4JSNC

Structure of mtordeltan-mlst8 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jsnC01
1K8KC 4A0AB 3MKQA 2P9KC 3JPXA 5CXCB 2CE9A 4GQBB 2OJYA 4PXWA 3A0FA 3C99A 4A2LA 3RFGA 4ESGA 1XHMA 3BG1A 3SXTD 3C75H 4EWRA 2HESX 5EMMB 4PNKB 4O3UB 5EM2B 3SHFA 4CY3A 5FKQA 4ERYA 3AH8B 5B4WA 2J56H 3EI1A 3C5MA 5FXYA 4E5ZB 2BBKH 4H5IA 2AQ5A 3OKTA 5EAPA 1JMZB 2P9UC 3GFCA 3MXXA 1QNIA 5IGQA 3JB9L 3RSEC 2OK6A 3OW8A 4JT6C 2IUQA 4J0XA 3DXKC 2CO0C 5H1MA 4OWRA 3BG0A 2YBAA 2H9PA 3EI3A 1JMXB 1N6DA 4X63B 1JOFA 2B5MA 5CYKA 3I8EA 4IA9A 4X60B 1MDAH 2H47A 4JXMA 4FA9D 5FQDA 2HKRA 4GQ1A 3SBQA 4GGCA 2PBIB 2HYEA 2UZXB 4MK0B 4BH6A 3MZKA 3SBPA 2AGLA 2YNPA 4ZOZA 1A0RB 1PGUA 3SWSD 1MG2A 4YVDA 1GXRA 3EI4B 4D6VA 4FA1D 2EBSA 3I7OA 5IJ8E 4QRJA 3OL2B 3B7FA 5C9ZB 3C9CA 4CZYA 5K1CC 3P4FA 5HE0B 4A0BA 2MTAH 3N0EA 1YFQA 5GMKn 4A09B 3SVWD 2P9NC 3MZLA 5TDHB 3SFZA 5I5JA 4CI3A 5HE3B 2IUVA 1PEVA 3MKSB 1Q47A 3EMHA 4J73A 4A08B 3ORVD 4X61B 1S4UX 1PI6A 3FRXA 1OMWB 2H9LA 5EARA 3ZWLB 2I3TA 3J80g 4ZOXA 3AL8B 4IMMA 4CY5A 4R7AB 5AJAA 4L3HD 4GMBA 2OIZA 1RI6A 5H14A 2H9NA 2IWFA 4CZVA 1L0QA 4TZ4A 2IUPA 4U1EI 4JD2C 2Z2NA 2G9AA 4O1QD 4Y5RD 4L9OA 5SXMA 2GC4A 2P9SC 5GSAA 4G56B 2CO0A 5IC7A 2BCJB 2CN3A 4I79A 5IJ7E 2H14A 5EMKB 5GXHA 3I8CA 2I3SA 3SJLD 5H17A 4PSWB 3OKYA 1NEXB 5TEFA 5EMJB 4FAND 2PM6B 3SMRA 4GGDA 4AOWA 2P9IC 4AEZA 5FKSA 1PBYB 4KFMB 4CC9A 2P9PC 3RLMD 5EMLB 3I7PA 3PXSD 3W15A 2QC5A 4A2MA 2YNOA 1FWXA 2OK4A 3KRWB 3L4OD 4Z8LA 3JAMg 3FGBA 4CI1A 1N6FA 2H3XA 3EI1B 2H6QA 4ZOYA 1JJUB 4FHLA 4ZN4A 4K3ID 2XYIA 3I7HA 3UVOA 5IGOA 2AH1A 3ODTA 3BWSA 5AFU3 4PBYA 2YMUA 4A11B 3EI3B 4E5ZA 4L1QD 1U2VC 3I7LA 4GM8A 3DWLC 4GM3A 2IWKA 5K19A 3PE7A 3DM0A 5CYKB 5FKTA 4LGNA 5HYNB 5KDOB 3UVNA 1P22A 5CXBA 5I5IA 1GG2B 4GM9A 2CN2A 3U4YA 2B5LA 3IJ1A 2AGZA 3JZNA 3PVWB 2AGXA 4J8BA 1SHYB 4J78A 1ERJA 3EI2A 2OVQB 3K26A 3OKWA 3CFSB 4GZ8A 4XEIC 4J0WA 3HFQA 3F3PA 2PM9A 1R5MA 4X3EA 4A0BB 3J81g 3CIKB 3IJ0A 2TRCB 3DXMC 2H9MA 1N6EA 3IKOA 2O9KA 4JT5C 4ES0A 3PXTD 4JSXC 3SCYA 4J81A 4A7JA 4FA4D 5FLXg 2I0TA 2QXVA 4J77A 4J8GA 4E54A 4XYHA 1SQJA 3F3GA 5EALA 2Q7QA 3I7KA 1K32A 4CZXA 3K27A 3UR4A 2HKMA 4PBZA 1GOTB 3JZHA 3IJCA 3RN0D 3IIYA 4QL1A 1B9YA 4LG9A 2GNQA 4ERZA 3OKYB 5AMSA 3OTTA 4ZOVA 4CI8A 2J55H 4BL0A 4CY2A 2IAAA 4ERQA 4BUJC 4XYIA 4JSNC 3SBRA 3NVNA 4A0AA 5CXCA 2YNNA 2OVRB 4J84A 1GP2B 2J57G 3JRPA 3KRXB 3UVMA 3JZGA 3RRMC 4J79A 3AFCA 5IT9g 4L3GD 5GXIA 2GC7A 4QT8A 3IIWA 2IURA 3CFVA 5EM2A 3UVLA 5C2WB 4GGAA 3GREA 4Y7RA 4J87A 3UKRC 3VH0A 3EG6A 2HJ4A 3PXWD 4K3JB 5JWZA 5TEEA 4J86A 2CNXA 2Z2PA 4HDJA 5C2VB 4QQEA 1TYQC 5HE2B 5EAMA 3V9FA 3VA6A 4FAVD 3N0DA 2XL3A 4U7AA 2UZYB 5A2Qg 2I0SA 2W18A 5FKRA 5CXBB 4N14A 4A11A 2H6KA 1TBGA 4H5JA 2AH0A 4FB1D 2H6NA 5TF2A 3SLED 2H68A 1MG3A 3RN1D 4D0KA 3AL9A 3I2NA 1B9XA 3EI2B 3UVKA 3EWEA 2AGYA 3DSMA 2HJBA 1VYHC 4NSXA 2H13A 4JSVC 3PSLA 2PM9B 3V7DB 2HXCA 3E0CA 3I89A 3JROA 3ULEC 3I7NA 3PSCB 3EI4A 3PVUB 5THAA 3SN6B 2P9LC 1SQ9A 5HQGA 3RMZD 3OL2A 4CY1A 3F3FA 2YB8B 1XIPA 2CE8A 4A09A 4FWWA 4O9DA 5FA5B 2OVPB 2Z2OA 2G99A 2PM7B 4E54B 4PC0A 3L4MD 2XU7A 4A08A 1XKSA 3MMYA 3NVQA 4FA5D 4GQ2P 4CI2A 3AL8A 3V5WB 3FM0A 2I0RA 2XL2A 4OZUA 3UKUC 3NVXA 1OLZA 2B5NA 1U4CA 4PSXB 3RFHA 5I5MA 4O3TB 4JSPC 2AGWA 4UI9R 5HE1B 2B4EA 3EU7A 4O45A 1NR0A 4LG8A 4J82A 3VGZA
chains in the Genus database with same CATH superfamily
2EICA 1K8KC 4A0AB 3MKQA 2P9KC 1E8MA 3JPXA 5CXCB 2CE9A 4GQBB 2OJYA 3K6SA 4PXWA 2VDNA 2VDOA 3A0FA 3C99A 4A2LA 5HDBA 1JV2A 3RFGA 4ESGA 1XHMA 5M5RA 3BG1A 3SXTD 3K72A 2VDKA 3C75H 3K71A 2HU7A 4EWRA 2HESX 5EMMB 4PNKB 1UOQA 4O3UB 4JHNA 5EM2B 1H2YA 3SHFA 4CY3A 5FKQA 4ERYA 3AH8B 5B4WA 2J56H 3EI1A 2VZ3A 3C5MA 5FXYA 1TYEA 3GC3B 2BBKH 4E5ZB 4H5IA 2AQ5A 3OKTA 5EAPA 1JMZB 2P9UC 3GFCA 1O6FA 3MXXA 3ZE2A 1QNIA 4AX4A 5IGQA 3JB9L 3RSEC 2OK6A 3OW8A 4JT6C 2IUQA 4J0XA 3DXKC 2CO0C 5H1MA 4OWRA 3DDUA 3BG0A 1GOHA 2YBAA 2H9PA 3EI3A 1JMXB 1N6DA 4X63B 3V4VA 3NIDA 5C92A 1JOFA 3IUNA 2B5MA 5CYKA 3I8EA 4IA9A 4X60B 1MDAH 3FCUA 2H47A 2VDLA 3O4GA 4Z7OA 4JXMA 4FA9D 5FQDA 2HKRA 4GQ1A 3SBQA 4GGCA 2PBIB 2HYEA 1UOPA 2UZXB 4MK0B 4BH6A 3MZKA 3SBPA 2AGLA 2YNPA 4ZOZA 1A0RB 1PGUA 3SWSD 1MG2A 4YVDA 1GXRA 3EI4B 4D6VA 4FA1D 2EBSA 3I7OA 3T3MA 5IJ8E 4QRJA 2VZ1A 3OL2B 3B7FA 5C9ZB 3C9CA 4CZYA 5K1CC 3P4FA 5HE0B 4A0BA 2VDMA 1O6GA 2MTAH 3N0EA 1YFQA 5GMKn 4A09B 3SVWD 2P9NC 3MZLA 5TDHB 2EIBA 3OF7A 2VDPA 3SFZA 5I5JA 4G1EA 4CI3A 5HE3B 2IUVA 1PEVA 3MKSB 1Q47A 4L1MA 3EMHA 4J73A 4A08B 3ORVD 2VC2A 1E8NA 4X61B 1S4UX 1PI6A 3FRXA 1OMWB 2H9LA 5EARA 3T3PA 3ZWLB 4G1MA 2I3TA 3J80g 4ZOXA 3AL8B 4IMMA 4CY5A 4R7AB 1GOFA 4L3HD 5AJAA 5M5SA 4GMBA 2OIZA 1RI6A 5H14A 2H9NA 2IWFA 3QHYB 4CZVA 2QR5A 1L0QA 4TZ4A 2IUPA 4U1EI 4JD2C 2Z2NA 2G9AA 4O1QD 1H2ZA 4Y5RD 4L9OA 5SXMA 2GC4A 2P9SC 5GSAA 4G56B 2CO0A 5IC7A 2BCJB 1H2WA 2CN3A 2QZPA 4I79A 5IJ7E 2H14A 5EMKB 5GXHA 1T2XA 1U8CA 3I8CA 2I3SA 2JKXA 3SJLD 5H17A 4PSWB 3OKYA 4DNVA 1NEXB 5TEFA 5EMJB 4FAND 2PM6B 3SMRA 4GGDA 3EQ7A 4AOWA 2P9IC 4AEZA 5E6RA 5FKSA 1PBYB 4KFMB 4CC9A 2P9PC 3IUMA 3RLMD 5EMLB 3VI4A 3I7PA 3PXSD 3W15A 2QC5A 4A2MA 2YNOA 1FWXA 2OK4A 1H2XA 3KRWB 3L4OD 4Z8LA 3JAMg 3FGBA 4CI1A 1N6FA 2H3XA 3EI1B 2H6QA 4ZOYA 1JJUB 4FHLA 3FCSA 5M5VA 3NIFA 4K3ID 2XYIA 4ZN4A 4BCCA 3I7HA 3UVOA 5IGOA 2AH1A 1GOGA 3O4JA 2VDRA 3ODTA 2VDQA 3BWSA 5AFU3 4PBYA 4BCBA 2YMUA 4A11B 3EI3B 4MMZA 4L1QD 1U2VC 3I7LA 4E5ZA 4AMZA 4GM8A 3DWLC 4GM3A 2IWKA 5K19A 3IULA 3PE7A 3DM0A 5CYKB 5FKTA 4LGNA 5HYNB 1QFMA 5KDOB 3UVNA 4BP8A 1P22A 5CXBA 5I5IA 1GG2B 4GM9A 3ZDXA 2CN2A 3U4YA 2B5LA 4D9SA 3IJ1A 2AGZA 3JZNA 4WJKA 3PVWB 2AGXA 4UM9A 4J8BA 1SHYB 1I2MB 4J78A 3IJEA 4O02A 1ERJA 3EI2A 2OVQB 3K26A 3OKWA 2EIDA 3CFSB 1UOOA 4GZ8A 4XEIC 4J0WA 3HFQA 5M5TA 3F3PA 2PM9A 1R5MA 4X3EA 4A0BB 3J81g 3CIKB 3IJ0A 2TRCB 3DXMC 2HU8A 4AMYA 2H9MA 1N6EA 3IKOA 2O9KA 4JT5C 4Z7NA 4ES0A 2EIEA 3PXTD 4JSXC 3SCYA 3ZDYA 4J81A 4A7JA 4FA4D 5FLXg 3O4IA 2I0TA 2QXVA 4J77A 4J8GA 2HU5A 4NBMA 4E54A 4XYHA 3ZE0A 1SQJA 4NENA 3MVDK 3F3GA 4QAMA 5EALA 2Q7QA 3I7KA 1K32A 4CZXA 3K27A 3UR4A 2HKMA 5M61A 4PBZA 1GOTB 3MUOA 3JZHA 3IJCA 3RN0D 3IIYA 4QL1A 1VZ3A 1B9YA 3NIGA 4LG9A 2GNQA 4ERZA 3OKYB 5AMSA 4NAAA 3OTTA 3IUQA 4ZOVA 4CI8A 1L5GA 2J55H 2WQ8A 2IAAA 4BL0A 4CY2A 4ERQA 4BUJC 4XYIA 4JSNC 3SBRA 3NVNA 4A0AA 4WK4A 4DNUA 5CXCA 4RE6A 2YNNA 2OVRB 4J84A 1GP2B 2J57G 3JRPA 4WK2A 4O2WA 1M1XA 2XE4A 3KRXB 3UVMA 3JZGA 4G55A 3RRMC 4J79A 3AFCA 4NC4A 5IT9g 4L3GD 5GXIA 3EQ9A 2GC7A 4QT8A 3IIWA 2IURA 3CFVA 5EM2A 3UVLA 5C2WB 4GGAA 3GREA 4IRZA 4Y7RA 4J87A 3UKRC 3VH0A 3EG6A 2HJ4A 3GD1I 3PXWD 4K3JB 5JWZA 5TEEA 4J86A 1C9LA 2CNXA 2Z2PA 3V4PA 4HDJA 2XZGA 3EQ8A 4Z7QA 1BPOA 5C2VB 4QQEA 1TYQC 5HE2B 3MUNA 5EAMA 3V9FA 2BKLA 4WK0A 3VA6A 4FAVD 3N0DA 1UTCA 2XL3A 4U7AA 2UZYB 3QI0A 5A2Qg 2I0SA 2W18A 5FKRA 5CXBB 4N14A 4A11A 2H6KA 1TBGA 4H5JA 1K3IA 2AH0A 3IVMA 1C9IA 4FB1D 5E6SA 1VE7A 2H6NA 5TF2A 3SLED 2H68A 1MG3A 3RN1D 4D0KA 3AL9A 1JTDB 3I2NA 3ZDZA 4DNWA 1B9XA 3EI2B 3UVKA 3EWEA 2AGYA 1VZ2A 1QFSA 2HJBA 3DSMA 1VYHC 4NSXA 2H13A 3O4HA 4UM8A 4JSVC 3PSLA 2PM9B 3V7DB 2HXCA 3E0CA 2XDWA 3I89A 3JROA 3ULEC 3I7NA 3PSCB 5FFGA 3EI4A 3PVUB 5THAA 3SN6B 2P9LC 3VI3A 1SQ9A 5HQGA 3KCIA 1VE6A 3RMZD 3OL2A 4AN1A 4CY1A 4RE5A 3F3FA 5C86A 2YB8B 1YR2A 1XIPA 4BCDA 2CE8A 4A09A 4FWWA 4O9DA 5FA5B 5E6UA 4MMXA 2OVPB 1E5TA 2Z2OA 2G99A 2PM7B 4E54B 3ZE1A 4PC0A 3L4MD 2XU7A 4A08A 1XKSA 3MMYA 3NVQA 4FA5D 3IURA 4GQ2P 4CI2A 3AL8A 3V5WB 5FFOA 3FM0A 2I0RA 2XL2A 3IUJA 4OZUA 3UKUC 3NVXA 1OLZA 2B5NA 5M5UA 1A12A 1U4CA 4PSXB 3RFHA 5I5MA 4MMYA 4O3TB 4JSPC 2AGWA 4UI9R 5HE1B 2B4EA 4AN0A 3EU7A 4O45A 1NR0A 4LG8A 4JHPC 4J82A 3VGZA 4BP9A
chains in the Genus database with same CATH topology
1K8KC 4A0AB 3MKQA 2P9KC 3JPXA 5CXCB 2CE9A 4GQBB 2OJYA 4PXWA 3A0FA 3C99A 4A2LA 3RFGA 4ESGA 1XHMA 3BG1A 3SXTD 3C75H 4EWRA 2HESX 5EMMB 4PNKB 4O3UB 5EM2B 3SHFA 4CY3A 5FKQA 4ERYA 3AH8B 5B4WA 2J56H 3EI1A 3C5MA 5FXYA 4E5ZB 2BBKH 4H5IA 2AQ5A 3OKTA 5EAPA 1JMZB 2P9UC 3GFCA 3MXXA 1QNIA 5IGQA 3JB9L 3RSEC 2OK6A 3OW8A 4JT6C 2IUQA 4J0XA 3DXKC 2CO0C 5H1MA 4OWRA 3BG0A 2YBAA 2H9PA 3EI3A 1JMXB 1N6DA 4X63B 1JOFA 2B5MA 5CYKA 3I8EA 4IA9A 4X60B 1MDAH 2H47A 4JXMA 4FA9D 5FQDA 2HKRA 4GQ1A 3SBQA 4GGCA 2PBIB 2HYEA 2UZXB 4MK0B 4BH6A 3MZKA 3SBPA 2AGLA 2YNPA 4ZOZA 1A0RB 1PGUA 3SWSD 1MG2A 4YVDA 1GXRA 3EI4B 4D6VA 4FA1D 2EBSA 3I7OA 5IJ8E 4QRJA 3OL2B 3B7FA 5C9ZB 3C9CA 4CZYA 5K1CC 3P4FA 5HE0B 4A0BA 2MTAH 3N0EA 1YFQA 5GMKn 4A09B 3SVWD 2P9NC 3MZLA 5TDHB 3SFZA 5I5JA 4CI3A 5HE3B 2IUVA 1PEVA 3MKSB 1Q47A 3EMHA 4J73A 4A08B 3ORVD 4X61B 1S4UX 1PI6A 3FRXA 1OMWB 2H9LA 5EARA 3ZWLB 2I3TA 3J80g 4ZOXA 3AL8B 4IMMA 4CY5A 4R7AB 5AJAA 4L3HD 4GMBA 2OIZA 1RI6A 5H14A 2H9NA 2IWFA 4CZVA 1L0QA 4TZ4A 2IUPA 4U1EI 4JD2C 2Z2NA 2G9AA 4O1QD 4Y5RD 4L9OA 5SXMA 2GC4A 2P9SC 5GSAA 4G56B 2CO0A 5IC7A 2BCJB 2CN3A 4I79A 5IJ7E 2H14A 5EMKB 5GXHA 3I8CA 2I3SA 3SJLD 5H17A 4PSWB 3OKYA 1NEXB 5TEFA 5EMJB 4FAND 2PM6B 3SMRA 4GGDA 4AOWA 2P9IC 4AEZA 5FKSA 1PBYB 4KFMB 4CC9A 2P9PC 3RLMD 5EMLB 3I7PA 3PXSD 3W15A 2QC5A 4A2MA 2YNOA 1FWXA 2OK4A 3KRWB 3L4OD 4Z8LA 3JAMg 3FGBA 4CI1A 1N6FA 2H3XA 3EI1B 2H6QA 4ZOYA 1JJUB 4FHLA 4ZN4A 4K3ID 2XYIA 3I7HA 3UVOA 5IGOA 2AH1A 3ODTA 3BWSA 5AFU3 4PBYA 2YMUA 4A11B 3EI3B 4E5ZA 4L1QD 1U2VC 3I7LA 4GM8A 3DWLC 4GM3A 2IWKA 5K19A 3PE7A 3DM0A 5CYKB 5FKTA 4LGNA 5HYNB 5KDOB 3UVNA 1P22A 5CXBA 5I5IA 1GG2B 4GM9A 2CN2A 3U4YA 2B5LA 3IJ1A 2AGZA 3JZNA 3PVWB 2AGXA 4J8BA 1SHYB 4J78A 1ERJA 3EI2A 2OVQB 3K26A 3OKWA 3CFSB 4GZ8A 4XEIC 4J0WA 3HFQA 3F3PA 2PM9A 1R5MA 4X3EA 4A0BB 3J81g 3CIKB 3IJ0A 2TRCB 3DXMC 2H9MA 1N6EA 3IKOA 2O9KA 4JT5C 4ES0A 3PXTD 4JSXC 3SCYA 4J81A 4A7JA 4FA4D 5FLXg 2I0TA 2QXVA 4J77A 4J8GA 4E54A 4XYHA 1SQJA 3F3GA 5EALA 2Q7QA 3I7KA 1K32A 4CZXA 3K27A 3UR4A 2HKMA 4PBZA 1GOTB 3JZHA 3IJCA 3RN0D 3IIYA 4QL1A 1B9YA 4LG9A 2GNQA 4ERZA 3OKYB 5AMSA 3OTTA 4ZOVA 4CI8A 2J55H 4BL0A 4CY2A 2IAAA 4ERQA 4BUJC 4XYIA 4JSNC 3SBRA 3NVNA 4A0AA 5CXCA 2YNNA 2OVRB 4J84A 1GP2B 2J57G 3JRPA 3KRXB 3UVMA 3JZGA 3RRMC 4J79A 3AFCA 5IT9g 4L3GD 5GXIA 2GC7A 4QT8A 3IIWA 2IURA 3CFVA 5EM2A 3UVLA 5C2WB 4GGAA 3GREA 4Y7RA 4J87A 3UKRC 3VH0A 3EG6A 2HJ4A 3PXWD 4K3JB 5JWZA 5TEEA 4J86A 2CNXA 2Z2PA 4HDJA 5C2VB 4QQEA 1TYQC 5HE2B 5EAMA 3V9FA 3VA6A 4FAVD 3N0DA 2XL3A 4U7AA 2UZYB 5A2Qg 2I0SA 2W18A 5FKRA 5CXBB 4N14A 4A11A 2H6KA 1TBGA 4H5JA 2AH0A 4FB1D 2H6NA 5TF2A 3SLED 2H68A 1MG3A 3RN1D 4D0KA 3AL9A 3I2NA 1B9XA 3EI2B 3UVKA 3EWEA 2AGYA 3DSMA 2HJBA 1VYHC 4NSXA 2H13A 4JSVC 3PSLA 2PM9B 3V7DB 2HXCA 3E0CA 3I89A 3JROA 3ULEC 3I7NA 3PSCB 3EI4A 3PVUB 5THAA 3SN6B 2P9LC 1SQ9A 5HQGA 3RMZD 3OL2A 4CY1A 3F3FA 2YB8B 1XIPA 2CE8A 4A09A 4FWWA 4O9DA 5FA5B 2OVPB 2Z2OA 2G99A 2PM7B 4E54B 4PC0A 3L4MD 2XU7A 4A08A 1XKSA 3MMYA 3NVQA 4FA5D 4GQ2P 4CI2A 3AL8A 3V5WB 3FM0A 2I0RA 2XL2A 4OZUA 3UKUC 3NVXA 1OLZA 2B5NA 1U4CA 4PSXB 3RFHA 5I5MA 4O3TB 4JSPC 2AGWA 4UI9R 5HE1B 2B4EA 3EU7A 4O45A 1NR0A 4LG8A 4J82A 3VGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8K C;  4A0A B;  3MKQ A;  2P9K C;  3JPX A;  5CXC B;  2CE9 A;  4GQB B;  2OJY A;  4PXW A;  3A0F A;  3C99 A;  4A2L A;  3RFG A;  4ESG A;  1XHM A;  3BG1 A;  3SXT D;  3C75 H;  4EWR A;  2HES X;  5EMM B;  4PNK B;  4O3U B;  5EM2 B;  3SHF A;  4CY3 A;  5FKQ A;  4ERY A;  3AH8 B;  5B4W A;  2J56 H;  3EI1 A;  3C5M A;  5FXY A;  4E5Z B;  2BBK H;  4H5I A;  2AQ5 A;  3OKT A;  5EAP A;  1JMZ B;  2P9U C;  3GFC A;  3MXX A;  1QNI A;  5IGQ A;  3JB9 L;  3RSE C;  2OK6 A;  3OW8 A;  4JT6 C;  2IUQ A;  4J0X A;  3DXK C;  2CO0 C;  5H1M A;  4OWR A;  3BG0 A;  2YBA A;  2H9P A;  3EI3 A;  1JMX B;  1N6D A;  4X63 B;  1JOF A;  2B5M A;  5CYK A;  3I8E A;  4IA9 A;  4X60 B;  1MDA H;  2H47 A;  4JXM A;  4FA9 D;  5FQD A;  2HKR A;  4GQ1 A;  3SBQ A;  4GGC A;  2PBI B;  2HYE A;  2UZX B;  4MK0 B;  4BH6 A;  3MZK A;  3SBP A;  2AGL A;  2YNP A;  4ZOZ A;  1A0R B;  1PGU A;  3SWS D;  1MG2 A;  4YVD A;  1GXR A;  3EI4 B;  4D6V A;  4FA1 D;  2EBS A;  3I7O A;  5IJ8 E;  4QRJ A;  3OL2 B;  3B7F A;  5C9Z B;  3C9C A;  4CZY A;  5K1C C;  3P4F A;  5HE0 B;  4A0B A;  2MTA H;  3N0E A;  1YFQ A;  5GMK n;  4A09 B;  3SVW D;  2P9N C;  3MZL A;  5TDH B;  3SFZ A;  5I5J A;  4CI3 A;  5HE3 B;  2IUV A;  1PEV A;  3MKS B;  1Q47 A;  3EMH A;  4J73 A;  4A08 B;  3ORV D;  4X61 B;  1S4U X;  1PI6 A;  3FRX A;  1OMW B;  2H9L A;  5EAR A;  3ZWL B;  2I3T A;  3J80 g;  4ZOX A;  3AL8 B;  4IMM A;  4CY5 A;  4R7A B;  5AJA A;  4L3H D;  4GMB A;  2OIZ A;  1RI6 A;  5H14 A;  2H9N A;  2IWF A;  4CZV A;  1L0Q A;  4TZ4 A;  2IUP A;  4U1E I;  4JD2 C;  2Z2N A;  2G9A A;  4O1Q D;  4Y5R D;  4L9O A;  5SXM A;  2GC4 A;  2P9S C;  5GSA A;  4G56 B;  2CO0 A;  5IC7 A;  2BCJ B;  2CN3 A;  4I79 A;  5IJ7 E;  2H14 A;  5EMK B;  5GXH A;  3I8C A;  2I3S A;  3SJL D;  5H17 A;  4PSW B;  3OKY A;  1NEX B;  5TEF A;  5EMJ B;  4FAN D;  2PM6 B;  3SMR A;  4GGD A;  4AOW A;  2P9I C;  4AEZ A;  5FKS A;  1PBY B;  4KFM B;  4CC9 A;  2P9P C;  3RLM D;  5EML B;  3I7P A;  3PXS D;  3W15 A;  2QC5 A;  4A2M A;  2YNO A;  1FWX A;  2OK4 A;  3KRW B;  3L4O D;  4Z8L A;  3JAM g;  3FGB A;  4CI1 A;  1N6F A;  2H3X A;  3EI1 B;  2H6Q A;  4ZOY A;  1JJU B;  4FHL A;  4ZN4 A;  4K3I D;  2XYI A;  3I7H A;  3UVO A;  5IGO A;  2AH1 A;  3ODT A;  3BWS A;  5AFU 3;  4PBY A;  2YMU A;  4A11 B;  3EI3 B;  4E5Z A;  4L1Q D;  1U2V C;  3I7L A;  4GM8 A;  3DWL C;  4GM3 A;  2IWK A;  5K19 A;  3PE7 A;  3DM0 A;  5CYK B;  5FKT A;  4LGN A;  5HYN B;  5KDO B;  3UVN A;  1P22 A;  5CXB A;  5I5I A;  1GG2 B;  4GM9 A;  2CN2 A;  3U4Y A;  2B5L A;  3IJ1 A;  2AGZ A;  3JZN A;  3PVW B;  2AGX A;  4J8B A;  1SHY B;  4J78 A;  1ERJ A;  3EI2 A;  2OVQ B;  3K26 A;  3OKW A;  3CFS B;  4GZ8 A;  4XEI C;  4J0W A;  3HFQ A;  3F3P A;  2PM9 A;  1R5M A;  4X3E A;  4A0B B;  3J81 g;  3CIK B;  3IJ0 A;  2TRC B;  3DXM C;  2H9M A;  1N6E A;  3IKO A;  2O9K A;  4JT5 C;  4ES0 A;  3PXT D;  4JSX C;  3SCY A;  4J81 A;  4A7J A;  4FA4 D;  5FLX g;  2I0T A;  2QXV A;  4J77 A;  4J8G A;  4E54 A;  4XYH A;  1SQJ A;  3F3G A;  5EAL A;  2Q7Q A;  3I7K A;  1K32 A;  4CZX A;  3K27 A;  3UR4 A;  2HKM A;  4PBZ A;  1GOT B;  3JZH A;  3IJC A;  3RN0 D;  3IIY A;  4QL1 A;  1B9Y A;  4LG9 A;  2GNQ A;  4ERZ A;  3OKY B;  5AMS A;  3OTT A;  4ZOV A;  4CI8 A;  2J55 H;  4BL0 A;  4CY2 A;  2IAA A;  4ERQ A;  4BUJ C;  4XYI A;  4JSN C;  3SBR A;  3NVN A;  4A0A A;  5CXC A;  2YNN A;  2OVR B;  4J84 A;  1GP2 B;  2J57 G;  3JRP A;  3KRX B;  3UVM A;  3JZG A;  3RRM C;  4J79 A;  3AFC A;  5IT9 g;  4L3G D;  5GXI A;  2GC7 A;  4QT8 A;  3IIW A;  2IUR A;  3CFV A;  5EM2 A;  3UVL A;  5C2W B;  4GGA A;  3GRE A;  4Y7R A;  4J87 A;  3UKR C;  3VH0 A;  3EG6 A;  2HJ4 A;  3PXW D;  4K3J B;  5JWZ A;  5TEE A;  4J86 A;  2CNX A;  2Z2P A;  4HDJ A;  5C2V B;  4QQE A;  1TYQ C;  5HE2 B;  5EAM A;  3V9F A;  3VA6 A;  4FAV D;  3N0D A;  2XL3 A;  4U7A A;  2UZY B;  5A2Q g;  2I0S A;  2W18 A;  5FKR A;  5CXB B;  4N14 A;  4A11 A;  2H6K A;  1TBG A;  4H5J A;  2AH0 A;  4FB1 D;  2H6N A;  5TF2 A;  3SLE D;  2H68 A;  1MG3 A;  3RN1 D;  4D0K A;  3AL9 A;  3I2N A;  1B9X A;  3EI2 B;  3UVK A;  3EWE A;  2AGY A;  3DSM A;  2HJB A;  1VYH C;  4NSX A;  2H13 A;  4JSV C;  3PSL A;  2PM9 B;  3V7D B;  2HXC A;  3E0C A;  3I89 A;  3JRO A;  3ULE C;  3I7N A;  3PSC B;  3EI4 A;  3PVU B;  5THA A;  3SN6 B;  2P9L C;  1SQ9 A;  5HQG A;  3RMZ D;  3OL2 A;  4CY1 A;  3F3F A;  2YB8 B;  1XIP A;  2CE8 A;  4A09 A;  4FWW A;  4O9D A;  5FA5 B;  2OVP B;  2Z2O A;  2G99 A;  2PM7 B;  4E54 B;  4PC0 A;  3L4M D;  2XU7 A;  4A08 A;  1XKS A;  3MMY A;  3NVQ A;  4FA5 D;  4GQ2 P;  4CI2 A;  3AL8 A;  3V5W B;  3FM0 A;  2I0R A;  2XL2 A;  4OZU A;  3UKU C;  3NVX A;  1OLZ A;  2B5N A;  1U4C A;  4PSX B;  3RFH A;  5I5M A;  4O3T B;  4JSP C;  2AGW A;  4UI9 R;  5HE1 B;  2B4E A;  3EU7 A;  4O45 A;  1NR0 A;  4LG8 A;  4J82 A;  3VGZ A; 
#chains in the Genus database with same CATH topology
 2EIC A;  1K8K C;  4A0A B;  3MKQ A;  2P9K C;  1E8M A;  3JPX A;  5CXC B;  2CE9 A;  4GQB B;  2OJY A;  3K6S A;  4PXW A;  2VDN A;  2VDO A;  3A0F A;  3C99 A;  4A2L A;  5HDB A;  1JV2 A;  3RFG A;  4ESG A;  1XHM A;  5M5R A;  3BG1 A;  3SXT D;  3K72 A;  2VDK A;  3C75 H;  3K71 A;  2HU7 A;  4EWR A;  2HES X;  5EMM B;  4PNK B;  1UOQ A;  4O3U B;  4JHN A;  5EM2 B;  1H2Y A;  3SHF A;  4CY3 A;  5FKQ A;  4ERY A;  3AH8 B;  5B4W A;  2J56 H;  3EI1 A;  2VZ3 A;  3C5M A;  5FXY A;  1TYE A;  3GC3 B;  2BBK H;  4E5Z B;  4H5I A;  2AQ5 A;  3OKT A;  5EAP A;  1JMZ B;  2P9U C;  3GFC A;  1O6F A;  3MXX A;  3ZE2 A;  1QNI A;  4AX4 A;  5IGQ A;  3JB9 L;  3RSE C;  2OK6 A;  3OW8 A;  4JT6 C;  2IUQ A;  4J0X A;  3DXK C;  2CO0 C;  5H1M A;  4OWR A;  3DDU A;  3BG0 A;  1GOH A;  2YBA A;  2H9P A;  3EI3 A;  1JMX B;  1N6D A;  4X63 B;  3V4V A;  3NID A;  5C92 A;  1JOF A;  3IUN A;  2B5M A;  5CYK A;  3I8E A;  4IA9 A;  4X60 B;  1MDA H;  3FCU A;  2H47 A;  2VDL A;  3O4G A;  4Z7O A;  4JXM A;  4FA9 D;  5FQD A;  2HKR A;  4GQ1 A;  3SBQ A;  4GGC A;  2PBI B;  2HYE A;  1UOP A;  2UZX B;  4MK0 B;  4BH6 A;  3MZK A;  3SBP A;  2AGL A;  2YNP A;  4ZOZ A;  1A0R B;  1PGU A;  3SWS D;  1MG2 A;  4YVD A;  1GXR A;  3EI4 B;  4D6V A;  4FA1 D;  2EBS A;  3I7O A;  3T3M A;  5IJ8 E;  4QRJ A;  2VZ1 A;  3OL2 B;  3B7F A;  5C9Z B;  3C9C A;  4CZY A;  5K1C C;  3P4F A;  5HE0 B;  4A0B A;  2VDM A;  1O6G A;  2MTA H;  3N0E A;  1YFQ A;  5GMK n;  4A09 B;  3SVW D;  2P9N C;  3MZL A;  5TDH B;  2EIB A;  3OF7 A;  2VDP A;  3SFZ A;  5I5J A;  4G1E A;  4CI3 A;  5HE3 B;  2IUV A;  1PEV A;  3MKS B;  1Q47 A;  4L1M A;  3EMH A;  4J73 A;  4A08 B;  3ORV D;  2VC2 A;  1E8N A;  4X61 B;  1S4U X;  1PI6 A;  3FRX A;  1OMW B;  2H9L A;  5EAR A;  3T3P A;  3ZWL B;  4G1M A;  2I3T A;  3J80 g;  4ZOX A;  3AL8 B;  4IMM A;  4CY5 A;  4R7A B;  1GOF A;  4L3H D;  5AJA A;  5M5S A;  4GMB A;  2OIZ A;  1RI6 A;  5H14 A;  2H9N A;  2IWF A;  3QHY B;  4CZV A;  2QR5 A;  1L0Q A;  4TZ4 A;  2IUP A;  4U1E I;  4JD2 C;  2Z2N A;  2G9A A;  4O1Q D;  1H2Z A;  4Y5R D;  4L9O A;  5SXM A;  2GC4 A;  2P9S C;  5GSA A;  4G56 B;  2CO0 A;  5IC7 A;  2BCJ B;  1H2W A;  2CN3 A;  2QZP A;  4I79 A;  5IJ7 E;  2H14 A;  5EMK B;  5GXH A;  1T2X A;  1U8C A;  3I8C A;  2I3S A;  2JKX A;  3SJL D;  5H17 A;  4PSW B;  3OKY A;  4DNV A;  1NEX B;  5TEF A;  5EMJ B;  4FAN D;  2PM6 B;  3SMR A;  4GGD A;  3EQ7 A;  4AOW A;  2P9I C;  4AEZ A;  5E6R A;  5FKS A;  1PBY B;  4KFM B;  4CC9 A;  2P9P C;  3IUM A;  3RLM D;  5EML B;  3VI4 A;  3I7P A;  3PXS D;  3W15 A;  2QC5 A;  4A2M A;  2YNO A;  1FWX A;  2OK4 A;  1H2X A;  3KRW B;  3L4O D;  4Z8L A;  3JAM g;  3FGB A;  4CI1 A;  1N6F A;  2H3X A;  3EI1 B;  2H6Q A;  4ZOY A;  1JJU B;  4FHL A;  3FCS A;  5M5V A;  3NIF A;  4K3I D;  2XYI A;  4ZN4 A;  4BCC A;  3I7H A;  3UVO A;  5IGO A;  2AH1 A;  1GOG A;  3O4J A;  2VDR A;  3ODT A;  2VDQ A;  3BWS A;  5AFU 3;  4PBY A;  4BCB A;  2YMU A;  4A11 B;  3EI3 B;  4MMZ A;  4L1Q D;  1U2V C;  3I7L A;  4E5Z A;  4AMZ A;  4GM8 A;  3DWL C;  4GM3 A;  2IWK A;  5K19 A;  3IUL A;  3PE7 A;  3DM0 A;  5CYK B;  5FKT A;  4LGN A;  5HYN B;  1QFM A;  5KDO B;  3UVN A;  4BP8 A;  1P22 A;  5CXB A;  5I5I A;  1GG2 B;  4GM9 A;  3ZDX A;  2CN2 A;  3U4Y A;  2B5L A;  4D9S A;  3IJ1 A;  2AGZ A;  3JZN A;  4WJK A;  3PVW B;  2AGX A;  4UM9 A;  4J8B A;  1SHY B;  1I2M B;  4J78 A;  3IJE A;  4O02 A;  1ERJ A;  3EI2 A;  2OVQ B;  3K26 A;  3OKW A;  2EID A;  3CFS B;  1UOO A;  4GZ8 A;  4XEI C;  4J0W A;  3HFQ A;  5M5T A;  3F3P A;  2PM9 A;  1R5M A;  4X3E A;  4A0B B;  3J81 g;  3CIK B;  3IJ0 A;  2TRC B;  3DXM C;  2HU8 A;  4AMY A;  2H9M A;  1N6E A;  3IKO A;  2O9K A;  4JT5 C;  4Z7N A;  4ES0 A;  2EIE A;  3PXT D;  4JSX C;  3SCY A;  3ZDY A;  4J81 A;  4A7J A;  4FA4 D;  5FLX g;  3O4I A;  2I0T A;  2QXV A;  4J77 A;  4J8G A;  2HU5 A;  4NBM A;  4E54 A;  4XYH A;  3ZE0 A;  1SQJ A;  4NEN A;  3MVD K;  3F3G A;  4QAM A;  5EAL A;  2Q7Q A;  3I7K A;  1K32 A;  4CZX A;  3K27 A;  3UR4 A;  2HKM A;  5M61 A;  4PBZ A;  1GOT B;  3MUO A;  3JZH A;  3IJC A;  3RN0 D;  3IIY A;  4QL1 A;  1VZ3 A;  1B9Y A;  3NIG A;  4LG9 A;  2GNQ A;  4ERZ A;  3OKY B;  5AMS A;  4NAA A;  3OTT A;  3IUQ A;  4ZOV A;  4CI8 A;  1L5G A;  2J55 H;  2WQ8 A;  2IAA A;  4BL0 A;  4CY2 A;  4ERQ A;  4BUJ C;  4XYI A;  4JSN C;  3SBR A;  3NVN A;  4A0A A;  4WK4 A;  4DNU A;  5CXC A;  4RE6 A;  2YNN A;  2OVR B;  4J84 A;  1GP2 B;  2J57 G;  3JRP A;  4WK2 A;  4O2W A;  1M1X A;  2XE4 A;  3KRX B;  3UVM A;  3JZG A;  4G55 A;  3RRM C;  4J79 A;  3AFC A;  4NC4 A;  5IT9 g;  4L3G D;  5GXI A;  3EQ9 A;  2GC7 A;  4QT8 A;  3IIW A;  2IUR A;  3CFV A;  5EM2 A;  3UVL A;  5C2W B;  4GGA A;  3GRE A;  4IRZ A;  4Y7R A;  4J87 A;  3UKR C;  3VH0 A;  3EG6 A;  2HJ4 A;  3GD1 I;  3PXW D;  4K3J B;  5JWZ A;  5TEE A;  4J86 A;  1C9L A;  2CNX A;  2Z2P A;  3V4P A;  4HDJ A;  2XZG A;  3EQ8 A;  4Z7Q A;  1BPO A;  5C2V B;  4QQE A;  1TYQ C;  5HE2 B;  3MUN A;  5EAM A;  3V9F A;  2BKL A;  4WK0 A;  3VA6 A;  4FAV D;  3N0D A;  1UTC A;  2XL3 A;  4U7A A;  2UZY B;  3QI0 A;  5A2Q g;  2I0S A;  2W18 A;  5FKR A;  5CXB B;  4N14 A;  4A11 A;  2H6K A;  1TBG A;  4H5J A;  1K3I A;  2AH0 A;  3IVM A;  1C9I A;  4FB1 D;  5E6S A;  1VE7 A;  2H6N A;  5TF2 A;  3SLE D;  2H68 A;  1MG3 A;  3RN1 D;  4D0K A;  3AL9 A;  1JTD B;  3I2N A;  3ZDZ A;  4DNW A;  1B9X A;  3EI2 B;  3UVK A;  3EWE A;  2AGY A;  1VZ2 A;  1QFS A;  2HJB A;  3DSM A;  1VYH C;  4NSX A;  2H13 A;  3O4H A;  4UM8 A;  4JSV C;  3PSL A;  2PM9 B;  3V7D B;  2HXC A;  3E0C A;  2XDW A;  3I89 A;  3JRO A;  3ULE C;  3I7N A;  3PSC B;  5FFG A;  3EI4 A;  3PVU B;  5THA A;  3SN6 B;  2P9L C;  3VI3 A;  1SQ9 A;  5HQG A;  3KCI A;  1VE6 A;  3RMZ D;  3OL2 A;  4AN1 A;  4CY1 A;  4RE5 A;  3F3F A;  5C86 A;  2YB8 B;  1YR2 A;  1XIP A;  4BCD A;  2CE8 A;  4A09 A;  4FWW A;  4O9D A;  5FA5 B;  5E6U A;  4MMX A;  2OVP B;  1E5T A;  2Z2O A;  2G99 A;  2PM7 B;  4E54 B;  3ZE1 A;  4PC0 A;  3L4M D;  2XU7 A;  4A08 A;  1XKS A;  3MMY A;  3NVQ A;  4FA5 D;  3IUR A;  4GQ2 P;  4CI2 A;  3AL8 A;  3V5W B;  5FFO A;  3FM0 A;  2I0R A;  2XL2 A;  3IUJ A;  4OZU A;  3UKU C;  3NVX A;  1OLZ A;  2B5N A;  5M5U A;  1A12 A;  1U4C A;  4PSX B;  3RFH A;  5I5M A;  4MMY A;  4O3T B;  4JSP C;  2AGW A;  4UI9 R;  5HE1 B;  2B4E A;  4AN0 A;  3EU7 A;  4O45 A;  1NR0 A;  4LG8 A;  4JHP C;  4J82 A;  3VGZ A;  4BP9 A; 
#chains in the Genus database with same CATH homology
 1K8K C;  4A0A B;  3MKQ A;  2P9K C;  3JPX A;  5CXC B;  2CE9 A;  4GQB B;  2OJY A;  4PXW A;  3A0F A;  3C99 A;  4A2L A;  3RFG A;  4ESG A;  1XHM A;  3BG1 A;  3SXT D;  3C75 H;  4EWR A;  2HES X;  5EMM B;  4PNK B;  4O3U B;  5EM2 B;  3SHF A;  4CY3 A;  5FKQ A;  4ERY A;  3AH8 B;  5B4W A;  2J56 H;  3EI1 A;  3C5M A;  5FXY A;  4E5Z B;  2BBK H;  4H5I A;  2AQ5 A;  3OKT A;  5EAP A;  1JMZ B;  2P9U C;  3GFC A;  3MXX A;  1QNI A;  5IGQ A;  3JB9 L;  3RSE C;  2OK6 A;  3OW8 A;  4JT6 C;  2IUQ A;  4J0X A;  3DXK C;  2CO0 C;  5H1M A;  4OWR A;  3BG0 A;  2YBA A;  2H9P A;  3EI3 A;  1JMX B;  1N6D A;  4X63 B;  1JOF A;  2B5M A;  5CYK A;  3I8E A;  4IA9 A;  4X60 B;  1MDA H;  2H47 A;  4JXM A;  4FA9 D;  5FQD A;  2HKR A;  4GQ1 A;  3SBQ A;  4GGC A;  2PBI B;  2HYE A;  2UZX B;  4MK0 B;  4BH6 A;  3MZK A;  3SBP A;  2AGL A;  2YNP A;  4ZOZ A;  1A0R B;  1PGU A;  3SWS D;  1MG2 A;  4YVD A;  1GXR A;  3EI4 B;  4D6V A;  4FA1 D;  2EBS A;  3I7O A;  5IJ8 E;  4QRJ A;  3OL2 B;  3B7F A;  5C9Z B;  3C9C A;  4CZY A;  5K1C C;  3P4F A;  5HE0 B;  4A0B A;  2MTA H;  3N0E A;  1YFQ A;  5GMK n;  4A09 B;  3SVW D;  2P9N C;  3MZL A;  5TDH B;  3SFZ A;  5I5J A;  4CI3 A;  5HE3 B;  2IUV A;  1PEV A;  3MKS B;  1Q47 A;  3EMH A;  4J73 A;  4A08 B;  3ORV D;  4X61 B;  1S4U X;  1PI6 A;  3FRX A;  1OMW B;  2H9L A;  5EAR A;  3ZWL B;  2I3T A;  3J80 g;  4ZOX A;  3AL8 B;  4IMM A;  4CY5 A;  4R7A B;  5AJA A;  4L3H D;  4GMB A;  2OIZ A;  1RI6 A;  5H14 A;  2H9N A;  2IWF A;  4CZV A;  1L0Q A;  4TZ4 A;  2IUP A;  4U1E I;  4JD2 C;  2Z2N A;  2G9A A;  4O1Q D;  4Y5R D;  4L9O A;  5SXM A;  2GC4 A;  2P9S C;  5GSA A;  4G56 B;  2CO0 A;  5IC7 A;  2BCJ B;  2CN3 A;  4I79 A;  5IJ7 E;  2H14 A;  5EMK B;  5GXH A;  3I8C A;  2I3S A;  3SJL D;  5H17 A;  4PSW B;  3OKY A;  1NEX B;  5TEF A;  5EMJ B;  4FAN D;  2PM6 B;  3SMR A;  4GGD A;  4AOW A;  2P9I C;  4AEZ A;  5FKS A;  1PBY B;  4KFM B;  4CC9 A;  2P9P C;  3RLM D;  5EML B;  3I7P A;  3PXS D;  3W15 A;  2QC5 A;  4A2M A;  2YNO A;  1FWX A;  2OK4 A;  3KRW B;  3L4O D;  4Z8L A;  3JAM g;  3FGB A;  4CI1 A;  1N6F A;  2H3X A;  3EI1 B;  2H6Q A;  4ZOY A;  1JJU B;  4FHL A;  4ZN4 A;  4K3I D;  2XYI A;  3I7H A;  3UVO A;  5IGO A;  2AH1 A;  3ODT A;  3BWS A;  5AFU 3;  4PBY A;  2YMU A;  4A11 B;  3EI3 B;  4E5Z A;  4L1Q D;  1U2V C;  3I7L A;  4GM8 A;  3DWL C;  4GM3 A;  2IWK A;  5K19 A;  3PE7 A;  3DM0 A;  5CYK B;  5FKT A;  4LGN A;  5HYN B;  5KDO B;  3UVN A;  1P22 A;  5CXB A;  5I5I A;  1GG2 B;  4GM9 A;  2CN2 A;  3U4Y A;  2B5L A;  3IJ1 A;  2AGZ A;  3JZN A;  3PVW B;  2AGX A;  4J8B A;  1SHY B;  4J78 A;  1ERJ A;  3EI2 A;  2OVQ B;  3K26 A;  3OKW A;  3CFS B;  4GZ8 A;  4XEI C;  4J0W A;  3HFQ A;  3F3P A;  2PM9 A;  1R5M A;  4X3E A;  4A0B B;  3J81 g;  3CIK B;  3IJ0 A;  2TRC B;  3DXM C;  2H9M A;  1N6E A;  3IKO A;  2O9K A;  4JT5 C;  4ES0 A;  3PXT D;  4JSX C;  3SCY A;  4J81 A;  4A7J A;  4FA4 D;  5FLX g;  2I0T A;  2QXV A;  4J77 A;  4J8G A;  4E54 A;  4XYH A;  1SQJ A;  3F3G A;  5EAL A;  2Q7Q A;  3I7K A;  1K32 A;  4CZX A;  3K27 A;  3UR4 A;  2HKM A;  4PBZ A;  1GOT B;  3JZH A;  3IJC A;  3RN0 D;  3IIY A;  4QL1 A;  1B9Y A;  4LG9 A;  2GNQ A;  4ERZ A;  3OKY B;  5AMS A;  3OTT A;  4ZOV A;  4CI8 A;  2J55 H;  4BL0 A;  4CY2 A;  2IAA A;  4ERQ A;  4BUJ C;  4XYI A;  4JSN C;  3SBR A;  3NVN A;  4A0A A;  5CXC A;  2YNN A;  2OVR B;  4J84 A;  1GP2 B;  2J57 G;  3JRP A;  3KRX B;  3UVM A;  3JZG A;  3RRM C;  4J79 A;  3AFC A;  5IT9 g;  4L3G D;  5GXI A;  2GC7 A;  4QT8 A;  3IIW A;  2IUR A;  3CFV A;  5EM2 A;  3UVL A;  5C2W B;  4GGA A;  3GRE A;  4Y7R A;  4J87 A;  3UKR C;  3VH0 A;  3EG6 A;  2HJ4 A;  3PXW D;  4K3J B;  5JWZ A;  5TEE A;  4J86 A;  2CNX A;  2Z2P A;  4HDJ A;  5C2V B;  4QQE A;  1TYQ C;  5HE2 B;  5EAM A;  3V9F A;  3VA6 A;  4FAV D;  3N0D A;  2XL3 A;  4U7A A;  2UZY B;  5A2Q g;  2I0S A;  2W18 A;  5FKR A;  5CXB B;  4N14 A;  4A11 A;  2H6K A;  1TBG A;  4H5J A;  2AH0 A;  4FB1 D;  2H6N A;  5TF2 A;  3SLE D;  2H68 A;  1MG3 A;  3RN1 D;  4D0K A;  3AL9 A;  3I2N A;  1B9X A;  3EI2 B;  3UVK A;  3EWE A;  2AGY A;  3DSM A;  2HJB A;  1VYH C;  4NSX A;  2H13 A;  4JSV C;  3PSL A;  2PM9 B;  3V7D B;  2HXC A;  3E0C A;  3I89 A;  3JRO A;  3ULE C;  3I7N A;  3PSC B;  3EI4 A;  3PVU B;  5THA A;  3SN6 B;  2P9L C;  1SQ9 A;  5HQG A;  3RMZ D;  3OL2 A;  4CY1 A;  3F3F A;  2YB8 B;  1XIP A;  2CE8 A;  4A09 A;  4FWW A;  4O9D A;  5FA5 B;  2OVP B;  2Z2O A;  2G99 A;  2PM7 B;  4E54 B;  4PC0 A;  3L4M D;  2XU7 A;  4A08 A;  1XKS A;  3MMY A;  3NVQ A;  4FA5 D;  4GQ2 P;  4CI2 A;  3AL8 A;  3V5W B;  3FM0 A;  2I0R A;  2XL2 A;  4OZU A;  3UKU C;  3NVX A;  1OLZ A;  2B5N A;  1U4C A;  4PSX B;  3RFH A;  5I5M A;  4O3T B;  4JSP C;  2AGW A;  4UI9 R;  5HE1 B;  2B4E A;  3EU7 A;  4O45 A;  1NR0 A;  4LG8 A;  4J82 A;  3VGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...