4JSNC

Structure of mtordeltan-mlst8 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase mTOR
total genus 82
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jsnC01
4ZN4A 2IUPA 3U4YA 2BCJB 3DSMA 2H6KA 3JZNA 4FAVD 3V7DB 1GOTB 2P9NC 4BL0A 2IAAA 3RN1D 5CYKA 3SXTD 3OKWA 4O3UB 4J81A 4D6VA 2YNNA 1FWXA 2H14A 3RFHA 2OVRB 5IGOA 3J81g 1K8KC 3JB9L 2MTAH 3GREA 3OKYB 4L9OA 5H14A 3NVNA 3VA6A 2I3SA 4H5IA 2IWKA 2HJBA 4CY5A 4GQ1A 3PXTD 3KRXB 2UZYB 4HDJA 4FA5D 4TZ4A 3I8CA 4A2LA 2AGWA 2HESX 4BUJC 4ERQA 4A08A 4OZUA 2G99A 3PSCB 5THAA 3F3GA 4UI9R 2J55H 2H3XA 5AFU3 4CY3A 3EI2A 3SWSD 4PXWA 1PBYB 4L3GD 2QC5A 2H9NA 5EMJB 4A08B 2H6QA 4A11B 5FKRA 3P4FA 1S4UX 3SMRA 3SVWD 4J78A 1OLZA 4LG8A 4GMBA 4A0BB 1YFQA 2OJYA 3RFGA 3SLED 3SBQA 4CY1A 2G9AA 2AGXA 5HE2B 2Z2PA 1JMXB 4LG9A 1L0QA 4X61B 3JPXA 5SXMA 4GM3A 5GXHA 3EU7A 5H17A 2QXVA 3JZHA 4ZOXA 5FXYA 2I0RA 1MG3A 3EI2B 5GXIA 4YVDA 3I8EA 2XL2A 4MK0B 2XYIA 3V5WB 2CN2A 3CFVA 2HKRA 3C5MA 4J73A 4Y7RA 3SFZA 3L4MD 2J56H 2P9LC 3JROA 3I7KA 2CE9A 1VYHC 2PM9B 3EI4B 3AH8B 4X3EA 2O9KA 5K19A 3PXWD 1N6FA 4GQ2P 3IJ0A 1B9XA 1PGUA 1JMZB 4J0WA 3UR4A 2AGLA 1MDAH 2UZXB 4GGDA 3UVKA 3F3PA 3EG6A 4ZOYA 3E0CA 4E54A 1GP2B 4N14A 3DXMC 3OKTA 4K3JB 3NVQA 3C9CA 3K27A 5IJ7E 4E54B 3MZLA 2I3TA 5HE1B 3I7OA 2OK6A 2H9PA 4ZOVA 4JSXC 3AL8A 3GFCA 3N0EA 2I0TA 4J0XA 3JZGA 3DM0A 5CXCB 3C99A 4U1EI 4J8GA 4PC0A 2J57G 1RI6A 4J84A 5EAMA 5EMLB 4QL1A 3VGZA 5GSAA 3I2NA 3IJCA 5IGQA 1XHMA 4QQEA 4LGNA 4QT8A 2AGZA 4ERZA 5FKTA 4CZXA 2P9SC 2H9LA 3EWEA 4Z8LA 3MKSB 4PSXB 4QRJA 2W18A 1SQJA 3C75H 4OWRA 3SN6B 3ZWLB 4O1QD 3FGBA 2IURA 2CO0C 4J8BA 3RSEC 4FB1D 2PBIB 5FKQA 5IJ8E 5FA5B 3V9FA 2AH1A 4A0BA 4A0AA 5FKSA 3OL2B 3I7NA 3KRWB 2I0SA 4A11A 4CI8A 3RN0D 4XEIC 4AEZA 4FWWA 2TRCB 1N6DA 3K26A 3SCYA 3IKOA 4GM9A 4XYIA 2OK4A 3IJ1A 5C2WB 2OVPB 2YBAA 4CZYA 1JJUB 3BG0A 1Q47A 2EBSA 4CY2A 3UVNA 4U7AA 2HJ4A 4J77A 4JT5C 2IUVA 3I7HA 1JOFA 3SBRA 5K1CC 4A0AB 2HYEA 3B7FA 5EAPA 2YNPA 3EI3A 2GC4A 4FA4D 3W15A 5CXBA 3EI1A 4JD2C 4PNKB 3UVLA 2H13A 3CIKB 3EI3B 3EMHA 4I79A 2B5LA 2P9IC 3PVUB 2HXCA 2YMUA 3A0FA 4E5ZB 5I5IA 4FA9D 3SHFA 4EWRA 5JWZA 4IMMA 3RLMD 1U4CA 1A0RB 4IA9A 1OMWB 3DWLC 3UVOA 1N6EA 3AL8B 3ULEC 4CI1A 3J80g 4PSWB 2YB8B 2P9UC 3F3FA 4H5JA 5TDHB 1XIPA 2B4EA 2AGYA 2OIZA 3I7PA 5AMSA 5HQGA 5I5JA 2AH0A 3MMYA 2H9MA 3OW8A 3MKQA 3BWSA 3OTTA 4G56B 1B9YA 4GM8A 2CNXA 2YNOA 3FRXA 2PM9A 4J79A 4CC9A 2H6NA 4FAND 1TBGA 4GZ8A 5CXBB 4GGAA 5EM2B 3JAMg 3IIWA 3ODTA 4BH6A 5EMMB 3N0DA 3UVMA 1NEXB 4JXMA 1NR0A 3OL2A 4X63B 2HKMA 4JSNC 4A7JA 1SQ9A 1R5MA 4J86A 4A09B 4ES0A 3MXXA 1XKSA 3AFCA 2IWFA 4JT6C 4CI2A 1GXRA 2CN3A 3L4OD 5TF2A 2OVQB 4NSXA 4PBZA 2XL3A 5IC7A 2PM6B 4J87A 4L3HD 1PEVA 5AJAA 3VH0A 3EI4A 1ERJA 3RMZD 5HYNB 4KFMB 5C2VB 3MZKA 4XYHA 3IIYA 4GQBB 4JSPC 3SBPA 2XU7A 2BBKH 4AOWA 4K3ID 2IUQA 4Y5RD 3I7LA 3SJLD 2PM7B 1SHYB 2H68A 3UKRC 1QNIA 2Z2OA 2P9PC 4R7AB 4CI3A 1PI6A 3ORVD 1K32A 2P9KC 3DXKC 3JRPA 3EI1B 3NVXA 5EALA 2AQ5A 3PVWB 4JSVC 5GMKn 3PE7A 2CO0A 2GC7A 3PSLA 5TEFA 5A2Qg 1MG2A 2CE8A 3BG1A 4FHLA 4GGCA 5I5MA 5HE3B 2Z2NA 4A2MA 5EMKB 5H1MA 5KDOB 5CYKB 4PBYA 2GNQA 4X60B 5C9ZB 4E5ZA 4O3TB 1P22A 5TEEA 5B4WA 4O45A 5IT9g 4ESGA 5FLXg 4J82A 4A09A 4L1QD 3CFSB 1U2VC 4D0KA 3FM0A 4ZOZA 5HE0B 3I89A 2H47A 4O9DA 5CXCA 3UKUC 5EM2A 1TYQC 2B5NA 5EARA 4FA1D 3OKYA 3AL9A 1GG2B 3PXSD 2B5MA 3HFQA 4ERYA 5FQDA 3RRMC 2Q7QA 4CZVA
chains in the Genus database with same CATH superfamily
4ZN4A 2IUPA 3ZE1A 2HU7A 5M61A 4NENA 3U4YA 2BCJB 3DSMA 2H6KA 4BCDA 3JZNA 4FAVD 3V7DB 1GOTB 2P9NC 4BL0A 2IAAA 3RN1D 5E6RA 5CYKA 3SXTD 4IRZA 3OKWA 4O3UB 4UM9A 4J81A 1VE7A 4D6VA 2YNNA 5M5UA 1FWXA 2H14A 3RFHA 2OVRB 5IGOA 3NIGA 3J81g 1K8KC 3JB9L 2MTAH 3GREA 3OKYB 4L9OA 5H14A 3NVNA 3VA6A 5FFGA 4L1MA 2I3SA 3OF7A 4H5IA 2IWKA 2HJBA 4CY5A 4GQ1A 3PXTD 3KRXB 3ZDYA 2UZYB 4HDJA 4FA5D 1VE6A 4TZ4A 3I8CA 4A2LA 2AGWA 3IULA 2HESX 4BUJC 3IUMA 3V4PA 4OZUA 4ERQA 2G99A 4A08A 3PSCB 5THAA 3F3GA 4UI9R 3FCUA 2J55H 2H3XA 5AFU3 4CY3A 3EI2A 3T3PA 3SWSD 2VZ1A 4PXWA 1PBYB 1UOOA 4Z7NA 4L3GD 2QC5A 2H9NA 5EMJB 4A08B 2H6QA 4A11B 5FKRA 3P4FA 4AMZA 4DNUA 3K71A 1S4UX 3SMRA 3SVWD 4J78A 1OLZA 4LG8A 4GMBA 4A0BB 1YFQA 2OJYA 3RFGA 3SLED 3SBQA 4CY1A 2AGXA 2G9AA 5HE2B 5E6UA 2VDRA 2Z2PA 1JMXB 4LG9A 1L0QA 4X61B 3JPXA 5SXMA 4GM3A 5GXHA 3EU7A 5H17A 2QXVA 2VZ3A 3JZHA 4ZOXA 5FXYA 2I0RA 3K6SA 1MG3A 3EI2B 4QAMA 5GXIA 4YVDA 3I8EA 2XL2A 2VDMA 4MK0B 4O02A 3IUNA 2XYIA 3V5WB 2CN2A 3CFVA 3V4VA 2HKRA 3C5MA 4J73A 4Y7RA 3SFZA 3L4MD 2J56H 2XDWA 1QFMA 2P9LC 3I7KA 3JROA 2CE9A 4MMYA 1VYHC 2PM9B 1L5GA 3EI4B 5C86A 3AH8B 4X3EA 2O9KA 5K19A 3PXWD 2HU8A 1N6FA 4GQ2P 3IJ0A 1B9XA 1PGUA 4Z7OA 1JMZB 4J0WA 4G1MA 1E8NA 4O2WA 3UR4A 2AGLA 1H2XA 2VDOA 1MDAH 4WK0A 1H2WA 2VDLA 2UZXB 4GGDA 3UVKA 3F3PA 3EG6A 2VDNA 4ZOYA 3E0CA 4E54A 1GP2B 4N14A 3DXMC 3OKTA 4K3JB 3NVQA 3C9CA 3K27A 2HU5A 5IJ7E 4E54B 3MZLA 4NAAA 4UM8A 2I3TA 5HE1B 3I7OA 1H2ZA 2OK6A 2H9PA 2XZGA 4JSXC 4ZOVA 2QR5A 3AL8A 3GFCA 3N0EA 2I0TA 4WJKA 4J0XA 3JZGA 3DM0A 5CXCB 3MVDK 4MMXA 3C99A 4J8GA 4U1EI 4PC0A 2J57G 1RI6A 4J84A 4AN1A 5EAMA 5EMLB 3GD1I 3T3MA 4QL1A 3VGZA 5GSAA 3I2NA 3IJCA 5IGQA 1K3IA 1XHMA 4QQEA 4LGNA 4QT8A 2AGZA 1E5TA 4ERZA 5FKTA 4CZXA 2VDPA 2P9SC 2H9LA 4DNWA 3EWEA 3O4HA 4Z8LA 3MKSB 4PSXB 2VDKA 3GC3B 4QRJA 2W18A 1SQJA 3C75H 4OWRA 3SN6B 3VI3A 3ZWLB 4O1QD 1M1XA 3FGBA 1GOHA 2IURA 2CO0C 5FFOA 1QFSA 4J8BA 3RSEC 1O6FA 4FB1D 2PBIB 4RE5A 5FKQA 5IJ8E 5FA5B 3V9FA 2AH1A 4A0BA 2EICA 1UOPA 4JHPC 5FKSA 4A0AA 3OL2B 3I7NA 3IUQA 3KRWB 3ZE2A 1UTCA 2I0SA 4WK2A 4A11A 4CI8A 4G1EA 1A12A 4XEIC 3RN0D 4AEZA 4FWWA 2TRCB 1N6DA 1JV2A 3K26A 3MUOA 3SCYA 4RE6A 3IKOA 4GM9A 3ZE0A 4XYIA 2OK4A 3IJ1A 5C2WB 2OVPB 2YBAA 4CZYA 3VI4A 1JJUB 5E6SA 4BP8A 3BG0A 4G55A 5M5RA 1Q47A 2EBSA 4CY2A 3UVNA 4U7AA 1C9IA 2HJ4A 4J77A 4JT5C 2IUVA 3ZDZA 3I7HA 1JOFA 3SBRA 5K1CC 4A0AB 2HYEA 3B7FA 5M5VA 1I2MB 5EAPA 2YNPA 2XE4A 3EI3A 2GC4A 4FA4D 3W15A 5CXBA 4NC4A 3EI1A 3IURA 4JD2C 4PNKB 2H13A 3UVLA 3CIKB 3EI3B 3EMHA 4I79A 2B5LA 4DNVA 2P9IC 3PVUB 2HXCA 2YMUA 3A0FA 4E5ZB 5I5IA 4FA9D 3SHFA 4EWRA 5JWZA 4IMMA 3RLMD 1U4CA 1A0RB 4IA9A 1OMWB 3DWLC 3UVOA 1N6EA 3AL8B 3ULEC 4CI1A 1H2YA 3J80g 4PSWB 2YB8B 2P9UC 3F3FA 4H5JA 5TDHB 1XIPA 2B4EA 2AGYA 2OIZA 3I7PA 5AMSA 5HQGA 5I5JA 5M5SA 2WQ8A 2AH0A 3MMYA 2H9MA 3OW8A 3DDUA 3MKQA 3BWSA 2EIDA 3OTTA 4G56B 1B9YA 4GM8A 1GOFA 2CNXA 2YNOA 3FRXA 2PM9A 3NIFA 4J79A 1O6GA 4CC9A 2H6NA 1JTDB 3NIDA 4FAND 1TBGA 4GZ8A 4Z7QA 5CXBB 4GGAA 1T2XA 5EM2B 3JAMg 3IIWA 3ODTA 4D9SA 4BH6A 5EMMB 3N0DA 4BP9A 3UVMA 1NEXB 1VZ3A 4JXMA 1NR0A 3OL2A 4X63B 2HKMA 4JSNC 4A7JA 1SQ9A 1R5MA 4J86A 4A09B 4ES0A 3QHYB 3MXXA 1XKSA 3AFCA 2IWFA 3KCIA 4JT6C 4CI2A 1TYEA 2QZPA 1GXRA 2CN3A 3L4OD 5TF2A 1UOQA 4NSXA 4PBZA 2OVQB 2XL3A 5IC7A 2PM6B 2EIEA 4J87A 4L3HD 1PEVA 3IVMA 5AJAA 3VH0A 3EI4A 1ERJA 2VC2A 3RMZD 5HYNB 4KFMB 3ZDXA 5C2VB 4WK4A 3MZKA 4XYHA 2VDQA 3IIYA 3EQ7A 4GQBB 4JSPC 3SBPA 2XU7A 1U8CA 3IJEA 2BBKH 3QI0A 4AOWA 4K3ID 2IUQA 4Y5RD 3I7LA 1C9LA 1VZ2A 3SJLD 2PM7B 1SHYB 2BKLA 2H68A 3UKRC 1QNIA 2Z2OA 1BPOA 2P9PC 4R7AB 4CI3A 1PI6A 4AN0A 3ORVD 1K32A 2P9KC 3DXKC 3JRPA 3EI1B 3NVXA 4JHNA 5EALA 1GOGA 2AQ5A 5C92A 3PVWB 4JSVC 5GMKn 3PE7A 2CO0A 3O4IA 3O4GA 2GC7A 3PSLA 5TEFA 4AMYA 5A2Qg 1MG2A 1E8MA 2CE8A 3BG1A 3MUNA 4FHLA 3K72A 4GGCA 5I5MA 5HE3B 2Z2NA 4A2MA 5EMKB 5H1MA 5KDOB 5CYKB 2JKXA 4PBYA 2GNQA 4X60B 5C9ZB 4E5ZA 3O4JA 4NBMA 4O3TB 1P22A 5TEEA 5B4WA 4BCCA 4O45A 5IT9g 3EQ9A 4ESGA 4MMZA 4BCBA 5FLXg 4J82A 4A09A 4L1QD 3CFSB 1U2VC 4D0KA 3IUJA 3FM0A 4ZOZA 5HE0B 3FCSA 3I89A 2H47A 4O9DA 5CXCA 5M5TA 3UKUC 5EM2A 1TYQC 2EIBA 2B5NA 5EARA 3EQ8A 4AX4A 5HDBA 4FA1D 3OKYA 1YR2A 1GG2B 3PXSD 3AL9A 2B5MA 3HFQA 4ERYA 5FQDA 3RRMC 2Q7QA 4CZVA
chains in the Genus database with same CATH topology
4ZN4A 2IUPA 3U4YA 2BCJB 3DSMA 2H6KA 3JZNA 4FAVD 3V7DB 1GOTB 2P9NC 4BL0A 2IAAA 3RN1D 5CYKA 3SXTD 3OKWA 4O3UB 4J81A 4D6VA 2YNNA 1FWXA 2H14A 3RFHA 2OVRB 5IGOA 3J81g 1K8KC 3JB9L 2MTAH 3GREA 3OKYB 4L9OA 5H14A 3NVNA 3VA6A 2I3SA 4H5IA 2IWKA 2HJBA 4CY5A 4GQ1A 3PXTD 3KRXB 2UZYB 4HDJA 4FA5D 4TZ4A 3I8CA 4A2LA 2AGWA 2HESX 4BUJC 4ERQA 4A08A 4OZUA 2G99A 3PSCB 5THAA 3F3GA 4UI9R 2J55H 2H3XA 5AFU3 4CY3A 3EI2A 3SWSD 4PXWA 1PBYB 4L3GD 2QC5A 2H9NA 5EMJB 4A08B 2H6QA 4A11B 5FKRA 3P4FA 1S4UX 3SMRA 3SVWD 4J78A 1OLZA 4LG8A 4GMBA 4A0BB 1YFQA 2OJYA 3RFGA 3SLED 3SBQA 4CY1A 2G9AA 2AGXA 5HE2B 2Z2PA 1JMXB 4LG9A 1L0QA 4X61B 3JPXA 5SXMA 4GM3A 5GXHA 3EU7A 5H17A 2QXVA 3JZHA 4ZOXA 5FXYA 2I0RA 1MG3A 3EI2B 5GXIA 4YVDA 3I8EA 2XL2A 4MK0B 2XYIA 3V5WB 2CN2A 3CFVA 2HKRA 3C5MA 4J73A 4Y7RA 3SFZA 3L4MD 2J56H 2P9LC 3JROA 3I7KA 2CE9A 1VYHC 2PM9B 3EI4B 3AH8B 4X3EA 2O9KA 5K19A 3PXWD 1N6FA 4GQ2P 3IJ0A 1B9XA 1PGUA 1JMZB 4J0WA 3UR4A 2AGLA 1MDAH 2UZXB 4GGDA 3UVKA 3F3PA 3EG6A 4ZOYA 3E0CA 4E54A 1GP2B 4N14A 3DXMC 3OKTA 4K3JB 3NVQA 3C9CA 3K27A 5IJ7E 4E54B 3MZLA 2I3TA 5HE1B 3I7OA 2OK6A 2H9PA 4ZOVA 4JSXC 3AL8A 3GFCA 3N0EA 2I0TA 4J0XA 3JZGA 3DM0A 5CXCB 3C99A 4U1EI 4J8GA 4PC0A 2J57G 1RI6A 4J84A 5EAMA 5EMLB 4QL1A 3VGZA 5GSAA 3I2NA 3IJCA 5IGQA 1XHMA 4QQEA 4LGNA 4QT8A 2AGZA 4ERZA 5FKTA 4CZXA 2P9SC 2H9LA 3EWEA 4Z8LA 3MKSB 4PSXB 4QRJA 2W18A 1SQJA 3C75H 4OWRA 3SN6B 3ZWLB 4O1QD 3FGBA 2IURA 2CO0C 4J8BA 3RSEC 4FB1D 2PBIB 5FKQA 5IJ8E 5FA5B 3V9FA 2AH1A 4A0BA 4A0AA 5FKSA 3OL2B 3I7NA 3KRWB 2I0SA 4A11A 4CI8A 3RN0D 4XEIC 4AEZA 4FWWA 2TRCB 1N6DA 3K26A 3SCYA 3IKOA 4GM9A 4XYIA 2OK4A 3IJ1A 5C2WB 2OVPB 2YBAA 4CZYA 1JJUB 3BG0A 1Q47A 2EBSA 4CY2A 3UVNA 4U7AA 2HJ4A 4J77A 4JT5C 2IUVA 3I7HA 1JOFA 3SBRA 5K1CC 4A0AB 2HYEA 3B7FA 5EAPA 2YNPA 3EI3A 2GC4A 4FA4D 3W15A 5CXBA 3EI1A 4JD2C 4PNKB 3UVLA 2H13A 3CIKB 3EI3B 3EMHA 4I79A 2B5LA 2P9IC 3PVUB 2HXCA 2YMUA 3A0FA 4E5ZB 5I5IA 4FA9D 3SHFA 4EWRA 5JWZA 4IMMA 3RLMD 1U4CA 1A0RB 4IA9A 1OMWB 3DWLC 3UVOA 1N6EA 3AL8B 3ULEC 4CI1A 3J80g 4PSWB 2YB8B 2P9UC 3F3FA 4H5JA 5TDHB 1XIPA 2B4EA 2AGYA 2OIZA 3I7PA 5AMSA 5HQGA 5I5JA 2AH0A 3MMYA 2H9MA 3OW8A 3MKQA 3BWSA 3OTTA 4G56B 1B9YA 4GM8A 2CNXA 2YNOA 3FRXA 2PM9A 4J79A 4CC9A 2H6NA 4FAND 1TBGA 4GZ8A 5CXBB 4GGAA 5EM2B 3JAMg 3IIWA 3ODTA 4BH6A 5EMMB 3N0DA 3UVMA 1NEXB 4JXMA 1NR0A 3OL2A 4X63B 2HKMA 4JSNC 4A7JA 1SQ9A 1R5MA 4J86A 4A09B 4ES0A 3MXXA 1XKSA 3AFCA 2IWFA 4JT6C 4CI2A 1GXRA 2CN3A 3L4OD 5TF2A 2OVQB 4NSXA 4PBZA 2XL3A 5IC7A 2PM6B 4J87A 4L3HD 1PEVA 5AJAA 3VH0A 3EI4A 1ERJA 3RMZD 5HYNB 4KFMB 5C2VB 3MZKA 4XYHA 3IIYA 4GQBB 4JSPC 3SBPA 2XU7A 2BBKH 4AOWA 4K3ID 2IUQA 4Y5RD 3I7LA 3SJLD 2PM7B 1SHYB 2H68A 3UKRC 1QNIA 2Z2OA 2P9PC 4R7AB 4CI3A 1PI6A 3ORVD 1K32A 2P9KC 3DXKC 3JRPA 3EI1B 3NVXA 5EALA 2AQ5A 3PVWB 4JSVC 5GMKn 3PE7A 2CO0A 2GC7A 3PSLA 5TEFA 5A2Qg 1MG2A 2CE8A 3BG1A 4FHLA 4GGCA 5I5MA 5HE3B 2Z2NA 4A2MA 5EMKB 5H1MA 5KDOB 5CYKB 4PBYA 2GNQA 4X60B 5C9ZB 4E5ZA 4O3TB 1P22A 5TEEA 5B4WA 4O45A 5IT9g 4ESGA 5FLXg 4J82A 4A09A 4L1QD 3CFSB 1U2VC 4D0KA 3FM0A 4ZOZA 5HE0B 3I89A 2H47A 4O9DA 5CXCA 3UKUC 5EM2A 1TYQC 2B5NA 5EARA 4FA1D 3OKYA 3AL9A 1GG2B 3PXSD 2B5MA 3HFQA 4ERYA 5FQDA 3RRMC 2Q7QA 4CZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZN4 A;  2IUP A;  3U4Y A;  2BCJ B;  3DSM A;  2H6K A;  3JZN A;  4FAV D;  3V7D B;  1GOT B;  2P9N C;  4BL0 A;  2IAA A;  3RN1 D;  5CYK A;  3SXT D;  3OKW A;  4O3U B;  4J81 A;  4D6V A;  2YNN A;  1FWX A;  2H14 A;  3RFH A;  2OVR B;  5IGO A;  3J81 g;  1K8K C;  3JB9 L;  2MTA H;  3GRE A;  3OKY B;  4L9O A;  5H14 A;  3NVN A;  3VA6 A;  2I3S A;  4H5I A;  2IWK A;  2HJB A;  4CY5 A;  4GQ1 A;  3PXT D;  3KRX B;  2UZY B;  4HDJ A;  4FA5 D;  4TZ4 A;  3I8C A;  4A2L A;  2AGW A;  2HES X;  4BUJ C;  4ERQ A;  4A08 A;  4OZU A;  2G99 A;  3PSC B;  5THA A;  3F3G A;  4UI9 R;  2J55 H;  2H3X A;  5AFU 3;  4CY3 A;  3EI2 A;  3SWS D;  4PXW A;  1PBY B;  4L3G D;  2QC5 A;  2H9N A;  5EMJ B;  4A08 B;  2H6Q A;  4A11 B;  5FKR A;  3P4F A;  1S4U X;  3SMR A;  3SVW D;  4J78 A;  1OLZ A;  4LG8 A;  4GMB A;  4A0B B;  1YFQ A;  2OJY A;  3RFG A;  3SLE D;  3SBQ A;  4CY1 A;  2G9A A;  2AGX A;  5HE2 B;  2Z2P A;  1JMX B;  4LG9 A;  1L0Q A;  4X61 B;  3JPX A;  5SXM A;  4GM3 A;  5GXH A;  3EU7 A;  5H17 A;  2QXV A;  3JZH A;  4ZOX A;  5FXY A;  2I0R A;  1MG3 A;  3EI2 B;  5GXI A;  4YVD A;  3I8E A;  2XL2 A;  4MK0 B;  2XYI A;  3V5W B;  2CN2 A;  3CFV A;  2HKR A;  3C5M A;  4J73 A;  4Y7R A;  3SFZ A;  3L4M D;  2J56 H;  2P9L C;  3JRO A;  3I7K A;  2CE9 A;  1VYH C;  2PM9 B;  3EI4 B;  3AH8 B;  4X3E A;  2O9K A;  5K19 A;  3PXW D;  1N6F A;  4GQ2 P;  3IJ0 A;  1B9X A;  1PGU A;  1JMZ B;  4J0W A;  3UR4 A;  2AGL A;  1MDA H;  2UZX B;  4GGD A;  3UVK A;  3F3P A;  3EG6 A;  4ZOY A;  3E0C A;  4E54 A;  1GP2 B;  4N14 A;  3DXM C;  3OKT A;  4K3J B;  3NVQ A;  3C9C A;  3K27 A;  5IJ7 E;  4E54 B;  3MZL A;  2I3T A;  5HE1 B;  3I7O A;  2OK6 A;  2H9P A;  4ZOV A;  4JSX C;  3AL8 A;  3GFC A;  3N0E A;  2I0T A;  4J0X A;  3JZG A;  3DM0 A;  5CXC B;  3C99 A;  4U1E I;  4J8G A;  4PC0 A;  2J57 G;  1RI6 A;  4J84 A;  5EAM A;  5EML B;  4QL1 A;  3VGZ A;  5GSA A;  3I2N A;  3IJC A;  5IGQ A;  1XHM A;  4QQE A;  4LGN A;  4QT8 A;  2AGZ A;  4ERZ A;  5FKT A;  4CZX A;  2P9S C;  2H9L A;  3EWE A;  4Z8L A;  3MKS B;  4PSX B;  4QRJ A;  2W18 A;  1SQJ A;  3C75 H;  4OWR A;  3SN6 B;  3ZWL B;  4O1Q D;  3FGB A;  2IUR A;  2CO0 C;  4J8B A;  3RSE C;  4FB1 D;  2PBI B;  5FKQ A;  5IJ8 E;  5FA5 B;  3V9F A;  2AH1 A;  4A0B A;  4A0A A;  5FKS A;  3OL2 B;  3I7N A;  3KRW B;  2I0S A;  4A11 A;  4CI8 A;  3RN0 D;  4XEI C;  4AEZ A;  4FWW A;  2TRC B;  1N6D A;  3K26 A;  3SCY A;  3IKO A;  4GM9 A;  4XYI A;  2OK4 A;  3IJ1 A;  5C2W B;  2OVP B;  2YBA A;  4CZY A;  1JJU B;  3BG0 A;  1Q47 A;  2EBS A;  4CY2 A;  3UVN A;  4U7A A;  2HJ4 A;  4J77 A;  4JT5 C;  2IUV A;  3I7H A;  1JOF A;  3SBR A;  5K1C C;  4A0A B;  2HYE A;  3B7F A;  5EAP A;  2YNP A;  3EI3 A;  2GC4 A;  4FA4 D;  3W15 A;  5CXB A;  3EI1 A;  4JD2 C;  4PNK B;  3UVL A;  2H13 A;  3CIK B;  3EI3 B;  3EMH A;  4I79 A;  2B5L A;  2P9I C;  3PVU B;  2HXC A;  2YMU A;  3A0F A;  4E5Z B;  5I5I A;  4FA9 D;  3SHF A;  4EWR A;  5JWZ A;  4IMM A;  3RLM D;  1U4C A;  1A0R B;  4IA9 A;  1OMW B;  3DWL C;  3UVO A;  1N6E A;  3AL8 B;  3ULE C;  4CI1 A;  3J80 g;  4PSW B;  2YB8 B;  2P9U C;  3F3F A;  4H5J A;  5TDH B;  1XIP A;  2B4E A;  2AGY A;  2OIZ A;  3I7P A;  5AMS A;  5HQG A;  5I5J A;  2AH0 A;  3MMY A;  2H9M A;  3OW8 A;  3MKQ A;  3BWS A;  3OTT A;  4G56 B;  1B9Y A;  4GM8 A;  2CNX A;  2YNO A;  3FRX A;  2PM9 A;  4J79 A;  4CC9 A;  2H6N A;  4FAN D;  1TBG A;  4GZ8 A;  5CXB B;  4GGA A;  5EM2 B;  3JAM g;  3IIW A;  3ODT A;  4BH6 A;  5EMM B;  3N0D A;  3UVM A;  1NEX B;  4JXM A;  1NR0 A;  3OL2 A;  4X63 B;  2HKM A;  4JSN C;  4A7J A;  1SQ9 A;  1R5M A;  4J86 A;  4A09 B;  4ES0 A;  3MXX A;  1XKS A;  3AFC A;  2IWF A;  4JT6 C;  4CI2 A;  1GXR A;  2CN3 A;  3L4O D;  5TF2 A;  2OVQ B;  4NSX A;  4PBZ A;  2XL3 A;  5IC7 A;  2PM6 B;  4J87 A;  4L3H D;  1PEV A;  5AJA A;  3VH0 A;  3EI4 A;  1ERJ A;  3RMZ D;  5HYN B;  4KFM B;  5C2V B;  3MZK A;  4XYH A;  3IIY A;  4GQB B;  4JSP C;  3SBP A;  2XU7 A;  2BBK H;  4AOW A;  4K3I D;  2IUQ A;  4Y5R D;  3I7L A;  3SJL D;  2PM7 B;  1SHY B;  2H68 A;  3UKR C;  1QNI A;  2Z2O A;  2P9P C;  4R7A B;  4CI3 A;  1PI6 A;  3ORV D;  1K32 A;  2P9K C;  3DXK C;  3JRP A;  3EI1 B;  3NVX A;  5EAL A;  2AQ5 A;  3PVW B;  4JSV C;  5GMK n;  3PE7 A;  2CO0 A;  2GC7 A;  3PSL A;  5TEF A;  5A2Q g;  1MG2 A;  2CE8 A;  3BG1 A;  4FHL A;  4GGC A;  5I5M A;  5HE3 B;  2Z2N A;  4A2M A;  5EMK B;  5H1M A;  5KDO B;  5CYK B;  4PBY A;  2GNQ A;  4X60 B;  5C9Z B;  4E5Z A;  4O3T B;  1P22 A;  5TEE A;  5B4W A;  4O45 A;  5IT9 g;  4ESG A;  5FLX g;  4J82 A;  4A09 A;  4L1Q D;  3CFS B;  1U2V C;  4D0K A;  3FM0 A;  4ZOZ A;  5HE0 B;  3I89 A;  2H47 A;  4O9D A;  5CXC A;  3UKU C;  5EM2 A;  1TYQ C;  2B5N A;  5EAR A;  4FA1 D;  3OKY A;  3AL9 A;  1GG2 B;  3PXS D;  2B5M A;  3HFQ A;  4ERY A;  5FQD A;  3RRM C;  2Q7Q A;  4CZV A; 
#chains in the Genus database with same CATH topology
 4ZN4 A;  2IUP A;  3ZE1 A;  2HU7 A;  5M61 A;  4NEN A;  3U4Y A;  2BCJ B;  3DSM A;  2H6K A;  4BCD A;  3JZN A;  4FAV D;  3V7D B;  1GOT B;  2P9N C;  4BL0 A;  2IAA A;  3RN1 D;  5E6R A;  5CYK A;  3SXT D;  4IRZ A;  3OKW A;  4O3U B;  4UM9 A;  4J81 A;  1VE7 A;  4D6V A;  2YNN A;  5M5U A;  1FWX A;  2H14 A;  3RFH A;  2OVR B;  5IGO A;  3NIG A;  3J81 g;  1K8K C;  3JB9 L;  2MTA H;  3GRE A;  3OKY B;  4L9O A;  5H14 A;  3NVN A;  3VA6 A;  5FFG A;  4L1M A;  2I3S A;  3OF7 A;  4H5I A;  2IWK A;  2HJB A;  4CY5 A;  4GQ1 A;  3PXT D;  3KRX B;  3ZDY A;  2UZY B;  4HDJ A;  4FA5 D;  1VE6 A;  4TZ4 A;  3I8C A;  4A2L A;  2AGW A;  3IUL A;  2HES X;  4BUJ C;  3IUM A;  3V4P A;  4OZU A;  4ERQ A;  2G99 A;  4A08 A;  3PSC B;  5THA A;  3F3G A;  4UI9 R;  3FCU A;  2J55 H;  2H3X A;  5AFU 3;  4CY3 A;  3EI2 A;  3T3P A;  3SWS D;  2VZ1 A;  4PXW A;  1PBY B;  1UOO A;  4Z7N A;  4L3G D;  2QC5 A;  2H9N A;  5EMJ B;  4A08 B;  2H6Q A;  4A11 B;  5FKR A;  3P4F A;  4AMZ A;  4DNU A;  3K71 A;  1S4U X;  3SMR A;  3SVW D;  4J78 A;  1OLZ A;  4LG8 A;  4GMB A;  4A0B B;  1YFQ A;  2OJY A;  3RFG A;  3SLE D;  3SBQ A;  4CY1 A;  2AGX A;  2G9A A;  5HE2 B;  5E6U A;  2VDR A;  2Z2P A;  1JMX B;  4LG9 A;  1L0Q A;  4X61 B;  3JPX A;  5SXM A;  4GM3 A;  5GXH A;  3EU7 A;  5H17 A;  2QXV A;  2VZ3 A;  3JZH A;  4ZOX A;  5FXY A;  2I0R A;  3K6S A;  1MG3 A;  3EI2 B;  4QAM A;  5GXI A;  4YVD A;  3I8E A;  2XL2 A;  2VDM A;  4MK0 B;  4O02 A;  3IUN A;  2XYI A;  3V5W B;  2CN2 A;  3CFV A;  3V4V A;  2HKR A;  3C5M A;  4J73 A;  4Y7R A;  3SFZ A;  3L4M D;  2J56 H;  2XDW A;  1QFM A;  2P9L C;  3I7K A;  3JRO A;  2CE9 A;  4MMY A;  1VYH C;  2PM9 B;  1L5G A;  3EI4 B;  5C86 A;  3AH8 B;  4X3E A;  2O9K A;  5K19 A;  3PXW D;  2HU8 A;  1N6F A;  4GQ2 P;  3IJ0 A;  1B9X A;  1PGU A;  4Z7O A;  1JMZ B;  4J0W A;  4G1M A;  1E8N A;  4O2W A;  3UR4 A;  2AGL A;  1H2X A;  2VDO A;  1MDA H;  4WK0 A;  1H2W A;  2VDL A;  2UZX B;  4GGD A;  3UVK A;  3F3P A;  3EG6 A;  2VDN A;  4ZOY A;  3E0C A;  4E54 A;  1GP2 B;  4N14 A;  3DXM C;  3OKT A;  4K3J B;  3NVQ A;  3C9C A;  3K27 A;  2HU5 A;  5IJ7 E;  4E54 B;  3MZL A;  4NAA A;  4UM8 A;  2I3T A;  5HE1 B;  3I7O A;  1H2Z A;  2OK6 A;  2H9P A;  2XZG A;  4JSX C;  4ZOV A;  2QR5 A;  3AL8 A;  3GFC A;  3N0E A;  2I0T A;  4WJK A;  4J0X A;  3JZG A;  3DM0 A;  5CXC B;  3MVD K;  4MMX A;  3C99 A;  4J8G A;  4U1E I;  4PC0 A;  2J57 G;  1RI6 A;  4J84 A;  4AN1 A;  5EAM A;  5EML B;  3GD1 I;  3T3M A;  4QL1 A;  3VGZ A;  5GSA A;  3I2N A;  3IJC A;  5IGQ A;  1K3I A;  1XHM A;  4QQE A;  4LGN A;  4QT8 A;  2AGZ A;  1E5T A;  4ERZ A;  5FKT A;  4CZX A;  2VDP A;  2P9S C;  2H9L A;  4DNW A;  3EWE A;  3O4H A;  4Z8L A;  3MKS B;  4PSX B;  2VDK A;  3GC3 B;  4QRJ A;  2W18 A;  1SQJ A;  3C75 H;  4OWR A;  3SN6 B;  3VI3 A;  3ZWL B;  4O1Q D;  1M1X A;  3FGB A;  1GOH A;  2IUR A;  2CO0 C;  5FFO A;  1QFS A;  4J8B A;  3RSE C;  1O6F A;  4FB1 D;  2PBI B;  4RE5 A;  5FKQ A;  5IJ8 E;  5FA5 B;  3V9F A;  2AH1 A;  4A0B A;  2EIC A;  1UOP A;  4JHP C;  5FKS A;  4A0A A;  3OL2 B;  3I7N A;  3IUQ A;  3KRW B;  3ZE2 A;  1UTC A;  2I0S A;  4WK2 A;  4A11 A;  4CI8 A;  4G1E A;  1A12 A;  4XEI C;  3RN0 D;  4AEZ A;  4FWW A;  2TRC B;  1N6D A;  1JV2 A;  3K26 A;  3MUO A;  3SCY A;  4RE6 A;  3IKO A;  4GM9 A;  3ZE0 A;  4XYI A;  2OK4 A;  3IJ1 A;  5C2W B;  2OVP B;  2YBA A;  4CZY A;  3VI4 A;  1JJU B;  5E6S A;  4BP8 A;  3BG0 A;  4G55 A;  5M5R A;  1Q47 A;  2EBS A;  4CY2 A;  3UVN A;  4U7A A;  1C9I A;  2HJ4 A;  4J77 A;  4JT5 C;  2IUV A;  3ZDZ A;  3I7H A;  1JOF A;  3SBR A;  5K1C C;  4A0A B;  2HYE A;  3B7F A;  5M5V A;  1I2M B;  5EAP A;  2YNP A;  2XE4 A;  3EI3 A;  2GC4 A;  4FA4 D;  3W15 A;  5CXB A;  4NC4 A;  3EI1 A;  3IUR A;  4JD2 C;  4PNK B;  2H13 A;  3UVL A;  3CIK B;  3EI3 B;  3EMH A;  4I79 A;  2B5L A;  4DNV A;  2P9I C;  3PVU B;  2HXC A;  2YMU A;  3A0F A;  4E5Z B;  5I5I A;  4FA9 D;  3SHF A;  4EWR A;  5JWZ A;  4IMM A;  3RLM D;  1U4C A;  1A0R B;  4IA9 A;  1OMW B;  3DWL C;  3UVO A;  1N6E A;  3AL8 B;  3ULE C;  4CI1 A;  1H2Y A;  3J80 g;  4PSW B;  2YB8 B;  2P9U C;  3F3F A;  4H5J A;  5TDH B;  1XIP A;  2B4E A;  2AGY A;  2OIZ A;  3I7P A;  5AMS A;  5HQG A;  5I5J A;  5M5S A;  2WQ8 A;  2AH0 A;  3MMY A;  2H9M A;  3OW8 A;  3DDU A;  3MKQ A;  3BWS A;  2EID A;  3OTT A;  4G56 B;  1B9Y A;  4GM8 A;  1GOF A;  2CNX A;  2YNO A;  3FRX A;  2PM9 A;  3NIF A;  4J79 A;  1O6G A;  4CC9 A;  2H6N A;  1JTD B;  3NID A;  4FAN D;  1TBG A;  4GZ8 A;  4Z7Q A;  5CXB B;  4GGA A;  1T2X A;  5EM2 B;  3JAM g;  3IIW A;  3ODT A;  4D9S A;  4BH6 A;  5EMM B;  3N0D A;  4BP9 A;  3UVM A;  1NEX B;  1VZ3 A;  4JXM A;  1NR0 A;  3OL2 A;  4X63 B;  2HKM A;  4JSN C;  4A7J A;  1SQ9 A;  1R5M A;  4J86 A;  4A09 B;  4ES0 A;  3QHY B;  3MXX A;  1XKS A;  3AFC A;  2IWF A;  3KCI A;  4JT6 C;  4CI2 A;  1TYE A;  2QZP A;  1GXR A;  2CN3 A;  3L4O D;  5TF2 A;  1UOQ A;  4NSX A;  4PBZ A;  2OVQ B;  2XL3 A;  5IC7 A;  2PM6 B;  2EIE A;  4J87 A;  4L3H D;  1PEV A;  3IVM A;  5AJA A;  3VH0 A;  3EI4 A;  1ERJ A;  2VC2 A;  3RMZ D;  5HYN B;  4KFM B;  3ZDX A;  5C2V B;  4WK4 A;  3MZK A;  4XYH A;  2VDQ A;  3IIY A;  3EQ7 A;  4GQB B;  4JSP C;  3SBP A;  2XU7 A;  1U8C A;  3IJE A;  2BBK H;  3QI0 A;  4AOW A;  4K3I D;  2IUQ A;  4Y5R D;  3I7L A;  1C9L A;  1VZ2 A;  3SJL D;  2PM7 B;  1SHY B;  2BKL A;  2H68 A;  3UKR C;  1QNI A;  2Z2O A;  1BPO A;  2P9P C;  4R7A B;  4CI3 A;  1PI6 A;  4AN0 A;  3ORV D;  1K32 A;  2P9K C;  3DXK C;  3JRP A;  3EI1 B;  3NVX A;  4JHN A;  5EAL A;  1GOG A;  2AQ5 A;  5C92 A;  3PVW B;  4JSV C;  5GMK n;  3PE7 A;  2CO0 A;  3O4I A;  3O4G A;  2GC7 A;  3PSL A;  5TEF A;  4AMY A;  5A2Q g;  1MG2 A;  1E8M A;  2CE8 A;  3BG1 A;  3MUN A;  4FHL A;  3K72 A;  4GGC A;  5I5M A;  5HE3 B;  2Z2N A;  4A2M A;  5EMK B;  5H1M A;  5KDO B;  5CYK B;  2JKX A;  4PBY A;  2GNQ A;  4X60 B;  5C9Z B;  4E5Z A;  3O4J A;  4NBM A;  4O3T B;  1P22 A;  5TEE A;  5B4W A;  4BCC A;  4O45 A;  5IT9 g;  3EQ9 A;  4ESG A;  4MMZ A;  4BCB A;  5FLX g;  4J82 A;  4A09 A;  4L1Q D;  3CFS B;  1U2V C;  4D0K A;  3IUJ A;  3FM0 A;  4ZOZ A;  5HE0 B;  3FCS A;  3I89 A;  2H47 A;  4O9D A;  5CXC A;  5M5T A;  3UKU C;  5EM2 A;  1TYQ C;  2EIB A;  2B5N A;  5EAR A;  3EQ8 A;  4AX4 A;  5HDB A;  4FA1 D;  3OKY A;  1YR2 A;  1GG2 B;  3PXS D;  3AL9 A;  2B5M A;  3HFQ A;  4ERY A;  5FQD A;  3RRM C;  2Q7Q A;  4CZV A; 
#chains in the Genus database with same CATH homology
 4ZN4 A;  2IUP A;  3U4Y A;  2BCJ B;  3DSM A;  2H6K A;  3JZN A;  4FAV D;  3V7D B;  1GOT B;  2P9N C;  4BL0 A;  2IAA A;  3RN1 D;  5CYK A;  3SXT D;  3OKW A;  4O3U B;  4J81 A;  4D6V A;  2YNN A;  1FWX A;  2H14 A;  3RFH A;  2OVR B;  5IGO A;  3J81 g;  1K8K C;  3JB9 L;  2MTA H;  3GRE A;  3OKY B;  4L9O A;  5H14 A;  3NVN A;  3VA6 A;  2I3S A;  4H5I A;  2IWK A;  2HJB A;  4CY5 A;  4GQ1 A;  3PXT D;  3KRX B;  2UZY B;  4HDJ A;  4FA5 D;  4TZ4 A;  3I8C A;  4A2L A;  2AGW A;  2HES X;  4BUJ C;  4ERQ A;  4A08 A;  4OZU A;  2G99 A;  3PSC B;  5THA A;  3F3G A;  4UI9 R;  2J55 H;  2H3X A;  5AFU 3;  4CY3 A;  3EI2 A;  3SWS D;  4PXW A;  1PBY B;  4L3G D;  2QC5 A;  2H9N A;  5EMJ B;  4A08 B;  2H6Q A;  4A11 B;  5FKR A;  3P4F A;  1S4U X;  3SMR A;  3SVW D;  4J78 A;  1OLZ A;  4LG8 A;  4GMB A;  4A0B B;  1YFQ A;  2OJY A;  3RFG A;  3SLE D;  3SBQ A;  4CY1 A;  2G9A A;  2AGX A;  5HE2 B;  2Z2P A;  1JMX B;  4LG9 A;  1L0Q A;  4X61 B;  3JPX A;  5SXM A;  4GM3 A;  5GXH A;  3EU7 A;  5H17 A;  2QXV A;  3JZH A;  4ZOX A;  5FXY A;  2I0R A;  1MG3 A;  3EI2 B;  5GXI A;  4YVD A;  3I8E A;  2XL2 A;  4MK0 B;  2XYI A;  3V5W B;  2CN2 A;  3CFV A;  2HKR A;  3C5M A;  4J73 A;  4Y7R A;  3SFZ A;  3L4M D;  2J56 H;  2P9L C;  3JRO A;  3I7K A;  2CE9 A;  1VYH C;  2PM9 B;  3EI4 B;  3AH8 B;  4X3E A;  2O9K A;  5K19 A;  3PXW D;  1N6F A;  4GQ2 P;  3IJ0 A;  1B9X A;  1PGU A;  1JMZ B;  4J0W A;  3UR4 A;  2AGL A;  1MDA H;  2UZX B;  4GGD A;  3UVK A;  3F3P A;  3EG6 A;  4ZOY A;  3E0C A;  4E54 A;  1GP2 B;  4N14 A;  3DXM C;  3OKT A;  4K3J B;  3NVQ A;  3C9C A;  3K27 A;  5IJ7 E;  4E54 B;  3MZL A;  2I3T A;  5HE1 B;  3I7O A;  2OK6 A;  2H9P A;  4ZOV A;  4JSX C;  3AL8 A;  3GFC A;  3N0E A;  2I0T A;  4J0X A;  3JZG A;  3DM0 A;  5CXC B;  3C99 A;  4U1E I;  4J8G A;  4PC0 A;  2J57 G;  1RI6 A;  4J84 A;  5EAM A;  5EML B;  4QL1 A;  3VGZ A;  5GSA A;  3I2N A;  3IJC A;  5IGQ A;  1XHM A;  4QQE A;  4LGN A;  4QT8 A;  2AGZ A;  4ERZ A;  5FKT A;  4CZX A;  2P9S C;  2H9L A;  3EWE A;  4Z8L A;  3MKS B;  4PSX B;  4QRJ A;  2W18 A;  1SQJ A;  3C75 H;  4OWR A;  3SN6 B;  3ZWL B;  4O1Q D;  3FGB A;  2IUR A;  2CO0 C;  4J8B A;  3RSE C;  4FB1 D;  2PBI B;  5FKQ A;  5IJ8 E;  5FA5 B;  3V9F A;  2AH1 A;  4A0B A;  4A0A A;  5FKS A;  3OL2 B;  3I7N A;  3KRW B;  2I0S A;  4A11 A;  4CI8 A;  3RN0 D;  4XEI C;  4AEZ A;  4FWW A;  2TRC B;  1N6D A;  3K26 A;  3SCY A;  3IKO A;  4GM9 A;  4XYI A;  2OK4 A;  3IJ1 A;  5C2W B;  2OVP B;  2YBA A;  4CZY A;  1JJU B;  3BG0 A;  1Q47 A;  2EBS A;  4CY2 A;  3UVN A;  4U7A A;  2HJ4 A;  4J77 A;  4JT5 C;  2IUV A;  3I7H A;  1JOF A;  3SBR A;  5K1C C;  4A0A B;  2HYE A;  3B7F A;  5EAP A;  2YNP A;  3EI3 A;  2GC4 A;  4FA4 D;  3W15 A;  5CXB A;  3EI1 A;  4JD2 C;  4PNK B;  3UVL A;  2H13 A;  3CIK B;  3EI3 B;  3EMH A;  4I79 A;  2B5L A;  2P9I C;  3PVU B;  2HXC A;  2YMU A;  3A0F A;  4E5Z B;  5I5I A;  4FA9 D;  3SHF A;  4EWR A;  5JWZ A;  4IMM A;  3RLM D;  1U4C A;  1A0R B;  4IA9 A;  1OMW B;  3DWL C;  3UVO A;  1N6E A;  3AL8 B;  3ULE C;  4CI1 A;  3J80 g;  4PSW B;  2YB8 B;  2P9U C;  3F3F A;  4H5J A;  5TDH B;  1XIP A;  2B4E A;  2AGY A;  2OIZ A;  3I7P A;  5AMS A;  5HQG A;  5I5J A;  2AH0 A;  3MMY A;  2H9M A;  3OW8 A;  3MKQ A;  3BWS A;  3OTT A;  4G56 B;  1B9Y A;  4GM8 A;  2CNX A;  2YNO A;  3FRX A;  2PM9 A;  4J79 A;  4CC9 A;  2H6N A;  4FAN D;  1TBG A;  4GZ8 A;  5CXB B;  4GGA A;  5EM2 B;  3JAM g;  3IIW A;  3ODT A;  4BH6 A;  5EMM B;  3N0D A;  3UVM A;  1NEX B;  4JXM A;  1NR0 A;  3OL2 A;  4X63 B;  2HKM A;  4JSN C;  4A7J A;  1SQ9 A;  1R5M A;  4J86 A;  4A09 B;  4ES0 A;  3MXX A;  1XKS A;  3AFC A;  2IWF A;  4JT6 C;  4CI2 A;  1GXR A;  2CN3 A;  3L4O D;  5TF2 A;  2OVQ B;  4NSX A;  4PBZ A;  2XL3 A;  5IC7 A;  2PM6 B;  4J87 A;  4L3H D;  1PEV A;  5AJA A;  3VH0 A;  3EI4 A;  1ERJ A;  3RMZ D;  5HYN B;  4KFM B;  5C2V B;  3MZK A;  4XYH A;  3IIY A;  4GQB B;  4JSP C;  3SBP A;  2XU7 A;  2BBK H;  4AOW A;  4K3I D;  2IUQ A;  4Y5R D;  3I7L A;  3SJL D;  2PM7 B;  1SHY B;  2H68 A;  3UKR C;  1QNI A;  2Z2O A;  2P9P C;  4R7A B;  4CI3 A;  1PI6 A;  3ORV D;  1K32 A;  2P9K C;  3DXK C;  3JRP A;  3EI1 B;  3NVX A;  5EAL A;  2AQ5 A;  3PVW B;  4JSV C;  5GMK n;  3PE7 A;  2CO0 A;  2GC7 A;  3PSL A;  5TEF A;  5A2Q g;  1MG2 A;  2CE8 A;  3BG1 A;  4FHL A;  4GGC A;  5I5M A;  5HE3 B;  2Z2N A;  4A2M A;  5EMK B;  5H1M A;  5KDO B;  5CYK B;  4PBY A;  2GNQ A;  4X60 B;  5C9Z B;  4E5Z A;  4O3T B;  1P22 A;  5TEE A;  5B4W A;  4O45 A;  5IT9 g;  4ESG A;  5FLX g;  4J82 A;  4A09 A;  4L1Q D;  3CFS B;  1U2V C;  4D0K A;  3FM0 A;  4ZOZ A;  5HE0 B;  3I89 A;  2H47 A;  4O9D A;  5CXC A;  3UKU C;  5EM2 A;  1TYQ C;  2B5N A;  5EAR A;  4FA1 D;  3OKY A;  3AL9 A;  1GG2 B;  3PXS D;  2B5M A;  3HFQ A;  4ERY A;  5FQD A;  3RRM C;  2Q7Q A;  4CZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...