4JHPC

The crystal structure of the rpgr rcc1-like domain in complex with pde6d
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
362
structure length
362
Chain Sequence
LMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodie
publication title The interplay between RPGR, PDE-delta and Arl2/3 regulate the ciliary targeting of farnesylated cargo.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 362
sequence length 362
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4jhpC00
3MVDK 1JTDB 4DNVA 4L1MA 4NC4A 4JHPC 4DNUA 3QHYB 4DNWA 1A12A 4NAAA 3OF7A 4D9SA 4NBMA 4O2WA 3QI0A 4QAMA 3KCIA 4JHNA 1I2MB
chains in the Genus database with same CATH superfamily
3FGBA 4QQEA 4A11A 2MTAH 1GOTB 4GM3A 4O02A 4O1QD 1K8KC 2HU7A 4Z7OA 4L3HD 4N14A 4WJKA 1MG2A 1NR0A 4DNUA 3C9CA 4J81A 4A0BA 5THAA 4FB1D 3A0FA 2H68A 4NENA 3RN1D 2UZYB 4A0AA 5EM2A 3IIYA 4Y7RA 1UOPA 4O2WA 4A7JA 4A09B 4RE5A 4TZ4A 5FA5B 2P9IC 3EI4A 4J79A 1PBYB 2B4EA 1JV2A 2XU7A 3RLMD 4PXWA 4FHLA 5CXCB 4A0AB 1E8MA 5I5JA 3V5WB 1P22A 4GGAA 5JWZA 3EG6A 3IUMA 2H47A 4JD2C 3NVXA 3QHYB 4DNWA 3OTTA 5C9ZB 2AH0A 3GREA 2AGWA 2CNXA 2PM7B 1FWXA 3I7KA 3O4HA 4UI9R 5A2Qg 1RI6A 3UKRC 2YNPA 4D0KA 5FKTA 5H1MA 2HJ4A 2IUVA 4OWRA 1TYEA 2XDWA 1QFMA 2YB8B 5AFU3 4X61B 4BL0A 3UVOA 3EQ9A 2PM6B 2OK4A 2YBAA 2GC4A 4L9OA 4X60B 2P9LC 5IT9g 1N6DA 1QFSA 3AL8A 3SVWD 2HJBA 2H9MA 4WK0A 3EI2A 4NC4A 2VDLA 3C99A 2CN3A 2QC5A 1O6GA 1M1XA 4PBYA 4LG9A 4G56B 2JKXA 2G9AA 3EI3B 4AN0A 3O4GA 2I0SA 3PXTD 3KRXB 4K3ID 3EI1A 3OL2A 1UOQA 3JZNA 4UM9A 3IVMA 4J8BA 1C9LA 4CC9A 3JZGA 4ES0A 2QR5A 1VZ2A 3GD1I 4GQ1A 2O9KA 5EMKB 4PC0A 3E0CA 4Y5RD 3UVLA 3O4IA 3V7DB 3JB9L 1OLZA 3ULEC 4BP9A 5FFOA 4O3TB 4KFMB 2Z2OA 5GXHA 3W15A 5C2VB 3PVWB 4WK2A 3I8CA 4H5IA 2AGLA 4MMZA 4X3EA 4D6VA 4ZN4A 2OVQB 2W18A 4CZXA 3GC3B 1L5GA 3FRXA 2AH1A 4JHNA 1Q47A 2HESX 4HDJA 5AJAA 2HU8A 3ZE0A 1QNIA 3FCUA 3MMYA 4GM9A 3AH8B 2IWFA 1GG2B 4J84A 4ERZA 2IAAA 3VI4A 3NIGA 3PVUB 2AQ5A 4MMXA 4E5ZA 4FA1D 1JJUB 5FFGA 2B5MA 2H6KA 4JT6C 5B4WA 4G1EA 3J81g 5FLXg 4CY3A 5H17A 5CYKB 3IKOA 3IJ0A 3NVQA 3UR4A 4OZUA 3MKSB 5FXYA 3SXTD 1E5TA 4CZYA 3F3GA 5EALA 3ZDYA 1E8NA 4GQBB 5HYNB 5HE3B 1OMWB 4A09A 4BCCA 4RE6A 5KDOB 2CO0A 4FA9D 2J56H 5IGOA 1A12A 4U1EI 2J57G 5I5IA 3L4MD 3SFZA 3RMZD 3NIFA 5CXCA 5IJ8E 3FCSA 1GOGA 4ZOZA 2EIBA 3UKUC 4YVDA 3ZDXA 5IJ7E 1T2XA 1N6EA 2P9KC 3V9FA 1I2MB 4GMBA 3UVMA 3RN0D 3RFGA 2HYEA 5EAPA 1MDAH 4IA9A 1PEVA 3DDUA 5M5SA 3F3FA 2H6QA 1GOFA 3OKTA 2IUPA 2H9PA 1TBGA 4A2LA 3ODTA 5M5RA 2VDOA 5C92A 3J80g 4J87A 3IUQA 3OF7A 4LG8A 2YNOA 3EU7A 1VYHC 3MZKA 4J86A 1SQ9A 1MG3A 5E6SA 3OKWA 2HU5A 5H14A 3SBRA 5C2WB 5EMLB 2XL3A 3MUNA 2H14A 5HE0B 4BH6A 3EI3A 4E54B 4L1MA 3JRPA 4Z7QA 1GOHA 4BCBA 3BG0A 4CI8A 1H2YA 2UZXB 4QRJA 3I2NA 3RRMC 1R5MA 1U2VC 4J82A 3N0DA 2EICA 4NSXA 1BPOA 2OIZA 4QT8A 3SMRA 3AFCA 2H9NA 5TEEA 3I7NA 3B7FA 2P9SC 2EIDA 2VZ3A 1JOFA 1NEXB 2EIEA 3VI3A 5SXMA 3NVNA 1U8CA 4L3GD 5TDHB 4JXMA 4CY2A 3IIWA 3IUNA 1L0QA 2VDQA 4K3JB 2YNNA 4I79A 2I3SA 3K6SA 1B9XA 2GNQA 5FKQA 3IJCA 2B5LA 3DXKC 1XKSA 1XHMA 3SWSD 1YR2A 3IJEA 3ZE2A 3I7OA 1UOOA 2G99A 5IGQA 4J8GA 4UM8A 4BUJC 3MZLA 3K26A 4FAND 3DSMA 2OK6A 3SLED 4AMZA 5K19A 5K1CC 3K27A 4R7AB 4BCDA 3I7HA 3DM0A 5CYKA 3RSEC 2GC7A 3K72A 5M5UA 2TRCB 1H2ZA 3V4PA 1B9YA 2HKRA 2CO0C 4GGDA 3DWLC 4JSXC 3MKQA 5IC7A 2XYIA 3EQ8A 2H13A 3OKYB 4G1MA 2OVPB 2VDMA 2CE9A 3CFVA 2Q7QA 3BWSA 4QL1A 2VDKA 3P4FA 1UTCA 1O6FA 2BCJB 4BP8A 3JAMg 2H6NA 3MUOA 4CZVA 2I3TA 3IJ1A 4ESGA 4NBMA 4O3UB 5EMMB 5EAMA 3JROA 4AEZA 4CI3A 4A2MA 5M5VA 3PXWD 3I8EA 1XIPA 2IURA 4GM8A 4J78A 5FQDA 1VE6A 5HDBA 2XZGA 5HE1B 4L1QD 1N6FA 3SN6B 3KRWB 5CXBA 3U4YA 1K3IA 4JSNC 3FM0A 2VDPA 1VE7A 4J0WA 4NAAA 2H9LA 4A11B 3L4OD 3VGZA 4Z7NA 5CXBB 3QI0A 3EMHA 4E54A 4QAMA 4FWWA 2WQ8A 4XEIC 3KCIA 4AMYA 4EWRA 4ZOXA 4A0BB 4CY5A 2VDNA 4O9DA 4X63B 5EM2B 3PSLA 3CFSB 4IMMA 4CY1A 3SCYA 1JTDB 2I0RA 1K32A 4G55A 3JZHA 3GFCA 1VZ3A 3EQ7A 2I0TA 4PSXB 3AL9A 5E6UA 2HKMA 2IUQA 3EI4B 2PM9A 3ORVD 4AN1A 3ZDZA 3N0EA 4JSVC 3VA6A 1PI6A 2IWKA 2H3XA 3SJLD 5HQGA 2VDRA 5FKSA 3T3PA 3I7LA 3ZWLB 5TF2A 4JSPC 5GMKn 2YMUA 2Z2NA 4PBZA 4U7AA 1U4CA 4WK4A 5I5MA 2PM9B 2AGYA 3PXSD 1ERJA 4XYHA 2VZ1A 4O45A 2P9PC 3VH0A 2AGXA 4J0XA 4H5JA 5EMJB 5E6RA 3EWEA 4JHPC 4GZ8A 4XYIA 4CI2A 4IRZA 1TYQC 4Z8LA 3SHFA 2XE4A 4AOWA 4FAVD 1GP2B 1H2XA 2B5NA 2XL2A 1GXRA 3CIKB 2EBSA 3AL8B 4A08A 5M5TA 4MMYA 3EI2B 5GXIA 4GQ2P 3DXMC 3I89A 3ZE1A 3IURA 2OJYA 1H2WA 2BBKH 2PBIB 4ZOVA 5M61A 3SBQA 2OVRB 2P9UC 4PNKB 4ERQA 4A08B 3EI1B 4ZOYA 2CN2A 3OL2B 1YFQA 2CE8A 5TEFA 3NIDA 5HE2B 2QZPA 3IUJA 3PSCB 3OKYA 3MXXA 4ERYA 4D9SA 3IULA 3V4VA 5AMSA 3HFQA 4JT5C 1SHYB 2QXVA 4MK0B 2HXCA 4GGCA 3OW8A 3RFHA 2P9NC 5FKRA 4J73A 5C86A 3F3PA 4FA4D 4FA5D 3SBPA 3MVDK 2BKLA 1C9IA 3T3MA 3UVKA 4DNVA 1SQJA 1JMXB 1JMZB 4AX4A 3O4JA 2VC2A 4PSWB 3K71A 2J55H 3PE7A 4J77A 3JPXA 4LGNA 1A0RB 1S4UX 2AGZA 3I7PA 4E5ZB 2Z2PA 3C5MA 4CI1A 5EARA 3UVNA 3C75H 5GSAA 3BG1A 1PGUA
chains in the Genus database with same CATH topology
3MVDK 1JTDB 4DNVA 4L1MA 4NC4A 4JHPC 4DNUA 3QHYB 4DNWA 1A12A 4NAAA 3OF7A 4D9SA 4NBMA 4O2WA 3QI0A 4QAMA 3KCIA 4JHNA 1I2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD K;  1JTD B;  4DNV A;  4L1M A;  4NC4 A;  4JHP C;  4DNU A;  3QHY B;  4DNW A;  1A12 A;  4NAA A;  3OF7 A;  4D9S A;  4NBM A;  4O2W A;  3QI0 A;  4QAM A;  3KCI A;  4JHN A;  1I2M B; 
#chains in the Genus database with same CATH topology
 3FGB A;  4QQE A;  4A11 A;  2MTA H;  1GOT B;  4GM3 A;  4O02 A;  4O1Q D;  1K8K C;  2HU7 A;  4Z7O A;  4L3H D;  4N14 A;  4WJK A;  1MG2 A;  1NR0 A;  4DNU A;  3C9C A;  4J81 A;  4A0B A;  5THA A;  4FB1 D;  3A0F A;  2H68 A;  4NEN A;  3RN1 D;  2UZY B;  4A0A A;  5EM2 A;  3IIY A;  4Y7R A;  1UOP A;  4O2W A;  4A7J A;  4A09 B;  4RE5 A;  4TZ4 A;  5FA5 B;  2P9I C;  3EI4 A;  4J79 A;  1PBY B;  2B4E A;  1JV2 A;  2XU7 A;  3RLM D;  4PXW A;  4FHL A;  5CXC B;  4A0A B;  1E8M A;  5I5J A;  3V5W B;  1P22 A;  4GGA A;  5JWZ A;  3EG6 A;  3IUM A;  2H47 A;  4JD2 C;  3NVX A;  3QHY B;  4DNW A;  3OTT A;  5C9Z B;  2AH0 A;  3GRE A;  2AGW A;  2CNX A;  2PM7 B;  1FWX A;  3I7K A;  3O4H A;  4UI9 R;  5A2Q g;  1RI6 A;  3UKR C;  2YNP A;  4D0K A;  5FKT A;  5H1M A;  2HJ4 A;  2IUV A;  4OWR A;  1TYE A;  2XDW A;  1QFM A;  2YB8 B;  5AFU 3;  4X61 B;  4BL0 A;  3UVO A;  3EQ9 A;  2PM6 B;  2OK4 A;  2YBA A;  2GC4 A;  4L9O A;  4X60 B;  2P9L C;  5IT9 g;  1N6D A;  1QFS A;  3AL8 A;  3SVW D;  2HJB A;  2H9M A;  4WK0 A;  3EI2 A;  4NC4 A;  2VDL A;  3C99 A;  2CN3 A;  2QC5 A;  1O6G A;  1M1X A;  4PBY A;  4LG9 A;  4G56 B;  2JKX A;  2G9A A;  3EI3 B;  4AN0 A;  3O4G A;  2I0S A;  3PXT D;  3KRX B;  4K3I D;  3EI1 A;  3OL2 A;  1UOQ A;  3JZN A;  4UM9 A;  3IVM A;  4J8B A;  1C9L A;  4CC9 A;  3JZG A;  4ES0 A;  2QR5 A;  1VZ2 A;  3GD1 I;  4GQ1 A;  2O9K A;  5EMK B;  4PC0 A;  3E0C A;  4Y5R D;  3UVL A;  3O4I A;  3V7D B;  3JB9 L;  1OLZ A;  3ULE C;  4BP9 A;  5FFO A;  4O3T B;  4KFM B;  2Z2O A;  5GXH A;  3W15 A;  5C2V B;  3PVW B;  4WK2 A;  3I8C A;  4H5I A;  2AGL A;  4MMZ A;  4X3E A;  4D6V A;  4ZN4 A;  2OVQ B;  2W18 A;  4CZX A;  3GC3 B;  1L5G A;  3FRX A;  2AH1 A;  4JHN A;  1Q47 A;  2HES X;  4HDJ A;  5AJA A;  2HU8 A;  3ZE0 A;  1QNI A;  3FCU A;  3MMY A;  4GM9 A;  3AH8 B;  2IWF A;  1GG2 B;  4J84 A;  4ERZ A;  2IAA A;  3VI4 A;  3NIG A;  3PVU B;  2AQ5 A;  4MMX A;  4E5Z A;  4FA1 D;  1JJU B;  5FFG A;  2B5M A;  2H6K A;  4JT6 C;  5B4W A;  4G1E A;  3J81 g;  5FLX g;  4CY3 A;  5H17 A;  5CYK B;  3IKO A;  3IJ0 A;  3NVQ A;  3UR4 A;  4OZU A;  3MKS B;  5FXY A;  3SXT D;  1E5T A;  4CZY A;  3F3G A;  5EAL A;  3ZDY A;  1E8N A;  4GQB B;  5HYN B;  5HE3 B;  1OMW B;  4A09 A;  4BCC A;  4RE6 A;  5KDO B;  2CO0 A;  4FA9 D;  2J56 H;  5IGO A;  1A12 A;  4U1E I;  2J57 G;  5I5I A;  3L4M D;  3SFZ A;  3RMZ D;  3NIF A;  5CXC A;  5IJ8 E;  3FCS A;  1GOG A;  4ZOZ A;  2EIB A;  3UKU C;  4YVD A;  3ZDX A;  5IJ7 E;  1T2X A;  1N6E A;  2P9K C;  3V9F A;  1I2M B;  4GMB A;  3UVM A;  3RN0 D;  3RFG A;  2HYE A;  5EAP A;  1MDA H;  4IA9 A;  1PEV A;  3DDU A;  5M5S A;  3F3F A;  2H6Q A;  1GOF A;  3OKT A;  2IUP A;  2H9P A;  1TBG A;  4A2L A;  3ODT A;  5M5R A;  2VDO A;  5C92 A;  3J80 g;  4J87 A;  3IUQ A;  3OF7 A;  4LG8 A;  2YNO A;  3EU7 A;  1VYH C;  3MZK A;  4J86 A;  1SQ9 A;  1MG3 A;  5E6S A;  3OKW A;  2HU5 A;  5H14 A;  3SBR A;  5C2W B;  5EML B;  2XL3 A;  3MUN A;  2H14 A;  5HE0 B;  4BH6 A;  3EI3 A;  4E54 B;  4L1M A;  3JRP A;  4Z7Q A;  1GOH A;  4BCB A;  3BG0 A;  4CI8 A;  1H2Y A;  2UZX B;  4QRJ A;  3I2N A;  3RRM C;  1R5M A;  1U2V C;  4J82 A;  3N0D A;  2EIC A;  4NSX A;  1BPO A;  2OIZ A;  4QT8 A;  3SMR A;  3AFC A;  2H9N A;  5TEE A;  3I7N A;  3B7F A;  2P9S C;  2EID A;  2VZ3 A;  1JOF A;  1NEX B;  2EIE A;  3VI3 A;  5SXM A;  3NVN A;  1U8C A;  4L3G D;  5TDH B;  4JXM A;  4CY2 A;  3IIW A;  3IUN A;  1L0Q A;  2VDQ A;  4K3J B;  2YNN A;  4I79 A;  2I3S A;  3K6S A;  1B9X A;  2GNQ A;  5FKQ A;  3IJC A;  2B5L A;  3DXK C;  1XKS A;  1XHM A;  3SWS D;  1YR2 A;  3IJE A;  3ZE2 A;  3I7O A;  1UOO A;  2G99 A;  5IGQ A;  4J8G A;  4UM8 A;  4BUJ C;  3MZL A;  3K26 A;  4FAN D;  3DSM A;  2OK6 A;  3SLE D;  4AMZ A;  5K19 A;  5K1C C;  3K27 A;  4R7A B;  4BCD A;  3I7H A;  3DM0 A;  5CYK A;  3RSE C;  2GC7 A;  3K72 A;  5M5U A;  2TRC B;  1H2Z A;  3V4P A;  1B9Y A;  2HKR A;  2CO0 C;  4GGD A;  3DWL C;  4JSX C;  3MKQ A;  5IC7 A;  2XYI A;  3EQ8 A;  2H13 A;  3OKY B;  4G1M A;  2OVP B;  2VDM A;  2CE9 A;  3CFV A;  2Q7Q A;  3BWS A;  4QL1 A;  2VDK A;  3P4F A;  1UTC A;  1O6F A;  2BCJ B;  4BP8 A;  3JAM g;  2H6N A;  3MUO A;  4CZV A;  2I3T A;  3IJ1 A;  4ESG A;  4NBM A;  4O3U B;  5EMM B;  5EAM A;  3JRO A;  4AEZ A;  4CI3 A;  4A2M A;  5M5V A;  3PXW D;  3I8E A;  1XIP A;  2IUR A;  4GM8 A;  4J78 A;  5FQD A;  1VE6 A;  5HDB A;  2XZG A;  5HE1 B;  4L1Q D;  1N6F A;  3SN6 B;  3KRW B;  5CXB A;  3U4Y A;  1K3I A;  4JSN C;  3FM0 A;  2VDP A;  1VE7 A;  4J0W A;  4NAA A;  2H9L A;  4A11 B;  3L4O D;  3VGZ A;  4Z7N A;  5CXB B;  3QI0 A;  3EMH A;  4E54 A;  4QAM A;  4FWW A;  2WQ8 A;  4XEI C;  3KCI A;  4AMY A;  4EWR A;  4ZOX A;  4A0B B;  4CY5 A;  2VDN A;  4O9D A;  4X63 B;  5EM2 B;  3PSL A;  3CFS B;  4IMM A;  4CY1 A;  3SCY A;  1JTD B;  2I0R A;  1K32 A;  4G55 A;  3JZH A;  3GFC A;  1VZ3 A;  3EQ7 A;  2I0T A;  4PSX B;  3AL9 A;  5E6U A;  2HKM A;  2IUQ A;  3EI4 B;  2PM9 A;  3ORV D;  4AN1 A;  3ZDZ A;  3N0E A;  4JSV C;  3VA6 A;  1PI6 A;  2IWK A;  2H3X A;  3SJL D;  5HQG A;  2VDR A;  5FKS A;  3T3P A;  3I7L A;  3ZWL B;  5TF2 A;  4JSP C;  5GMK n;  2YMU A;  2Z2N A;  4PBZ A;  4U7A A;  1U4C A;  4WK4 A;  5I5M A;  2PM9 B;  2AGY A;  3PXS D;  1ERJ A;  4XYH A;  2VZ1 A;  4O45 A;  2P9P C;  3VH0 A;  2AGX A;  4J0X A;  4H5J A;  5EMJ B;  5E6R A;  3EWE A;  4JHP C;  4GZ8 A;  4XYI A;  4CI2 A;  4IRZ A;  1TYQ C;  4Z8L A;  3SHF A;  2XE4 A;  4AOW A;  4FAV D;  1GP2 B;  1H2X A;  2B5N A;  2XL2 A;  1GXR A;  3CIK B;  2EBS A;  3AL8 B;  4A08 A;  5M5T A;  4MMY A;  3EI2 B;  5GXI A;  4GQ2 P;  3DXM C;  3I89 A;  3ZE1 A;  3IUR A;  2OJY A;  1H2W A;  2BBK H;  2PBI B;  4ZOV A;  5M61 A;  3SBQ A;  2OVR B;  2P9U C;  4PNK B;  4ERQ A;  4A08 B;  3EI1 B;  4ZOY A;  2CN2 A;  3OL2 B;  1YFQ A;  2CE8 A;  5TEF A;  3NID A;  5HE2 B;  2QZP A;  3IUJ A;  3PSC B;  3OKY A;  3MXX A;  4ERY A;  4D9S A;  3IUL A;  3V4V A;  5AMS A;  3HFQ A;  4JT5 C;  1SHY B;  2QXV A;  4MK0 B;  2HXC A;  4GGC A;  3OW8 A;  3RFH A;  2P9N C;  5FKR A;  4J73 A;  5C86 A;  3F3P A;  4FA4 D;  4FA5 D;  3SBP A;  3MVD K;  2BKL A;  1C9I A;  3T3M A;  3UVK A;  4DNV A;  1SQJ A;  1JMX B;  1JMZ B;  4AX4 A;  3O4J A;  2VC2 A;  4PSW B;  3K71 A;  2J55 H;  3PE7 A;  4J77 A;  3JPX A;  4LGN A;  1A0R B;  1S4U X;  2AGZ A;  3I7P A;  4E5Z B;  2Z2P A;  3C5M A;  4CI1 A;  5EAR A;  3UVN A;  3C75 H;  5GSA A;  3BG1 A;  1PGU A; 
#chains in the Genus database with same CATH homology
 3MVD K;  1JTD B;  4DNV A;  4L1M A;  4NC4 A;  4JHP C;  4DNU A;  3QHY B;  4DNW A;  1A12 A;  4NAA A;  3OF7 A;  4D9S A;  4NBM A;  4O2W A;  3QI0 A;  4QAM A;  3KCI A;  4JHN A;  1I2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...