VDN A;  1T2X A;  2P9K C;  3AFC A;  5K1C C;  4L1M A;  1FWX A;  1L5G A;  5FQD A;  2CN3 A;  5I5J A;  2CE9 A;  2I0T A;  1M1X A;  4PBY A;  2VDQ A;  2IUR A;  4RE6 A;  3OTT A;  2EIE A;  3DWL C;  3IJ0 A;  2YBA A;  4JSN C;  5C86 A;  4Y7R A;  1GOH A;  2CNX A;  3GD1 I;  4R7A B;  4CZV A;  2XL3 A;  3EI4 A;  4NSX A;  2P9P C;  4BL0 A;  3UKR C;  3IUJ A;  4O45 A;  1L0Q A;  4ZOV A;  3PVU B;  3CFV A;  4WK2 A;  4BP9 A;  2PM7 B;  4PNK B;  3I7N A;  3OL2 A;  5I5I A;  3EQ9 A;  5HE1 B;  4K3I D;  2P9I C;  5CYK B;  2HU5 A;  3SCY A;  4JSX C;  5FKT A;  3JRP A;  2P9N C;  5H14 A;  3RRM C;  3AL8 B;  5H17 A;  4UM9 A;  2IUQ A;  1B9X A;  3ODT A;  4GGC A;  3IUR A;  1R5M A;  3FGB A;  3E0C A;  4WJK A;  3IUL A;  2AGX A;  2Q7Q A;  5IC7 A;  1JV2 A;  4CI8 A;  3ZDX A;  3SXT D;  5AJA A;  3OKW A;  3ZDZ A;  1UOP A;  2VDP A;  3EI2 A;  1OLZ A;  2OVQ B;  1N6E A;  1UOQ A;  1VZ3 A;  1MDA H;  3IVM A;  5FLX g;  4CI3 A;  4A2M A;  3K26 A;  2QR5 A;  4CZY A;  4NBM A;  3IIW A;  3V4V A;  2B5L A;  3ZE1 A;  3JZN A;  3EI4 B;  3FCS A;  3NIF A;  4UI9 R;  2XU7 A;  1VE7 A;  3UVL A;  4NC4 A;  4JD2 C;  4FA1 D;  1E5T A;  2CN2 A;  1N6D A;  2IUV A;  1JJU B;  2HKM A;  3EI3 A;  3OL2 B;  4JSV C;  1H2Y A;  4FWW A;  4JXM A;  4QL1 A;  2H14 A;  5C2V B;  2BKL A;  2H13 A;  2AGL A;  3ZDY A;  5HE2 B;  1MG3 A;  4CY3 A;  2H3X A;  2HU7 A;  3VGZ A;  2HKR A;  4GGA A;  4WK4 A;  5A2Q g;  5EAR A;  3AL9 A;  1B9Y A;  3I2N A;  2VC2 A;  2HXC A;  4H5J A;  3GC3 B;  4J78 A;  3RSE C;  2XZG A;  3ULE C;  4BCB A;  2XE4 A;  5IJ7 E;  1I2M B;  4RE5 A;  5EMJ B;  5EAP A;  5AMS A;  3EQ7 A;  3V9F A;  3IUQ A;  4ZN4 A;  3QI0 A;  3K27 A;  4O9D A;  2IAA A;  4XEI C;  4O1Q D;  5HDB A;  3MUN A;  1JTD B;  4OWR A;  4QT8 A;  2OJY A;  3PXS D;  4JSP C;  3F3G A;  4ERQ A;  3EI2 B;  3I7O A;  5FXY A;  3V5W B;  2I0R A;  5GXH A;  3EMH A;  4L3H D;  4NEN A;  1S4U X;  2OIZ A;  5E6S A;  5CXB A;  1UOO A;  2AH1 A;  3GFC A;  1GP2 B;  2G9A A;  4J81 A;  1SQ9 A;  2OK6 A;  4AN1 A;  2CO0 A;  3KRX B;  3OW8 A;  1U4C A;  3EI3 B;  2HJ4 A;  2GC4 A;  3QHY B;  4CY2 A;  2H9M A;  2XDW A;  5EAL A;  3I7L A;  4E5Z A;  1K32 A;  3BWS A;  4ZOZ A;  5HYN B;  2YNN A;  2H6Q A;  4ZOX A;  2EIB A;  5TEE A;  1VYH C;  1NR0 A;  2GNQ A;  4JT6 C;  3IKO A;  2GC7 A;  4X63 B;  2H6K A;  4UM8 A;  2P9S C;  3MUO A;  4J84 A;  2IWF A;  3IUM A;  3NVN A;  4GQ2 P;  4JHP C;  2H9P A;  5FFG A;  3ZE0 A;  2BCJ B;  3I8C A;  3L4M D;  4AX4 A;  3K6S A;  5THA A;  5EMM B;  2VDR A;  3FRX A;  2QC5 A;  4J8B A;  3MKS B;  2H9N A;  4FA9 D;  5TF2 A;  4Z7Q A;  1U8C A;  4A09 A;  2B5N A;  4BCD A;  2CO0 C;  4A0B A;  1E8N A;  2VDK A;  5EML B;  3I8E A;  4ES0 A;  2YB8 B;  4ZOY A;  4GM8 A;  3J80 g;  5CXB B;  2PM6 B;  4DNU A;  2I3T A;  4A11 A;  1MG2 A;  2VDM A;  2I3S A;  4GM3 A;  2Z2P A;  3SHF A;  2XYI A;  3VA6 A;  3SWS D;  1UTC A;  1XIP A;  4XYH A;  3OF7 A;  4GZ8 A;  2J55 H;  3GRE A;  3MKQ A;  3SMR A;  3V4P A;  1P22 A;  4PBZ A;  3K72 A;  2YNP A;  2Z2O A;  4BUJ C;  4ERY A;  3IJ1 A;  5C2W B;  4E5Z B;  4QRJ A;  2MTA H;  3I7K A;  2J56 H;  3B7F A;  3MVD K;  3C75 H;  3JZH A;  1Q47 A;  5KDO B;  4G55 A;  2B5M A;  5HE0 B;  4QAM A;  3F3P A;  3C5M A;  5HE3 B;  3UKU C;  3SJL D;  4Z7N A;  2O9K A;  5IGQ A;  3PVW B;  4BCC A;  2EBS A;  4IRZ A;  3MMY A;  4MMY A;  4KFM B;  3BG0 A;  5IJ8 E;  5GSA A;  1A12 A;  1A0R B;  2VZ3 A;  5FA5 B;  4LG8 A;  1GOF A;  5GXI A;  1H2X A;  2JKX A;  5FKS A;  1GG2 B;  4E54 A;  5EAM A;  5CXC A;  4K3J B;  4MMZ A;  4FA4 D;  3EU7 A;  3DDU A;  3HFQ A;  4A09 B;  5HQG A;  4AOW A;  5FKQ A;  4A0B B;  4J87 A;  4CC9 A;  3KCI A;  3BG1 A;  2CE8 A;  3PSC B;  4U1E I;  4A0A A;  3SFZ A;  2EIC A;  3I7P A;  4O3U B;  4CZX A;  1PEV A;  4Y5R D;  2EID A;  1E8M A;  3A0F A;  4JT5 C;  3RLM D;  4CI2 A;  3ZWL B;  4A11 B;  3L4O D;  2TRC B;  4U7A A;  5AFU 3;  4TZ4 A;  5FFO A;  3IIY A;  5B4W A;  3C9C A;  3FM0 A;  4D9S A;  1GXR A;  4LGN A;  4G1M A;  3EI1 A;  3ZE2 A;  3VH0 A;  2HJB A;  2UZY B;  3NVX A;  4CI1 A;  2XL2 A;  4L9O A;  1XKS A;  2YMU A;  2AQ5 A;  4O02 A;  5I5M A;  2UZX B;  3EQ8 A;  4IMM A;  3SBP A;  1JMX B;  2VDL A;  2OVR B;  4J86 A;  4FAN D;  2H47 A;  5M5S A;  5GMK n;  2H6N A;  2AGY A;  3I89 A;  3KRW B;  4G1E A;  3RFH A;  3EG6 A;  2OK4 A;  1H2Z A;  3SBR A;  2BBK H;  5M5R A;  4Z8L A;  3MZL A;  5E6R A;  3JZG A;  1TBG A;  1OMW B;  2QXV A;  3RN0 D;  1QFM A;  3K71 A;  2VZ1 A;  1BPO A;  3DXM C;  4E54 B;  2W18 A;  5CXC B;  4D6V A;  4AN0 A;  3SBQ A;  2HYE A;  4MK0 B;  2Z2N A;  4HDJ A;  2P9U C;  3PSL A;  1PBY B;  4X3E A;  5EMK B;  4OZU A;  1QFS A;  4GGD A;  2B4E A;  4ERZ A;  2AGZ A;  4BH6 A;  4J79 A;  3MZK A;  3VI3 A;  4J77 A;  4NAA A;  4A0A B;  4MMX A;  3EWE A;  3U4Y A;  2IWK A;  3RMZ D;  3I7H A;  5SXM A;  1C9L A;  4AEZ A;  1JMZ B;  3DSM A;  3NIG A;  1SQJ A;  4GM9 A;  5EM2 A;  2HU8 A;  3CIK B;  4JHN A;  3CFS B;  3JRO A;  3EI1 B;  3O4J A;  1ERJ A;  4A7J A;  3NVQ A;  4CY1 A;  2WQ8 A;  1C9I A;  4J73 A;  4I79 A;  4G56 B;  1TYE A;  3MXX A;  4Z7O A; 
#chains in the Genus database with same CATH homology
 5K19 A;  2PBI B;  1JOF A;  4GMB A;  4FAV D;  4L3G D;  3SLE D;  1N6F A;  3JB9 L;  4A08 A;  3J81 g;  3AH8 B;  3V7D B;  3OKT A;  2AGW A;  4J82 A;  1XHM A;  2PM9 B;  2J57 G;  1YFQ A;  5IT9 g;  3DM0 A;  4O3T B;  4PSW B;  4PC0 A;  3UVN A;  3SN6 B;  2P9L C;  2AH0 A;  4J0W A;  4H5I A;  4L1Q D;  5TDH B;  1GOT B;  3P4F A;  4PXW A;  2G99 A;  3OKY A;  3UVK A;  4D0K A;  3PXW D;  4GQB B;  3RN1 D;  4ESG A;  2YNO A;  4CY5 A;  4J0X A;  5IGO A;  3F3F A;  5EM2 B;  2H9L A;  1K8K C;  3DXK C;  3N0E A;  2IUP A;  3N0D A;  1QNI A;  1NEX B;  4GQ1 A;  4FHL A;  5C9Z B;  3UVM A;  3UVO A;  4J8G A;  4FB1 D;  4FA5 D;  4X60 B;  5JWZ A;  4XYI A;  2H68 A;  3W15 A;  3PE7 A;  2HES X;  3SVW D;  3ORV D;  3UR4 A;  4A08 B;  3JAM g;  4PSX B;  4YVD A;  4EWR A;  5FKR A;  5CYK A;  5H1M A;  3JPX A;  2OVP B;  1RI6 A;  3IJC A;  1TYQ C;  1PI6 A;  4QQE A;  3AL8 A;  4N14 A;  4X61 B;  4LG9 A;  4A2L A;  4IA9 A;  3C99 A;  3OKY B;  5TEF A;  1PGU A;  3PXT D;  2PM9 A;  1SHY B;  2I0S A;  1U2V C;  3RFG A;  2P9K C;  3AFC A;  5K1C C;  1FWX A;  5FQD A;  2CN3 A;  5I5J A;  2CE9 A;  2I0T A;  4PBY A;  2IUR A;  3OTT A;  3DWL C;  3IJ0 A;  2YBA A;  4JSN C;  4Y7R A;  2CNX A;  4R7A B;  4CZV A;  2XL3 A;  3EI4 A;  4NSX A;  2P9P C;  4BL0 A;  3UKR C;  4O45 A;  1L0Q A;  4ZOV A;  3PVU B;  3CFV A;  2PM7 B;  4PNK B;  3I7N A;  3OL2 A;  5I5I A;  5HE1 B;  4K3I D;  2P9I C;  5CYK B;  3SCY A;  4JSX C;  5FKT A;  3JRP A;  2P9N C;  5H14 A;  3RRM C;  3AL8 B;  5H17 A;  2IUQ A;  1B9X A;  3ODT A;  4GGC A;  1R5M A;  3FGB A;  3E0C A;  2AGX A;  2Q7Q A;  5IC7 A;  4CI8 A;  3SXT D;  5AJA A;  3OKW A;  3EI2 A;  1OLZ A;  2OVQ B;  1N6E A;  1MDA H;  5FLX g;  4CI3 A;  4A2M A;  3K26 A;  4CZY A;  3IIW A;  2B5L A;  3JZN A;  3EI4 B;  4UI9 R;  2XU7 A;  3UVL A;  4FA1 D;  4JD2 C;  2CN2 A;  1N6D A;  2IUV A;  1JJU B;  2HKM A;  4JSV C;  3EI3 A;  3OL2 B;  4FWW A;  4JXM A;  4QL1 A;  5C2V B;  2H14 A;  2H13 A;  2AGL A;  5HE2 B;  1MG3 A;  4CY3 A;  2H3X A;  3VGZ A;  2HKR A;  4GGA A;  5A2Q g;  5EAR A;  3AL9 A;  1B9Y A;  3I2N A;  2HXC A;  4H5J A;  4J78 A;  3RSE C;  3ULE C;  5IJ7 E;  5EMJ B;  5EAP A;  5AMS A;  3V9F A;  4ZN4 A;  3K27 A;  4O9D A;  2IAA A;  4XEI C;  4O1Q D;  4OWR A;  4QT8 A;  2OJY A;  3PXS D;  4JSP C;  3F3G A;  4ERQ A;  3EI2 B;  3I7O A;  5FXY A;  3V5W B;  2I0R A;  5GXH A;  3EMH A;  4L3H D;  1S4U X;  2OIZ A;  5CXB A;  2AH1 A;  3GFC A;  1GP2 B;  2G9A A;  4J81 A;  1SQ9 A;  2OK6 A;  2CO0 A;  3KRX B;  3OW8 A;  1U4C A;  3EI3 B;  2HJ4 A;  2GC4 A;  4CY2 A;  2H9M A;  5EAL A;  3I7L A;  4E5Z A;  1K32 A;  3BWS A;  4ZOZ A;  5HYN B;  2YNN A;  2H6Q A;  4ZOX A;  5TEE A;  1VYH C;  1NR0 A;  2GNQ A;  4JT6 C;  3IKO A;  2GC7 A;  4X63 B;  2H6K A;  2P9S C;  4J84 A;  2IWF A;  4GQ2 P;  3NVN A;  2H9P A;  2BCJ B;  3I8C A;  3L4M D;  5THA A;  5EMM B;  3FRX A;  2QC5 A;  4J8B A;  3MKS B;  2H9N A;  4FA9 D;  5TF2 A;  4A09 A;  2B5N A;  2CO0 C;  4A0B A;  5EML B;  3I8E A;  4ES0 A;  2YB8 B;  4ZOY A;  4GM8 A;  3J80 g;  5CXB B;  2PM6 B;  2I3T A;  4A11 A;  1MG2 A;  2I3S A;  4GM3 A;  2Z2P A;  3SHF A;  2XYI A;  3VA6 A;  3SWS D;  1XIP A;  4XYH A;  4GZ8 A;  2J55 H;  3GRE A;  3MKQ A;  3SMR A;  1P22 A;  4PBZ A;  2YNP A;  2Z2O A;  4BUJ C;  4ERY A;  3IJ1 A;  5C2W B;  4E5Z B;  4QRJ A;  2MTA H;  3I7K A;  2J56 H;  3B7F A;  3C75 H;  3JZH A;  1Q47 A;  5KDO B;  2B5M A;  5HE0 B;  3F3P A;  3C5M A;  5HE3 B;  3UKU C;  3SJL D;  5IGQ A;  2O9K A;  3PVW B;  2EBS A;  3MMY A;  4KFM B;  3BG0 A;  5IJ8 E;  5GSA A;  1A0R B;  5FA5 B;  4LG8 A;  5GXI A;  5FKS A;  1GG2 B;  4E54 A;  5EAM A;  5CXC A;  4K3J B;  4FA4 D;  3EU7 A;  3HFQ A;  4A09 B;  5HQG A;  4AOW A;  5FKQ A;  4A0B B;  4J87 A;  4CC9 A;  3BG1 A;  2CE8 A;  3PSC B;  4U1E I;  4A0A A;  3SFZ A;  3I7P A;  4O3U B;  4CZX A;  1PEV A;  4Y5R D;  3A0F A;  4JT5 C;  3RLM D;  4CI2 A;  3ZWL B;  4A11 B;  3L4O D;  2TRC B;  4U7A A;  5AFU 3;  4TZ4 A;  3IIY A;  5B4W A;  3C9C A;  3FM0 A;  1GXR A;  4LGN A;  3EI1 A;  3VH0 A;  2HJB A;  2UZY B;  3NVX A;  4CI1 A;  2XL2 A;  4L9O A;  1XKS A;  2YMU A;  2AQ5 A;  5I5M A;  2UZX B;  4IMM A;  3SBP A;  1JMX B;  2OVR B;  4J86 A;  4FAN D;  2H47 A;  5GMK n;  2H6N A;  2AGY A;  3I89 A;  3KRW B;  3RFH A;  3EG6 A;  2OK4 A;  3SBR A;  2BBK H;  4Z8L A;  3MZL A;  3JZG A;  1TBG A;  1OMW B;  2QXV A;  3RN0 D;  3DXM C;  4E54 B;  2W18 A;  5CXC B;  4D6V A;  3SBQ A;  2HYE A;  4MK0 B;  2Z2N A;  4HDJ A;  2P9U C;  3PSL A;  1PBY B;  4X3E A;  5EMK B;  4OZU A;  4GGD A;  2B4E A;  4ERZ A;  2AGZ A;  4BH6 A;  4J79 A;  3MZK A;  4J77 A;  4A0A B;  3EWE A;  3U4Y A;  2IWK A;  3RMZ D;  3I7H A;  5SXM A;  4AEZ A;  1JMZ B;  3DSM A;  1SQJ A;  4GM9 A;  5EM2 A;  3CIK B;  3CFS B;  3JRO A;  3EI1 B;  1ERJ A;  4A7J A;  3NVQ A;  4CY1 A;  4J73 A;  4I79 A;  4G56 B;  3MXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...