4JSNC

Structure of mtordeltan-mlst8 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jsnC01
2J56H 3I7NA 1Q47A 1GG2B 1XHMA 4E54A 4ERQA 4A08B 4JT5C 4GQ2P 4PSWB 4A2MA 2OJYA 3C5MA 4JD2C 1U2VC 4JSVC 3ZWLB 4ERYA 4E5ZB 4CI3A 2B5LA 3J81g 4JT6C 2P9SC 3ODTA 1P22A 1B9YA 4Y7RA 4LG8A 4IMMA 4GM3A 3UVMA 2XYIA 3I2NA 3HFQA 3NVQA 4FWWA 4PXWA 1PGUA 5FKQA 3UKUC 2H6NA 5EMJB 4D6VA 2IUVA 4A11B 5EM2B 4A0BA 4A09B 5GXIA 3JZGA 2PBIB 3SCYA 4J81A 3OTTA 3EG6A 4X3EA 5IC7A 3K27A 3N0DA 3AL8B 1TBGA 3MKQA 3PXSD 4FA9D 2YNPA 2Z2PA 5TDHB 4ESGA 4LG9A 3MMYA 4CZYA 2CO0A 3K26A 2HESX 5SXMA 5TEEA 3IJ0A 2AGYA 5FKTA 3V5WB 1L0QA 3PXTD 4N14A 2IUQA 1MDAH 5CYKA 4FB1D 4E54B 4JSXC 5I5IA 4O1QD 4J0XA 4I79A 1N6EA 2Z2OA 3EI3B 3BWSA 3EI4A 4ZOXA 2Z2NA 1N6DA 3DXKC 4G56B 5HQGA 4ZOVA 4A08A 3FRXA 2GC7A 2H68A 2H14A 4J87A 5FQDA 2H9MA 2AH0A 3GFCA 5K19A 3RMZD 4JSPC 4R7AB 4E5ZA 3MZLA 5B4WA 2HJ4A 4FAND 3C75H 2HKRA 2OIZA 2H9PA 5H17A 3DXMC 1OLZA 3EMHA 4ES0A 3EI2B 2CO0C 3I7LA 3JB9L 2HYEA 1PI6A 5EMLB 5C2VB 3UVLA 3VH0A 4HDJA 4A11A 2QC5A 1VYHC 4A09A 4CC9A 5AFU3 1ERJA 2P9PC 2PM9B 2IURA 3AL8A 3V7DB 1FWXA 4BUJC 4FA4D 1OMWB 3I7HA 1MG2A 2GC4A 3MZKA 1TYQC 4TZ4A 5GXHA 3C9CA 4PNKB 2HJBA 3UVKA 5C2WB 3PVUB 4L3HD 3EI3A 5EARA 3EU7A 3SBQA 2GNQA 4AOWA 2AGLA 3BG0A 5KDOB 1R5MA 4CY1A 3F3FA 5THAA 3I7OA 4GGDA 5EMKB 4ERZA 2CNXA 4YVDA 4CI1A 3PSLA 4ZOZA 3MKSB 3OL2B 3ULEC 1GP2B 3ORVD 2H3XA 4J73A 5A2Qg 4AEZA 2O9KA 3W15A 4A7JA 3J80g 2TRCB 3VGZA 2PM7B 3OKTA 3CFSB 3N0EA 5H1MA 4XEIC 2OVPB 4CY2A 4GM9A 2H9NA 3OKYB 3EI2A 2XU7A 5EMMB 2AH1A 4J8GA 3JPXA 4NSXA 4FA1D 3FM0A 3L4MD 5K1CC 3RFHA 5IJ7E 2OVRB 2H9LA 1MG3A 2PM9A 5I5MA 5HYNB 1SQJA 2IAAA 4XYHA 5FLXg 5HE1B 4GGAA 1S4UX 4A2LA 1JOFA 2I3SA 5CXCB 4PC0A 2J55H 3JZNA 3SLED 3F3PA 3L4OD 3KRWB 2I0TA 5CXBB 5C9ZB 5HE2B 3B7FA 3IKOA 4X61B 3KRXB 1QNIA 2YNOA 4GQBB 3EWEA 4CZVA 1XIPA 2B5MA 4CI8A 2IWKA 1JMZB 3SJLD 3OL2A 2AQ5A 4PBZA 4H5IA 4U1EI 3RN0D 3AFCA 3IIYA 5FKSA 3PSCB 4X60B 1NR0A 5JWZA 4O3TB 2I0RA 5EALA 3OKYA 4H5JA 4A0AA 4BH6A 3SN6B 2H6QA 3IIWA 4O3UB 3C99A 5FA5B 3UR4A 1N6FA 4J82A 2B4EA 3DWLC 3BG1A 1NEXB 1SHYB 3E0CA 3I7PA 3SHFA 1A0RB 1XKSA 4LGNA 5IT9g 3V9FA 3SBRA 3P4FA 4CZXA 4UI9R 2H6KA 4L1QD 5FKRA 2BBKH 4J77A 2OVQB 3EI1B 2P9LC 3NVXA 4FA5D 2HKMA 2P9UC 2IUPA 4X63B 3JROA 5CXCA 5H14A 2J57G 4MK0B 3I89A 2W18A 2YB8B 2YBAA 2P9NC 4K3JB 5CXBA 2YNNA 4QRJA 3JZHA 2HXCA 4OWRA 3I8EA 3DM0A 3U4YA 4J8BA 2AGZA 4O45A 2CE9A 2OK6A 2UZXB 4D0KA 1GXRA 2B5NA 4GZ8A 4ZOYA 4QL1A 2P9KC 4CY5A 3A0FA 5GMKn 4FHLA 4CI2A 3AL9A 4A0AB 3IJCA 4GQ1A 4QT8A 3IJ1A 1PBYB 3FGBA 3RSEC 2MTAH 4IA9A 5I5JA 3JRPA 2H47A 5FXYA 1YFQA 3I7KA 4U7AA 5EAMA 3SBPA 3AH8B 3RRMC 2XL2A 3CIKB 2I0SA 3SMRA 2I3TA 4L3GD 1JMXB 3PVWB 2P9IC 3EI1A 5IGOA 2AGXA 4O9DA 3OW8A 4J78A 4KFMB 5AMSA 2CE8A 2UZYB 5HE3B 1RI6A 1K8KC 3RN1D 3UKRC 1PEVA 3GREA 2QXVA 3SXTD 3PE7A 3SWSD 3VA6A 4JSNC 2G99A 4K3ID 2AGWA 4PSXB 4OZUA 3CFVA 5TF2A 3RLMD 3NVNA 4GGCA 4J86A 5HE0B 3I8CA 1JJUB 2CN3A 1SQ9A 2PM6B 2OK4A 2IWFA 4GM8A 4Z8LA 5AJAA 3UVOA 2Q7QA 2XL3A 1U4CA 4Y5RD 2YMUA 4PBYA 5GSAA 3RFGA 2BCJB 2EBSA 2CN2A 3JAMg 4A0BB 5EAPA 4XYIA 4EWRA 4GMBA 5IJ8E 4L9OA 5TEFA 2H13A 3SFZA 5EM2A 4BL0A 3DSMA 1B9XA 3OKWA 1K32A 2G9AA 3F3GA 3MXXA 4J79A 4FAVD 4ZN4A 4J84A 3SVWD 3UVNA 5IGQA 4QQEA 4J0WA 5CYKB 4CY3A 1GOTB 3EI4B 3PXWD 4JXMA
chains in the Genus database with same CATH superfamily
2J56H 3I7NA 1Q47A 1GG2B 1GOGA 1XHMA 4E54A 5HDBA 4ERQA 4A08B 4JT5C 4MMYA 4GQ2P 4PSWB 4A2MA 2OJYA 3C5MA 1QFSA 4JD2C 4UM8A 1U2VC 2WQ8A 4JSVC 3O4IA 3ZWLB 3FCUA 4ERYA 4E5ZB 4CI3A 2B5LA 3OF7A 2VZ1A 5FFOA 3J81g 3MUOA 4JT6C 2P9SC 3EQ8A 3ODTA 1E5TA 1P22A 1B9YA 4Y7RA 2QZPA 4LG8A 4IMMA 4GM3A 3UVMA 3K6SA 2XYIA 3I2NA 3HFQA 3NVQA 4FWWA 4PXWA 5C86A 1PGUA 1UOOA 5FKQA 1UOQA 3UKUC 2H6NA 3IUNA 5EMJB 4D6VA 2IUVA 4L1MA 4A11B 1QFMA 5EM2B 1H2WA 4A0BA 4A09B 5GXIA 3JZGA 2PBIB 3SCYA 4J81A 3OTTA 3EG6A 4X3EA 5IC7A 4NENA 3K27A 3N0DA 3AL8B 1TBGA 3MKQA 3PXSD 4FA9D 2YNPA 2Z2PA 2EIDA 5TDHB 3ZE1A 4AN0A 4ESGA 4LG9A 3MMYA 4CZYA 2EIBA 2CO0A 3K26A 2JKXA 2HESX 3NIDA 5SXMA 1UOPA 5TEEA 3IJ0A 2AGYA 5FKTA 3V5WB 1L0QA 3PXTD 4N14A 2IUQA 1MDAH 5CYKA 4FB1D 4E54B 4JSXC 5I5IA 2EIEA 1C9LA 4J0XA 4I79A 1N6EA 4O1QD 2Z2OA 3EI3B 3MVDK 3BWSA 3EI4A 4ZOXA 2Z2NA 1N6DA 3DXKC 4G56B 5M5VA 4DNWA 5HQGA 4ZOVA 4A08A 4QAMA 3FRXA 3GD1I 2GC7A 3ZE2A 2H68A 2H14A 4J87A 5FQDA 2H9MA 2AH0A 3GFCA 5K19A 3RMZD 4JSPC 4R7AB 4E5ZA 3MZLA 5B4WA 2HJ4A 4FAND 3C75H 2HKRA 2OIZA 2H9PA 2XE4A 5H17A 4BCCA 3DXMC 2XDWA 1OLZA 3EMHA 4ES0A 4WK4A 3T3MA 3EI2B 2CO0C 3I7LA 3JB9L 2HYEA 1PI6A 5EMLB 5C2VB 3UVLA 3VH0A 4BP9A 4RE5A 4HDJA 4A11A 2QC5A 1VZ2A 1VYHC 4A09A 4CC9A 3NIGA 4JHPC 3IURA 5AFU3 1ERJA 2P9PC 2PM9B 3DDUA 3O4JA 2IURA 3AL8A 4MMZA 1FWXA 3V7DB 4BUJC 4FA4D 1OMWB 5FFGA 3I7HA 1MG2A 3IUMA 2GC4A 3MZKA 1TYQC 4TZ4A 5GXHA 3C9CA 4PNKB 2HJBA 3UVKA 5C2WB 3PVUB 4NBMA 1UTCA 4L3HD 3EI3A 5EARA 3EU7A 3SBQA 2GNQA 4AOWA 1T2XA 2AGLA 3BG0A 3V4VA 5KDOB 1R5MA 4CY1A 3F3FA 1O6GA 5THAA 5C92A 3I7OA 4GGDA 4Z7NA 2VDKA 5EMKB 3VI3A 4ERZA 2CNXA 4YVDA 4CI1A 3PSLA 4ZOZA 3MKSB 3OL2B 3ULEC 1GP2B 3ORVD 2H3XA 2BKLA 4J73A 5A2Qg 3VI4A 4AEZA 4BCBA 2O9KA 2QR5A 3W15A 4BCDA 4A7JA 1K3IA 3J80g 2TRCB 3IUQA 2PM7B 1E8NA 3OKTA 3CFSB 3VGZA 3N0EA 1H2ZA 4XEIC 5H1MA 2OVPB 4CY2A 4GM9A 2H9NA 3OKYB 3EI2A 2XU7A 5EMMB 2AH1A 4J8GA 3JPXA 2HU5A 4NSXA 4UM9A 4FA1D 3FM0A 3L4MD 5K1CC 3RFHA 5IJ7E 2OVRB 2H9LA 3MUNA 1MG3A 3ZE0A 2VDRA 2PM9A 5I5MA 5HYNB 1SQJA 2IAAA 4XYHA 5M5SA 5FLXg 5HE1B 4G1MA 4NC4A 1L5GA 2VDMA 4GGAA 1E8MA 1M1XA 1S4UX 4A2LA 1JOFA 1YR2A 2I3SA 5CXCB 4PC0A 2J55H 4AMZA 1I2MB 3JZNA 3K71A 3SLED 3F3PA 3L4OD 4G55A 3KRWB 2I0TA 5CXBB 5C9ZB 5HE2B 3B7FA 3IKOA 4X61B 3T3PA 3KRXB 1QNIA 2YNOA 4GQBB 3EWEA 4CZVA 4RE6A 1XIPA 2B5MA 5M5RA 4CI8A 2IWKA 1JMZB 3ZDYA 3SJLD 3OL2A 2AQ5A 4PBZA 1O6FA 4H5IA 4U1EI 3RN0D 4AN1A 3AFCA 3IIYA 5FKSA 3PSCB 4X60B 1NR0A 5JWZA 4O3TB 2I0RA 5EALA 3OKYA 4H5JA 4AX4A 4A0AA 4BH6A 3SN6B 2H6QA 3IIWA 4O3UB 3C99A 5FA5B 3UR4A 1N6FA 4J82A 2B4EA 3DWLC 3BG1A 1NEXB 1SHYB 3E0CA 3I7PA 4O02A 3SHFA 3QI0A 1A0RB 1XKSA 1VE6A 4LGNA 5IT9g 4DNVA 3QHYB 3V9FA 3SBRA 3P4FA 4CZXA 3ZDZA 4UI9R 2H6KA 4L1QD 5FKRA 2BBKH 4J77A 2VDPA 3ZDXA 2OVQB 3EI1B 2P9LC 3NVXA 4FA5D 2HKMA 2P9UC 2IUPA 4X63B 1C9IA 3JROA 5CXCA 5H14A 2J57G 4MK0B 3I89A 4WK2A 2VDQA 2W18A 2YB8B 2YBAA 2P9NC 4K3JB 5CXBA 2YNNA 4QRJA 3JZHA 2HXCA 4OWRA 3I8EA 3DM0A 3U4YA 1JV2A 4J8BA 2AGZA 4O45A 2CE9A 2OK6A 2UZXB 4D0KA 5M61A 1GXRA 2B5NA 4GZ8A 4ZOYA 4QL1A 2P9KC 4CY5A 3A0FA 3GC3B 5GMKn 3EQ7A 4FHLA 4CI2A 3AL9A 4O2WA 4A0AB 3IJCA 3O4GA 4GQ1A 4QT8A 3IJ1A 1PBYB 3FGBA 3IUJA 3RSEC 2MTAH 3IJEA 4IA9A 1TYEA 3IULA 5I5JA 3JRPA 3O4HA 2VDOA 3K72A 2H47A 5E6UA 5FXYA 1YFQA 3I7KA 4U7AA 1H2XA 4IRZA 5EAMA 3SBPA 3AH8B 3RRMC 2XL2A 3CIKB 3IVMA 2I0SA 3SMRA 2I3TA 4L3GD 3FCSA 1JTDB 1JMXB 3PVWB 4NAAA 2VDNA 2P9IC 5M5UA 3EI1A 5IGOA 4AMYA 2AGXA 4O9DA 3OW8A 4J78A 3NIFA 4KFMB 5AMSA 1A12A 2CE8A 2UZYB 5HE3B 1RI6A 1K8KC 3RN1D 3UKRC 1PEVA 3GREA 5E6SA 2QXVA 4Z7QA 3SXTD 3PE7A 3SWSD 3VA6A 4JSNC 2G99A 4K3ID 2AGWA 1GOHA 4PSXB 4OZUA 3CFVA 2VC2A 5TF2A 3RLMD 4WJKA 4D9SA 3NVNA 4GGCA 4J86A 5HE0B 1VZ3A 3I8CA 1JJUB 2CN3A 1SQ9A 2PM6B 3KCIA 2OK4A 4DNUA 2IWFA 4GM8A 4WK0A 4Z8LA 5AJAA 1VE7A 3UVOA 2VDLA 2VZ3A 2Q7QA 2XL3A 1U4CA 4Y5RD 2YMUA 4PBYA 5GSAA 3RFGA 2BCJB 2EBSA 2CN2A 3JAMg 3V4PA 2XZGA 4A0BB 1BPOA 5EAPA 4XYIA 4JHNA 4EWRA 2HU8A 2EICA 4GMBA 5IJ8E 4L9OA 5TEFA 2H13A 3SFZA 4Z7OA 5EM2A 4BL0A 1U8CA 3DSMA 1B9XA 3OKWA 1K32A 4G1EA 4BP8A 2G9AA 3F3GA 2HU7A 3MXXA 3EQ9A 4J79A 4FAVD 4ZN4A 4J84A 3SVWD 5E6RA 3UVNA 5IGQA 4QQEA 4J0WA 5CYKB 4CY3A 1GOTB 4MMXA 1H2YA 3EI4B 3PXWD 5M5TA 4JXMA 1GOFA
chains in the Genus database with same CATH topology
2J56H 3I7NA 1Q47A 1GG2B 1XHMA 4E54A 4ERQA 4A08B 4JT5C 4GQ2P 4PSWB 4A2MA 2OJYA 3C5MA 4JD2C 1U2VC 4JSVC 3ZWLB 4ERYA 4E5ZB 4CI3A 2B5LA 3J81g 4JT6C 2P9SC 3ODTA 1P22A 1B9YA 4Y7RA 4LG8A 4IMMA 4GM3A 3UVMA 2XYIA 3I2NA 3HFQA 3NVQA 4FWWA 4PXWA 1PGUA 5FKQA 3UKUC 2H6NA 5EMJB 4D6VA 2IUVA 4A11B 5EM2B 4A0BA 4A09B 5GXIA 3JZGA 2PBIB 3SCYA 4J81A 3OTTA 3EG6A 4X3EA 5IC7A 3K27A 3N0DA 3AL8B 1TBGA 3MKQA 3PXSD 4FA9D 2YNPA 2Z2PA 5TDHB 4ESGA 4LG9A 3MMYA 4CZYA 2CO0A 3K26A 2HESX 5SXMA 5TEEA 3IJ0A 2AGYA 5FKTA 3V5WB 1L0QA 3PXTD 4N14A 2IUQA 1MDAH 5CYKA 4FB1D 4E54B 4JSXC 5I5IA 4O1QD 4J0XA 4I79A 1N6EA 2Z2OA 3EI3B 3BWSA 3EI4A 4ZOXA 2Z2NA 1N6DA 3DXKC 4G56B 5HQGA 4ZOVA 4A08A 3FRXA 2GC7A 2H68A 2H14A 4J87A 5FQDA 2H9MA 2AH0A 3GFCA 5K19A 3RMZD 4JSPC 4R7AB 4E5ZA 3MZLA 5B4WA 2HJ4A 4FAND 3C75H 2HKRA 2OIZA 2H9PA 5H17A 3DXMC 1OLZA 3EMHA 4ES0A 3EI2B 2CO0C 3I7LA 3JB9L 2HYEA 1PI6A 5EMLB 5C2VB 3UVLA 3VH0A 4HDJA 4A11A 2QC5A 1VYHC 4A09A 4CC9A 5AFU3 1ERJA 2P9PC 2PM9B 2IURA 3AL8A 3V7DB 1FWXA 4BUJC 4FA4D 1OMWB 3I7HA 1MG2A 2GC4A 3MZKA 1TYQC 4TZ4A 5GXHA 3C9CA 4PNKB 2HJBA 3UVKA 5C2WB 3PVUB 4L3HD 3EI3A 5EARA 3EU7A 3SBQA 2GNQA 4AOWA 2AGLA 3BG0A 5KDOB 1R5MA 4CY1A 3F3FA 5THAA 3I7OA 4GGDA 5EMKB 4ERZA 2CNXA 4YVDA 4CI1A 3PSLA 4ZOZA 3MKSB 3OL2B 3ULEC 1GP2B 3ORVD 2H3XA 4J73A 5A2Qg 4AEZA 2O9KA 3W15A 4A7JA 3J80g 2TRCB 3VGZA 2PM7B 3OKTA 3CFSB 3N0EA 5H1MA 4XEIC 2OVPB 4CY2A 4GM9A 2H9NA 3OKYB 3EI2A 2XU7A 5EMMB 2AH1A 4J8GA 3JPXA 4NSXA 4FA1D 3FM0A 3L4MD 5K1CC 3RFHA 5IJ7E 2OVRB 2H9LA 1MG3A 2PM9A 5I5MA 5HYNB 1SQJA 2IAAA 4XYHA 5FLXg 5HE1B 4GGAA 1S4UX 4A2LA 1JOFA 2I3SA 5CXCB 4PC0A 2J55H 3JZNA 3SLED 3F3PA 3L4OD 3KRWB 2I0TA 5CXBB 5C9ZB 5HE2B 3B7FA 3IKOA 4X61B 3KRXB 1QNIA 2YNOA 4GQBB 3EWEA 4CZVA 1XIPA 2B5MA 4CI8A 2IWKA 1JMZB 3SJLD 3OL2A 2AQ5A 4PBZA 4H5IA 4U1EI 3RN0D 3AFCA 3IIYA 5FKSA 3PSCB 4X60B 1NR0A 5JWZA 4O3TB 2I0RA 5EALA 3OKYA 4H5JA 4A0AA 4BH6A 3SN6B 2H6QA 3IIWA 4O3UB 3C99A 5FA5B 3UR4A 1N6FA 4J82A 2B4EA 3DWLC 3BG1A 1NEXB 1SHYB 3E0CA 3I7PA 3SHFA 1A0RB 1XKSA 4LGNA 5IT9g 3V9FA 3SBRA 3P4FA 4CZXA 4UI9R 2H6KA 4L1QD 5FKRA 2BBKH 4J77A 2OVQB 3EI1B 2P9LC 3NVXA 4FA5D 2HKMA 2P9UC 2IUPA 4X63B 3JROA 5CXCA 5H14A 2J57G 4MK0B 3I89A 2W18A 2YB8B 2YBAA 2P9NC 4K3JB 5CXBA 2YNNA 4QRJA 3JZHA 2HXCA 4OWRA 3I8EA 3DM0A 3U4YA 4J8BA 2AGZA 4O45A 2CE9A 2OK6A 2UZXB 4D0KA 1GXRA 2B5NA 4GZ8A 4ZOYA 4QL1A 2P9KC 4CY5A 3A0FA 5GMKn 4FHLA 4CI2A 3AL9A 4A0AB 3IJCA 4GQ1A 4QT8A 3IJ1A 1PBYB 3FGBA 3RSEC 2MTAH 4IA9A 5I5JA 3JRPA 2H47A 5FXYA 1YFQA 3I7KA 4U7AA 5EAMA 3SBPA 3AH8B 3RRMC 2XL2A 3CIKB 2I0SA 3SMRA 2I3TA 4L3GD 1JMXB 3PVWB 2P9IC 3EI1A 5IGOA 2AGXA 4O9DA 3OW8A 4J78A 4KFMB 5AMSA 2CE8A 2UZYB 5HE3B 1RI6A 1K8KC 3RN1D 3UKRC 1PEVA 3GREA 2QXVA 3SXTD 3PE7A 3SWSD 3VA6A 4JSNC 2G99A 4K3ID 2AGWA 4PSXB 4OZUA 3CFVA 5TF2A 3RLMD 3NVNA 4GGCA 4J86A 5HE0B 3I8CA 1JJUB 2CN3A 1SQ9A 2PM6B 2OK4A 2IWFA 4GM8A 4Z8LA 5AJAA 3UVOA 2Q7QA 2XL3A 1U4CA 4Y5RD 2YMUA 4PBYA 5GSAA 3RFGA 2BCJB 2EBSA 2CN2A 3JAMg 4A0BB 5EAPA 4XYIA 4EWRA 4GMBA 5IJ8E 4L9OA 5TEFA 2H13A 3SFZA 5EM2A 4BL0A 3DSMA 1B9XA 3OKWA 1K32A 2G9AA 3F3GA 3MXXA 4J79A 4FAVD 4ZN4A 4J84A 3SVWD 3UVNA 5IGQA 4QQEA 4J0WA 5CYKB 4CY3A 1GOTB 3EI4B 3PXWD 4JXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J56 H;  3I7N A;  1Q47 A;  1GG2 B;  1XHM A;  4E54 A;  4ERQ A;  4A08 B;  4JT5 C;  4GQ2 P;  4PSW B;  4A2M A;  2OJY A;  3C5M A;  4JD2 C;  1U2V C;  4JSV C;  3ZWL B;  4ERY A;  4E5Z B;  4CI3 A;  2B5L A;  3J81 g;  4JT6 C;  2P9S C;  3ODT A;  1P22 A;  1B9Y A;  4Y7R A;  4LG8 A;  4IMM A;  4GM3 A;  3UVM A;  2XYI A;  3I2N A;  3HFQ A;  3NVQ A;  4FWW A;  4PXW A;  1PGU A;  5FKQ A;  3UKU C;  2H6N A;  5EMJ B;  4D6V A;  2IUV A;  4A11 B;  5EM2 B;  4A0B A;  4A09 B;  5GXI A;  3JZG A;  2PBI B;  3SCY A;  4J81 A;  3OTT A;  3EG6 A;  4X3E A;  5IC7 A;  3K27 A;  3N0D A;  3AL8 B;  1TBG A;  3MKQ A;  3PXS D;  4FA9 D;  2YNP A;  2Z2P A;  5TDH B;  4ESG A;  4LG9 A;  3MMY A;  4CZY A;  2CO0 A;  3K26 A;  2HES X;  5SXM A;  5TEE A;  3IJ0 A;  2AGY A;  5FKT A;  3V5W B;  1L0Q A;  3PXT D;  4N14 A;  2IUQ A;  1MDA H;  5CYK A;  4FB1 D;  4E54 B;  4JSX C;  5I5I A;  4O1Q D;  4J0X A;  4I79 A;  1N6E A;  2Z2O A;  3EI3 B;  3BWS A;  3EI4 A;  4ZOX A;  2Z2N A;  1N6D A;  3DXK C;  4G56 B;  5HQG A;  4ZOV A;  4A08 A;  3FRX A;  2GC7 A;  2H68 A;  2H14 A;  4J87 A;  5FQD A;  2H9M A;  2AH0 A;  3GFC A;  5K19 A;  3RMZ D;  4JSP C;  4R7A B;  4E5Z A;  3MZL A;  5B4W A;  2HJ4 A;  4FAN D;  3C75 H;  2HKR A;  2OIZ A;  2H9P A;  5H17 A;  3DXM C;  1OLZ A;  3EMH A;  4ES0 A;  3EI2 B;  2CO0 C;  3I7L A;  3JB9 L;  2HYE A;  1PI6 A;  5EML B;  5C2V B;  3UVL A;  3VH0 A;  4HDJ A;  4A11 A;  2QC5 A;  1VYH C;  4A09 A;  4CC9 A;  5AFU 3;  1ERJ A;  2P9P C;  2PM9 B;  2IUR A;  3AL8 A;  3V7D B;  1FWX A;  4BUJ C;  4FA4 D;  1OMW B;  3I7H A;  1MG2 A;  2GC4 A;  3MZK A;  1TYQ C;  4TZ4 A;  5GXH A;  3C9C A;  4PNK B;  2HJB A;  3UVK A;  5C2W B;  3PVU B;  4L3H D;  3EI3 A;  5EAR A;  3EU7 A;  3SBQ A;  2GNQ A;  4AOW A;  2AGL A;  3BG0 A;  5KDO B;  1R5M A;  4CY1 A;  3F3F A;  5THA A;  3I7O A;  4GGD A;  5EMK B;  4ERZ A;  2CNX A;  4YVD A;  4CI1 A;  3PSL A;  4ZOZ A;  3MKS B;  3OL2 B;  3ULE C;  1GP2 B;  3ORV D;  2H3X A;  4J73 A;  5A2Q g;  4AEZ A;  2O9K A;  3W15 A;  4A7J A;  3J80 g;  2TRC B;  3VGZ A;  2PM7 B;  3OKT A;  3CFS B;  3N0E A;  5H1M A;  4XEI C;  2OVP B;  4CY2 A;  4GM9 A;  2H9N A;  3OKY B;  3EI2 A;  2XU7 A;  5EMM B;  2AH1 A;  4J8G A;  3JPX A;  4NSX A;  4FA1 D;  3FM0 A;  3L4M D;  5K1C C;  3RFH A;  5IJ7 E;  2OVR B;  2H9L A;  1MG3 A;  2PM9 A;  5I5M A;  5HYN B;  1SQJ A;  2IAA A;  4XYH A;  5FLX g;  5HE1 B;  4GGA A;  1S4U X;  4A2L A;  1JOF A;  2I3S A;  5CXC B;  4PC0 A;  2J55 H;  3JZN A;  3SLE D;  3F3P A;  3L4O D;  3KRW B;  2I0T A;  5CXB B;  5C9Z B;  5HE2 B;  3B7F A;  3IKO A;  4X61 B;  3KRX B;  1QNI A;  2YNO A;  4GQB B;  3EWE A;  4CZV A;  1XIP A;  2B5M A;  4CI8 A;  2IWK A;  1JMZ B;  3SJL D;  3OL2 A;  2AQ5 A;  4PBZ A;  4H5I A;  4U1E I;  3RN0 D;  3AFC A;  3IIY A;  5FKS A;  3PSC B;  4X60 B;  1NR0 A;  5JWZ A;  4O3T B;  2I0R A;  5EAL A;  3OKY A;  4H5J A;  4A0A A;  4BH6 A;  3SN6 B;  2H6Q A;  3IIW A;  4O3U B;  3C99 A;  5FA5 B;  3UR4 A;  1N6F A;  4J82 A;  2B4E A;  3DWL C;  3BG1 A;  1NEX B;  1SHY B;  3E0C A;  3I7P A;  3SHF A;  1A0R B;  1XKS A;  4LGN A;  5IT9 g;  3V9F A;  3SBR A;  3P4F A;  4CZX A;  4UI9 R;  2H6K A;  4L1Q D;  5FKR A;  2BBK H;  4J77 A;  2OVQ B;  3EI1 B;  2P9L C;  3NVX A;  4FA5 D;  2HKM A;  2P9U C;  2IUP A;  4X63 B;  3JRO A;  5CXC A;  5H14 A;  2J57 G;  4MK0 B;  3I89 A;  2W18 A;  2YB8 B;  2YBA A;  2P9N C;  4K3J B;  5CXB A;  2YNN A;  4QRJ A;  3JZH A;  2HXC A;  4OWR A;  3I8E A;  3DM0 A;  3U4Y A;  4J8B A;  2AGZ A;  4O45 A;  2CE9 A;  2OK6 A;  2UZX B;  4D0K A;  1GXR A;  2B5N A;  4GZ8 A;  4ZOY A;  4QL1 A;  2P9K C;  4CY5 A;  3A0F A;  5GMK n;  4FHL A;  4CI2 A;  3AL9 A;  4A0A B;  3IJC A;  4GQ1 A;  4QT8 A;  3IJ1 A;  1PBY B;  3FGB A;  3RSE C;  2MTA H;  4IA9 A;  5I5J A;  3JRP A;  2H47 A;  5FXY A;  1YFQ A;  3I7K A;  4U7A A;  5EAM A;  3SBP A;  3AH8 B;  3RRM C;  2XL2 A;  3CIK B;  2I0S A;  3SMR A;  2I3T A;  4L3G D;  1JMX B;  3PVW B;  2P9I C;  3EI1 A;  5IGO A;  2AGX A;  4O9D A;  3OW8 A;  4J78 A;  4KFM B;  5AMS A;  2CE8 A;  2UZY B;  5HE3 B;  1RI6 A;  1K8K C;  3RN1 D;  3UKR C;  1PEV A;  3GRE A;  2QXV A;  3SXT D;  3PE7 A;  3SWS D;  3VA6 A;  4JSN C;  2G99 A;  4K3I D;  2AGW A;  4PSX B;  4OZU A;  3CFV A;  5TF2 A;  3RLM D;  3NVN A;  4GGC A;  4J86 A;  5HE0 B;  3I8C A;  1JJU B;  2CN3 A;  1SQ9 A;  2PM6 B;  2OK4 A;  2IWF A;  4GM8 A;  4Z8L A;  5AJA A;  3UVO A;  2Q7Q A;  2XL3 A;  1U4C A;  4Y5R D;  2YMU A;  4PBY A;  5GSA A;  3RFG A;  2BCJ B;  2EBS A;  2CN2 A;  3JAM g;  4A0B B;  5EAP A;  4XYI A;  4EWR A;  4GMB A;  5IJ8 E;  4L9O A;  5TEF A;  2H13 A;  3SFZ A;  5EM2 A;  4BL0 A;  3DSM A;  1B9X A;  3OKW A;  1K32 A;  2G9A A;  3F3G A;  3MXX A;  4J79 A;  4FAV D;  4ZN4 A;  4J84 A;  3SVW D;  3UVN A;  5IGQ A;  4QQE A;  4J0W A;  5CYK B;  4CY3 A;  1GOT B;  3EI4 B;  3PXW D;  4JXM A; 
#chains in the Genus database with same CATH topology
 2J56 H;  3I7N A;  1Q47 A;  1GG2 B;  1GOG A;  1XHM A;  4E54 A;  5HDB A;  4ERQ A;  4A08 B;  4JT5 C;  4MMY A;  4GQ2 P;  4PSW B;  4A2M A;  2OJY A;  3C5M A;  1QFS A;  4JD2 C;  4UM8 A;  1U2V C;  2WQ8 A;  4JSV C;  3O4I A;  3ZWL B;  3FCU A;  4ERY A;  4E5Z B;  4CI3 A;  2B5L A;  3OF7 A;  2VZ1 A;  5FFO A;  3J81 g;  3MUO A;  4JT6 C;  2P9S C;  3EQ8 A;  3ODT A;  1E5T A;  1P22 A;  1B9Y A;  4Y7R A;  2QZP A;  4LG8 A;  4IMM A;  4GM3 A;  3UVM A;  3K6S A;  2XYI A;  3I2N A;  3HFQ A;  3NVQ A;  4FWW A;  4PXW A;  5C86 A;  1PGU A;  1UOO A;  5FKQ A;  1UOQ A;  3UKU C;  2H6N A;  3IUN A;  5EMJ B;  4D6V A;  2IUV A;  4L1M A;  4A11 B;  1QFM A;  5EM2 B;  1H2W A;  4A0B A;  4A09 B;  5GXI A;  3JZG A;  2PBI B;  3SCY A;  4J81 A;  3OTT A;  3EG6 A;  4X3E A;  5IC7 A;  4NEN A;  3K27 A;  3N0D A;  3AL8 B;  1TBG A;  3MKQ A;  3PXS D;  4FA9 D;  2YNP A;  2Z2P A;  2EID A;  5TDH B;  3ZE1 A;  4AN0 A;  4ESG A;  4LG9 A;  3MMY A;  4CZY A;  2EIB A;  2CO0 A;  3K26 A;  2JKX A;  2HES X;  3NID A;  5SXM A;  1UOP A;  5TEE A;  3IJ0 A;  2AGY A;  5FKT A;  3V5W B;  1L0Q A;  3PXT D;  4N14 A;  2IUQ A;  1MDA H;  5CYK A;  4FB1 D;  4E54 B;  4JSX C;  5I5I A;  2EIE A;  1C9L A;  4J0X A;  4I79 A;  1N6E A;  4O1Q D;  2Z2O A;  3EI3 B;  3MVD K;  3BWS A;  3EI4 A;  4ZOX A;  2Z2N A;  1N6D A;  3DXK C;  4G56 B;  5M5V A;  4DNW A;  5HQG A;  4ZOV A;  4A08 A;  4QAM A;  3FRX A;  3GD1 I;  2GC7 A;  3ZE2 A;  2H68 A;  2H14 A;  4J87 A;  5FQD A;  2H9M A;  2AH0 A;  3GFC A;  5K19 A;  3RMZ D;  4JSP C;  4R7A B;  4E5Z A;  3MZL A;  5B4W A;  2HJ4 A;  4FAN D;  3C75 H;  2HKR A;  2OIZ A;  2H9P A;  2XE4 A;  5H17 A;  4BCC A;  3DXM C;  2XDW A;  1OLZ A;  3EMH A;  4ES0 A;  4WK4 A;  3T3M A;  3EI2 B;  2CO0 C;  3I7L A;  3JB9 L;  2HYE A;  1PI6 A;  5EML B;  5C2V B;  3UVL A;  3VH0 A;  4BP9 A;  4RE5 A;  4HDJ A;  4A11 A;  2QC5 A;  1VZ2 A;  1VYH C;  4A09 A;  4CC9 A;  3NIG A;  4JHP C;  3IUR A;  5AFU 3;  1ERJ A;  2P9P C;  2PM9 B;  3DDU A;  3O4J A;  2IUR A;  3AL8 A;  4MMZ A;  1FWX A;  3V7D B;  4BUJ C;  4FA4 D;  1OMW B;  5FFG A;  3I7H A;  1MG2 A;  3IUM A;  2GC4 A;  3MZK A;  1TYQ C;  4TZ4 A;  5GXH A;  3C9C A;  4PNK B;  2HJB A;  3UVK A;  5C2W B;  3PVU B;  4NBM A;  1UTC A;  4L3H D;  3EI3 A;  5EAR A;  3EU7 A;  3SBQ A;  2GNQ A;  4AOW A;  1T2X A;  2AGL A;  3BG0 A;  3V4V A;  5KDO B;  1R5M A;  4CY1 A;  3F3F A;  1O6G A;  5THA A;  5C92 A;  3I7O A;  4GGD A;  4Z7N A;  2VDK A;  5EMK B;  3VI3 A;  4ERZ A;  2CNX A;  4YVD A;  4CI1 A;  3PSL A;  4ZOZ A;  3MKS B;  3OL2 B;  3ULE C;  1GP2 B;  3ORV D;  2H3X A;  2BKL A;  4J73 A;  5A2Q g;  3VI4 A;  4AEZ A;  4BCB A;  2O9K A;  2QR5 A;  3W15 A;  4BCD A;  4A7J A;  1K3I A;  3J80 g;  2TRC B;  3IUQ A;  2PM7 B;  1E8N A;  3OKT A;  3CFS B;  3VGZ A;  3N0E A;  1H2Z A;  4XEI C;  5H1M A;  2OVP B;  4CY2 A;  4GM9 A;  2H9N A;  3OKY B;  3EI2 A;  2XU7 A;  5EMM B;  2AH1 A;  4J8G A;  3JPX A;  2HU5 A;  4NSX A;  4UM9 A;  4FA1 D;  3FM0 A;  3L4M D;  5K1C C;  3RFH A;  5IJ7 E;  2OVR B;  2H9L A;  3MUN A;  1MG3 A;  3ZE0 A;  2VDR A;  2PM9 A;  5I5M A;  5HYN B;  1SQJ A;  2IAA A;  4XYH A;  5M5S A;  5FLX g;  5HE1 B;  4G1M A;  4NC4 A;  1L5G A;  2VDM A;  4GGA A;  1E8M A;  1M1X A;  1S4U X;  4A2L A;  1JOF A;  1YR2 A;  2I3S A;  5CXC B;  4PC0 A;  2J55 H;  4AMZ A;  1I2M B;  3JZN A;  3K71 A;  3SLE D;  3F3P A;  3L4O D;  4G55 A;  3KRW B;  2I0T A;  5CXB B;  5C9Z B;  5HE2 B;  3B7F A;  3IKO A;  4X61 B;  3T3P A;  3KRX B;  1QNI A;  2YNO A;  4GQB B;  3EWE A;  4CZV A;  4RE6 A;  1XIP A;  2B5M A;  5M5R A;  4CI8 A;  2IWK A;  1JMZ B;  3ZDY A;  3SJL D;  3OL2 A;  2AQ5 A;  4PBZ A;  1O6F A;  4H5I A;  4U1E I;  3RN0 D;  4AN1 A;  3AFC A;  3IIY A;  5FKS A;  3PSC B;  4X60 B;  1NR0 A;  5JWZ A;  4O3T B;  2I0R A;  5EAL A;  3OKY A;  4H5J A;  4AX4 A;  4A0A A;  4BH6 A;  3SN6 B;  2H6Q A;  3IIW A;  4O3U B;  3C99 A;  5FA5 B;  3UR4 A;  1N6F A;  4J82 A;  2B4E A;  3DWL C;  3BG1 A;  1NEX B;  1SHY B;  3E0C A;  3I7P A;  4O02 A;  3SHF A;  3QI0 A;  1A0R B;  1XKS A;  1VE6 A;  4LGN A;  5IT9 g;  4DNV A;  3QHY B;  3V9F A;  3SBR A;  3P4F A;  4CZX A;  3ZDZ A;  4UI9 R;  2H6K A;  4L1Q D;  5FKR A;  2BBK H;  4J77 A;  2VDP A;  3ZDX A;  2OVQ B;  3EI1 B;  2P9L C;  3NVX A;  4FA5 D;  2HKM A;  2P9U C;  2IUP A;  4X63 B;  1C9I A;  3JRO A;  5CXC A;  5H14 A;  2J57 G;  4MK0 B;  3I89 A;  4WK2 A;  2VDQ A;  2W18 A;  2YB8 B;  2YBA A;  2P9N C;  4K3J B;  5CXB A;  2YNN A;  4QRJ A;  3JZH A;  2HXC A;  4OWR A;  3I8E A;  3DM0 A;  3U4Y A;  1JV2 A;  4J8B A;  2AGZ A;  4O45 A;  2CE9 A;  2OK6 A;  2UZX B;  4D0K A;  5M61 A;  1GXR A;  2B5N A;  4GZ8 A;  4ZOY A;  4QL1 A;  2P9K C;  4CY5 A;  3A0F A;  3GC3 B;  5GMK n;  3EQ7 A;  4FHL A;  4CI2 A;  3AL9 A;  4O2W A;  4A0A B;  3IJC A;  3O4G A;  4GQ1 A;  4QT8 A;  3IJ1 A;  1PBY B;  3FGB A;  3IUJ A;  3RSE C;  2MTA H;  3IJE A;  4IA9 A;  1TYE A;  3IUL A;  5I5J A;  3JRP A;  3O4H A;  2VDO A;  3K72 A;  2H47 A;  5E6U A;  5FXY A;  1YFQ A;  3I7K A;  4U7A A;  1H2X A;  4IRZ A;  5EAM A;  3SBP A;  3AH8 B;  3RRM C;  2XL2 A;  3CIK B;  3IVM A;  2I0S A;  3SMR A;  2I3T A;  4L3G D;  3FCS A;  1JTD B;  1JMX B;  3PVW B;  4NAA A;  2VDN A;  2P9I C;  5M5U A;  3EI1 A;  5IGO A;  4AMY A;  2AGX A;  4O9D A;  3OW8 A;  4J78 A;  3NIF A;  4KFM B;  5AMS A;  1A12 A;  2CE8 A;  2UZY B;  5HE3 B;  1RI6 A;  1K8K C;  3RN1 D;  3UKR C;  1PEV A;  3GRE A;  5E6S A;  2QXV A;  4Z7Q A;  3SXT D;  3PE7 A;  3SWS D;  3VA6 A;  4JSN C;  2G99 A;  4K3I D;  2AGW A;  1GOH A;  4PSX B;  4OZU A;  3CFV A;  2VC2 A;  5TF2 A;  3RLM D;  4WJK A;  4D9S A;  3NVN A;  4GGC A;  4J86 A;  5HE0 B;  1VZ3 A;  3I8C A;  1JJU B;  2CN3 A;  1SQ9 A;  2PM6 B;  3KCI A;  2OK4 A;  4DNU A;  2IWF A;  4GM8 A;  4WK0 A;  4Z8L A;  5AJA A;  1VE7 A;  3UVO A;  2VDL A;  2VZ3 A;  2Q7Q A;  2XL3 A;  1U4C A;  4Y5R D;  2YMU A;  4PBY A;  5GSA A;  3RFG A;  2BCJ B;  2EBS A;  2CN2 A;  3JAM g;  3V4P A;  2XZG A;  4A0B B;  1BPO A;  5EAP A;  4XYI A;  4JHN A;  4EWR A;  2HU8 A;  2EIC A;  4GMB A;  5IJ8 E;  4L9O A;  5TEF A;  2H13 A;  3SFZ A;  4Z7O A;  5EM2 A;  4BL0 A;  1U8C A;  3DSM A;  1B9X A;  3OKW A;  1K32 A;  4G1E A;  4BP8 A;  2G9A A;  3F3G A;  2HU7 A;  3MXX A;  3EQ9 A;  4J79 A;  4FAV D;  4ZN4 A;  4J84 A;  3SVW D;  5E6R A;  3UVN A;  5IGQ A;  4QQE A;  4J0W A;  5CYK B;  4CY3 A;  1GOT B;  4MMX A;  1H2Y A;  3EI4 B;  3PXW D;  5M5T A;  4JXM A;  1GOF A; 
#chains in the Genus database with same CATH homology
 2J56 H;  3I7N A;  1Q47 A;  1GG2 B;  1XHM A;  4E54 A;  4ERQ A;  4A08 B;  4JT5 C;  4GQ2 P;  4PSW B;  4A2M A;  2OJY A;  3C5M A;  4JD2 C;  1U2V C;  4JSV C;  3ZWL B;  4ERY A;  4E5Z B;  4CI3 A;  2B5L A;  3J81 g;  4JT6 C;  2P9S C;  3ODT A;  1P22 A;  1B9Y A;  4Y7R A;  4LG8 A;  4IMM A;  4GM3 A;  3UVM A;  2XYI A;  3I2N A;  3HFQ A;  3NVQ A;  4FWW A;  4PXW A;  1PGU A;  5FKQ A;  3UKU C;  2H6N A;  5EMJ B;  4D6V A;  2IUV A;  4A11 B;  5EM2 B;  4A0B A;  4A09 B;  5GXI A;  3JZG A;  2PBI B;  3SCY A;  4J81 A;  3OTT A;  3EG6 A;  4X3E A;  5IC7 A;  3K27 A;  3N0D A;  3AL8 B;  1TBG A;  3MKQ A;  3PXS D;  4FA9 D;  2YNP A;  2Z2P A;  5TDH B;  4ESG A;  4LG9 A;  3MMY A;  4CZY A;  2CO0 A;  3K26 A;  2HES X;  5SXM A;  5TEE A;  3IJ0 A;  2AGY A;  5FKT A;  3V5W B;  1L0Q A;  3PXT D;  4N14 A;  2IUQ A;  1MDA H;  5CYK A;  4FB1 D;  4E54 B;  4JSX C;  5I5I A;  4O1Q D;  4J0X A;  4I79 A;  1N6E A;  2Z2O A;  3EI3 B;  3BWS A;  3EI4 A;  4ZOX A;  2Z2N A;  1N6D A;  3DXK C;  4G56 B;  5HQG A;  4ZOV A;  4A08 A;  3FRX A;  2GC7 A;  2H68 A;  2H14 A;  4J87 A;  5FQD A;  2H9M A;  2AH0 A;  3GFC A;  5K19 A;  3RMZ D;  4JSP C;  4R7A B;  4E5Z A;  3MZL A;  5B4W A;  2HJ4 A;  4FAN D;  3C75 H;  2HKR A;  2OIZ A;  2H9P A;  5H17 A;  3DXM C;  1OLZ A;  3EMH A;  4ES0 A;  3EI2 B;  2CO0 C;  3I7L A;  3JB9 L;  2HYE A;  1PI6 A;  5EML B;  5C2V B;  3UVL A;  3VH0 A;  4HDJ A;  4A11 A;  2QC5 A;  1VYH C;  4A09 A;  4CC9 A;  5AFU 3;  1ERJ A;  2P9P C;  2PM9 B;  2IUR A;  3AL8 A;  3V7D B;  1FWX A;  4BUJ C;  4FA4 D;  1OMW B;  3I7H A;  1MG2 A;  2GC4 A;  3MZK A;  1TYQ C;  4TZ4 A;  5GXH A;  3C9C A;  4PNK B;  2HJB A;  3UVK A;  5C2W B;  3PVU B;  4L3H D;  3EI3 A;  5EAR A;  3EU7 A;  3SBQ A;  2GNQ A;  4AOW A;  2AGL A;  3BG0 A;  5KDO B;  1R5M A;  4CY1 A;  3F3F A;  5THA A;  3I7O A;  4GGD A;  5EMK B;  4ERZ A;  2CNX A;  4YVD A;  4CI1 A;  3PSL A;  4ZOZ A;  3MKS B;  3OL2 B;  3ULE C;  1GP2 B;  3ORV D;  2H3X A;  4J73 A;  5A2Q g;  4AEZ A;  2O9K A;  3W15 A;  4A7J A;  3J80 g;  2TRC B;  3VGZ A;  2PM7 B;  3OKT A;  3CFS B;  3N0E A;  5H1M A;  4XEI C;  2OVP B;  4CY2 A;  4GM9 A;  2H9N A;  3OKY B;  3EI2 A;  2XU7 A;  5EMM B;  2AH1 A;  4J8G A;  3JPX A;  4NSX A;  4FA1 D;  3FM0 A;  3L4M D;  5K1C C;  3RFH A;  5IJ7 E;  2OVR B;  2H9L A;  1MG3 A;  2PM9 A;  5I5M A;  5HYN B;  1SQJ A;  2IAA A;  4XYH A;  5FLX g;  5HE1 B;  4GGA A;  1S4U X;  4A2L A;  1JOF A;  2I3S A;  5CXC B;  4PC0 A;  2J55 H;  3JZN A;  3SLE D;  3F3P A;  3L4O D;  3KRW B;  2I0T A;  5CXB B;  5C9Z B;  5HE2 B;  3B7F A;  3IKO A;  4X61 B;  3KRX B;  1QNI A;  2YNO A;  4GQB B;  3EWE A;  4CZV A;  1XIP A;  2B5M A;  4CI8 A;  2IWK A;  1JMZ B;  3SJL D;  3OL2 A;  2AQ5 A;  4PBZ A;  4H5I A;  4U1E I;  3RN0 D;  3AFC A;  3IIY A;  5FKS A;  3PSC B;  4X60 B;  1NR0 A;  5JWZ A;  4O3T B;  2I0R A;  5EAL A;  3OKY A;  4H5J A;  4A0A A;  4BH6 A;  3SN6 B;  2H6Q A;  3IIW A;  4O3U B;  3C99 A;  5FA5 B;  3UR4 A;  1N6F A;  4J82 A;  2B4E A;  3DWL C;  3BG1 A;  1NEX B;  1SHY B;  3E0C A;  3I7P A;  3SHF A;  1A0R B;  1XKS A;  4LGN A;  5IT9 g;  3V9F A;  3SBR A;  3P4F A;  4CZX A;  4UI9 R;  2H6K A;  4L1Q D;  5FKR A;  2BBK H;  4J77 A;  2OVQ B;  3EI1 B;  2P9L C;  3NVX A;  4FA5 D;  2HKM A;  2P9U C;  2IUP A;  4X63 B;  3JRO A;  5CXC A;  5H14 A;  2J57 G;  4MK0 B;  3I89 A;  2W18 A;  2YB8 B;  2YBA A;  2P9N C;  4K3J B;  5CXB A;  2YNN A;  4QRJ A;  3JZH A;  2HXC A;  4OWR A;  3I8E A;  3DM0 A;  3U4Y A;  4J8B A;  2AGZ A;  4O45 A;  2CE9 A;  2OK6 A;  2UZX B;  4D0K A;  1GXR A;  2B5N A;  4GZ8 A;  4ZOY A;  4QL1 A;  2P9K C;  4CY5 A;  3A0F A;  5GMK n;  4FHL A;  4CI2 A;  3AL9 A;  4A0A B;  3IJC A;  4GQ1 A;  4QT8 A;  3IJ1 A;  1PBY B;  3FGB A;  3RSE C;  2MTA H;  4IA9 A;  5I5J A;  3JRP A;  2H47 A;  5FXY A;  1YFQ A;  3I7K A;  4U7A A;  5EAM A;  3SBP A;  3AH8 B;  3RRM C;  2XL2 A;  3CIK B;  2I0S A;  3SMR A;  2I3T A;  4L3G D;  1JMX B;  3PVW B;  2P9I C;  3EI1 A;  5IGO A;  2AGX A;  4O9D A;  3OW8 A;  4J78 A;  4KFM B;  5AMS A;  2CE8 A;  2UZY B;  5HE3 B;  1RI6 A;  1K8K C;  3RN1 D;  3UKR C;  1PEV A;  3GRE A;  2QXV A;  3SXT D;  3PE7 A;  3SWS D;  3VA6 A;  4JSN C;  2G99 A;  4K3I D;  2AGW A;  4PSX B;  4OZU A;  3CFV A;  5TF2 A;  3RLM D;  3NVN A;  4GGC A;  4J86 A;  5HE0 B;  3I8C A;  1JJU B;  2CN3 A;  1SQ9 A;  2PM6 B;  2OK4 A;  2IWF A;  4GM8 A;  4Z8L A;  5AJA A;  3UVO A;  2Q7Q A;  2XL3 A;  1U4C A;  4Y5R D;  2YMU A;  4PBY A;  5GSA A;  3RFG A;  2BCJ B;  2EBS A;  2CN2 A;  3JAM g;  4A0B B;  5EAP A;  4XYI A;  4EWR A;  4GMB A;  5IJ8 E;  4L9O A;  5TEF A;  2H13 A;  3SFZ A;  5EM2 A;  4BL0 A;  3DSM A;  1B9X A;  3OKW A;  1K32 A;  2G9A A;  3F3G A;  3MXX A;  4J79 A;  4FAV D;  4ZN4 A;  4J84 A;  3SVW D;  3UVN A;  5IGQ A;  4QQE A;  4J0W A;  5CYK B;  4CY3 A;  1GOT B;  3EI4 B;  3PXW D;  4JXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...