4JHPC

The crystal structure of the rpgr rcc1-like domain in complex with pde6d
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
362
structure length
362
Chain Sequence
LMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodie
publication title The interplay between RPGR, PDE-delta and Arl2/3 regulate the ciliary targeting of farnesylated cargo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 93
structure length 362
sequence length 362
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4jhpC00
4NAAA 3MVDK 4DNVA 4QAMA 3QI0A 1I2MB 4JHPC 4L1MA 3OF7A 4DNUA 1A12A 3KCIA 4D9SA 4DNWA 1JTDB 4JHNA 3QHYB 4NBMA 4NC4A 4O2WA
chains in the Genus database with same CATH superfamily
4HDJA 2AH1A 3CIKB 4GM3A 5E6UA 1QFSA 4G55A 5HQGA 2Z2OA 4I79A 4AEZA 3SBRA 3AL8B 1FWXA 2VC2A 3ODTA 4IRZA 3PVWB 3BG0A 5I5JA 2P9KC 4MMZA 1A12A 5KDOB 4UI9R 1L0QA 2P9IC 2YNNA 4E5ZA 1NEXB 2VZ1A 3AL8A 3K27A 4CY2A 3QHYB 4PSXB 3K72A 5FFGA 5EALA 1PI6A 3I2NA 5HE0B 3O4GA 4AMZA 3ZDXA 5M5UA 5SXMA 2MTAH 2UZXB 3IVMA 4G56B 5M61A 3VI3A 3GREA 1A0RB 5CYKB 2VZ3A 2CN3A 5IJ7E 5EMMB 1H2YA 4PNKB 3K26A 2HU8A 2H9LA 3RN0D 5EARA 3NIFA 2BCJB 5H1MA 2XDWA 4A7JA 1UTCA 3EQ9A 5IC7A 4JHNA 3UVKA 2AH0A 3JZGA 5FKQA 2CO0C 5CYKA 1OMWB 1VE7A 4FAND 5K19A 4WK2A 3FCSA 3I8CA 4X61B 4QQEA 2BBKH 4Y7RA 4CC9A 1XKSA 2J56H 3UVMA 4CZVA 3UKUC 4CY1A 5FXYA 4A0BB 4ERYA 4AN1A 4A09B 1QNIA 2EIDA 2H47A 2H9MA 1K32A 3V5WB 3MZKA 5H14A 3RLMD 2TRCB 5TDHB 3SVWD 4D0KA 3EG6A 4L9OA 4A0BA 3F3FA 4A09A 3I7PA 3PXTD 3EQ8A 2CNXA 3EI1B 3MZLA 3ZE1A 4J78A 4UM9A 4JHPC 5HE1B 3UVOA 4J87A 3EI3B 3DDUA 5FKTA 5EM2B 3IJ1A 2IAAA 3KCIA 2GNQA 2YBAA 2AGZA 4R7AB 3RRMC 3EI1A 3FM0A 1GOTB 3I7HA 3RSEC 4O9DA 5I5MA 4WJKA 4U7AA 4GGAA 4K3JB 3SMRA 1GP2B 3MUOA 3UVLA 4J73A 3K71A 2G99A 5IGQA 4AX4A 2Z2PA 3JROA 4XEIC 3PXWD 1PEVA 4H5JA 3GFCA 4JXMA 1Q47A 3SBPA 5EAMA 2XYIA 3IKOA 5C86A 1PGUA 4H5IA 4XYIA 3DWLC 3I7LA 2OJYA 3VA6A 2HKRA 5B4WA 3PE7A 5C92A 1R5MA 3O4IA 2O9KA 2QR5A 4CY5A 4JD2C 4E5ZB 2I3SA 1YR2A 2HJBA 4IMMA 3EWEA 5TEEA 2OVQB 5E6SA 4ESGA 5EMKB 4JSNC 3OL2B 1E8NA 5FFOA 4CI3A 1T2XA 3BG1A 2PM7B 4FA5D 5K1CC 3IUJA 2OK6A 2Z2NA 4L3GD 4U1EI 3SJLD 4GM9A 1JV2A 1U4CA 2EIEA 4ZOYA 4L1QD 4CI1A 2Q7QA 2XL2A 3OL2A 5IJ8E 3NVXA 4PSWB 4X60B 5FA5B 1PBYB 2H68A 4BCDA 5AFU3 5H17A 4AMYA 3W15A 4EWRA 5EMJB 2OVRB 1K8KC 5A2Qg 3JRPA 2XL3A 1JMZB 2WQ8A 3OKWA 5THAA 3JAMg 1TYQC 2B5LA 2J55H 3P4FA 1ERJA 5AJAA 3RFHA 2QZPA 4Z7QA 3BWSA 5C2WB 1VYHC 2H9NA 3ZDYA 4FWWA 4J0XA 4RE6A 3MKSB 3UVNA 2AGWA 3IJCA 4FB1D 5HDBA 3L4MD 2VDQA 4NAAA 1JJUB 3IIYA 2I0TA 5IT9g 1P22A 2IUQA 3VH0A 3U4YA 4GQBB 2HYEA 4GMBA 4FA4D 4FAVD 1VZ3A 3MXXA 3PVUB 4J8BA 4JSXC 3VI4A 3O4HA 2P9UC 4LGNA 4J86A 2JKXA 3PXSD 2J57G 4YVDA 2YB8B 1MG2A 3GC3B 4WK0A 3F3PA 3IURA 3IULA 4D6VA 1GG2B 4BCCA 3SHFA 5IGOA 1GOFA 1H2ZA 3KRXB 4OZUA 2YNOA 3ZE0A 1TYEA 4J82A 3T3MA 4G1MA 5EAPA 5CXBB 5FKSA 4JSVC 2P9NC 3AL9A 3FRXA 4D9SA 4A2MA 2VDRA 1N6EA 2CE9A 3EI2B 3JB9L 5FKRA 1H2WA 4PC0A 2B5MA 2AGYA 4MK0B 1L5GA 1VE6A 5HE2B 1XHMA 2UZYB 3I7NA 1QFMA 2EIBA 3OKTA 5CXBA 3SXTD 3MVDK 1OLZA 2OK4A 3JPXA 3J81g 4ERZA 4GQ1A 4ZOXA 4Z7NA 4QAMA 3OF7A 4BCBA 4AN0A 3EI2A 4J8GA 2BKLA 4J77A 1NR0A 1U8CA 2B4EA 3F3GA 3SBQA 2VDOA 3JZHA 3MMYA 4PBYA 2AQ5A 3AH8B 1SQ9A 3K6SA 3IJ0A 1S4UX 4BUJC 2OVPB 2IWKA 4RE5A 4MMXA 4NC4A 2XZGA 3I89A 1RI6A 2I0RA 4MMYA 2H6QA 3CFVA 5FQDA 5CXCB 3ORVD 4TZ4A 4DNVA 5C9ZB 2QXVA 3QI0A 3KRWB 4DNUA 1E5TA 4ERQA 4J84A 1C9IA 1GXRA 4QRJA 3PSLA 4QL1A 1GOGA 2HJ4A 4BH6A 5CXCA 4L3HD 2GC4A 3N0DA 3IUNA 3N0EA 2HESX 2IUVA 4NBMA 4J81A 1N6FA 3ULEC 5M5RA 4NSXA 2HXCA 3NIDA 2AGXA 1UOQA 2CO0A 4BP9A 3RMZD 3IIWA 5M5VA 1UOOA 4N14A 2XE4A 4A0AB 3CFSB 1TBGA 4GGDA 1MDAH 4ZOZA 3IJEA 3AFCA 2H6NA 4DNWA 1C9LA 3EMHA 4JSPC 5M5TA 4ES0A 3EU7A 3OKYB 5FLXg 5E6RA 2OIZA 1H2XA 1XIPA 2VDMA 4A0AA 3UKRC 1YFQA 1SHYB 4FHLA 4UM8A 3I7KA 3ZDZA 5TF2A 4KFMB 5C2VB 4O45A 4L1MA 3C99A 4A11B 3OKYA 2IWFA 3DSMA 4CI8A 5HYNB 5HE3B 2PBIB 3V7DB 2EICA 3I7OA 4J0WA 3T3PA 3V4PA 5GXHA 2H9PA 4BP8A 3A0FA 4A11A 2VDKA 2H6KA 4LG8A 4QT8A 2VDNA 2QC5A 2VDLA 3SLED 3IUMA 2G9AA 4Z7OA 5M5SA 2H3XA 3FGBA 3C75H 1M1XA 2H14A 4Z8LA 2GC7A 4E54B 3I8EA 4GQ2P 3E0CA 2P9SC 3DXMC 3SFZA 4FA1D 2CN2A 2AGLA 2YMUA 4A2LA 3L4OD 2I0SA 1O6FA 4ZOVA 2W18A 3VGZA 3V4VA 4K3ID 3PSCB 3ZE2A 4BL0A 2I3TA 5JWZA 2IUPA 3DXKC 4E54A 1K3IA 1E8MA 1O6GA 4IA9A 4CY3A 5I5IA 2YNPA 2XU7A 3SN6B 1GOHA 4A08B 2CE8A 4GM8A 5GMKn 5GSAA 4GZ8A 4JT5C 4O1QD 3OTTA 3DM0A 2IURA 3C9CA 3FCUA 2VDPA 3HFQA 1B9XA 4G1EA 3NIGA 4XYHA 2PM9B 3GD1I 5EMLB 3RFGA 3J80g 4JT6C 2EBSA 1U2VC 4X63B 1UOPA 4X3EA 4A08A 1JTDB 3MKQA 3O4JA 3EI3A 4OWRA 3SCYA 4O02A 1VZ2A 3JZNA 4J79A 5EM2A 2P9PC 2PM9A 3EI4B 1BPOA 1JMXB 4CZXA 3V9FA 2P9LC 3SWSD 5AMSA 5GXIA 3UR4A 4FA9D 1I2MB 4Y5RD 3IUQA 4CI2A 4NENA 5TEFA 1N6DA 1MG3A 1B9YA 3RN1D 3MUNA 4WK4A 3EQ7A 3OW8A 2PM6B 2HKMA 3EI4A 4O3UB 1JOFA 2B5NA 3C5MA 3NVQA 4GGCA 4CZYA 2H13A 4LG9A 4ZN4A 3B7FA 2HU7A 4O3TB 4PXWA 4PBZA 1SQJA 2HU5A 3NVNA 4AOWA 4O2WA 3ZWLB
chains in the Genus database with same CATH topology
4NAAA 3MVDK 4DNVA 4QAMA 3QI0A 1I2MB 4JHPC 4L1MA 3OF7A 4DNUA 1A12A 3KCIA 4D9SA 4DNWA 1JTDB 4JHNA 3QHYB 4NBMA 4NC4A 4O2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAA A;  3MVD K;  4DNV A;  4QAM A;  3QI0 A;  1I2M B;  4JHP C;  4L1M A;  3OF7 A;  4DNU A;  1A12 A;  3KCI A;  4D9S A;  4DNW A;  1JTD B;  4JHN A;  3QHY B;  4NBM A;  4NC4 A;  4O2W A; 
#chains in the Genus database with same CATH topology
 4HDJ A;  2AH1 A;  3CIK B;  4GM3 A;  5E6U A;  1QFS A;  4G55 A;  5HQG A;  2Z2O A;  4I79 A;  4AEZ A;  3SBR A;  3AL8 B;  1FWX A;  2VC2 A;  3ODT A;  4IRZ A;  3PVW B;  3BG0 A;  5I5J A;  2P9K C;  4MMZ A;  1A12 A;  5KDO B;  4UI9 R;  1L0Q A;  2P9I C;  2YNN A;  4E5Z A;  1NEX B;  2VZ1 A;  3AL8 A;  3K27 A;  4CY2 A;  3QHY B;  4PSX B;  3K72 A;  5FFG A;  5EAL A;  1PI6 A;  3I2N A;  5HE0 B;  3O4G A;  4AMZ A;  3ZDX A;  5M5U A;  5SXM A;  2MTA H;  2UZX B;  3IVM A;  4G56 B;  5M61 A;  3VI3 A;  3GRE A;  1A0R B;  5CYK B;  2VZ3 A;  2CN3 A;  5IJ7 E;  5EMM B;  1H2Y A;  4PNK B;  3K26 A;  2HU8 A;  2H9L A;  3RN0 D;  5EAR A;  3NIF A;  2BCJ B;  5H1M A;  2XDW A;  4A7J A;  1UTC A;  3EQ9 A;  5IC7 A;  4JHN A;  3UVK A;  2AH0 A;  3JZG A;  5FKQ A;  2CO0 C;  5CYK A;  1OMW B;  1VE7 A;  4FAN D;  5K19 A;  4WK2 A;  3FCS A;  3I8C A;  4X61 B;  4QQE A;  2BBK H;  4Y7R A;  4CC9 A;  1XKS A;  2J56 H;  3UVM A;  4CZV A;  3UKU C;  4CY1 A;  5FXY A;  4A0B B;  4ERY A;  4AN1 A;  4A09 B;  1QNI A;  2EID A;  2H47 A;  2H9M A;  1K32 A;  3V5W B;  3MZK A;  5H14 A;  3RLM D;  2TRC B;  5TDH B;  3SVW D;  4D0K A;  3EG6 A;  4L9O A;  4A0B A;  3F3F A;  4A09 A;  3I7P A;  3PXT D;  3EQ8 A;  2CNX A;  3EI1 B;  3MZL A;  3ZE1 A;  4J78 A;  4UM9 A;  4JHP C;  5HE1 B;  3UVO A;  4J87 A;  3EI3 B;  3DDU A;  5FKT A;  5EM2 B;  3IJ1 A;  2IAA A;  3KCI A;  2GNQ A;  2YBA A;  2AGZ A;  4R7A B;  3RRM C;  3EI1 A;  3FM0 A;  1GOT B;  3I7H A;  3RSE C;  4O9D A;  5I5M A;  4WJK A;  4U7A A;  4GGA A;  4K3J B;  3SMR A;  1GP2 B;  3MUO A;  3UVL A;  4J73 A;  3K71 A;  2G99 A;  5IGQ A;  4AX4 A;  2Z2P A;  3JRO A;  4XEI C;  3PXW D;  1PEV A;  4H5J A;  3GFC A;  4JXM A;  1Q47 A;  3SBP A;  5EAM A;  2XYI A;  3IKO A;  5C86 A;  1PGU A;  4H5I A;  4XYI A;  3DWL C;  3I7L A;  2OJY A;  3VA6 A;  2HKR A;  5B4W A;  3PE7 A;  5C92 A;  1R5M A;  3O4I A;  2O9K A;  2QR5 A;  4CY5 A;  4JD2 C;  4E5Z B;  2I3S A;  1YR2 A;  2HJB A;  4IMM A;  3EWE A;  5TEE A;  2OVQ B;  5E6S A;  4ESG A;  5EMK B;  4JSN C;  3OL2 B;  1E8N A;  5FFO A;  4CI3 A;  1T2X A;  3BG1 A;  2PM7 B;  4FA5 D;  5K1C C;  3IUJ A;  2OK6 A;  2Z2N A;  4L3G D;  4U1E I;  3SJL D;  4GM9 A;  1JV2 A;  1U4C A;  2EIE A;  4ZOY A;  4L1Q D;  4CI1 A;  2Q7Q A;  2XL2 A;  3OL2 A;  5IJ8 E;  3NVX A;  4PSW B;  4X60 B;  5FA5 B;  1PBY B;  2H68 A;  4BCD A;  5AFU 3;  5H17 A;  4AMY A;  3W15 A;  4EWR A;  5EMJ B;  2OVR B;  1K8K C;  5A2Q g;  3JRP A;  2XL3 A;  1JMZ B;  2WQ8 A;  3OKW A;  5THA A;  3JAM g;  1TYQ C;  2B5L A;  2J55 H;  3P4F A;  1ERJ A;  5AJA A;  3RFH A;  2QZP A;  4Z7Q A;  3BWS A;  5C2W B;  1VYH C;  2H9N A;  3ZDY A;  4FWW A;  4J0X A;  4RE6 A;  3MKS B;  3UVN A;  2AGW A;  3IJC A;  4FB1 D;  5HDB A;  3L4M D;  2VDQ A;  4NAA A;  1JJU B;  3IIY A;  2I0T A;  5IT9 g;  1P22 A;  2IUQ A;  3VH0 A;  3U4Y A;  4GQB B;  2HYE A;  4GMB A;  4FA4 D;  4FAV D;  1VZ3 A;  3MXX A;  3PVU B;  4J8B A;  4JSX C;  3VI4 A;  3O4H A;  2P9U C;  4LGN A;  4J86 A;  2JKX A;  3PXS D;  2J57 G;  4YVD A;  2YB8 B;  1MG2 A;  3GC3 B;  4WK0 A;  3F3P A;  3IUR A;  3IUL A;  4D6V A;  1GG2 B;  4BCC A;  3SHF A;  5IGO A;  1GOF A;  1H2Z A;  3KRX B;  4OZU A;  2YNO A;  3ZE0 A;  1TYE A;  4J82 A;  3T3M A;  4G1M A;  5EAP A;  5CXB B;  5FKS A;  4JSV C;  2P9N C;  3AL9 A;  3FRX A;  4D9S A;  4A2M A;  2VDR A;  1N6E A;  2CE9 A;  3EI2 B;  3JB9 L;  5FKR A;  1H2W A;  4PC0 A;  2B5M A;  2AGY A;  4MK0 B;  1L5G A;  1VE6 A;  5HE2 B;  1XHM A;  2UZY B;  3I7N A;  1QFM A;  2EIB A;  3OKT A;  5CXB A;  3SXT D;  3MVD K;  1OLZ A;  2OK4 A;  3JPX A;  3J81 g;  4ERZ A;  4GQ1 A;  4ZOX A;  4Z7N A;  4QAM A;  3OF7 A;  4BCB A;  4AN0 A;  3EI2 A;  4J8G A;  2BKL A;  4J77 A;  1NR0 A;  1U8C A;  2B4E A;  3F3G A;  3SBQ A;  2VDO A;  3JZH A;  3MMY A;  4PBY A;  2AQ5 A;  3AH8 B;  1SQ9 A;  3K6S A;  3IJ0 A;  1S4U X;  4BUJ C;  2OVP B;  2IWK A;  4RE5 A;  4MMX A;  4NC4 A;  2XZG A;  3I89 A;  1RI6 A;  2I0R A;  4MMY A;  2H6Q A;  3CFV A;  5FQD A;  5CXC B;  3ORV D;  4TZ4 A;  4DNV A;  5C9Z B;  2QXV A;  3QI0 A;  3KRW B;  4DNU A;  1E5T A;  4ERQ A;  4J84 A;  1C9I A;  1GXR A;  4QRJ A;  3PSL A;  4QL1 A;  1GOG A;  2HJ4 A;  4BH6 A;  5CXC A;  4L3H D;  2GC4 A;  3N0D A;  3IUN A;  3N0E A;  2HES X;  2IUV A;  4NBM A;  4J81 A;  1N6F A;  3ULE C;  5M5R A;  4NSX A;  2HXC A;  3NID A;  2AGX A;  1UOQ A;  2CO0 A;  4BP9 A;  3RMZ D;  3IIW A;  5M5V A;  1UOO A;  4N14 A;  2XE4 A;  4A0A B;  3CFS B;  1TBG A;  4GGD A;  1MDA H;  4ZOZ A;  3IJE A;  3AFC A;  2H6N A;  4DNW A;  1C9L A;  3EMH A;  4JSP C;  5M5T A;  4ES0 A;  3EU7 A;  3OKY B;  5FLX g;  5E6R A;  2OIZ A;  1H2X A;  1XIP A;  2VDM A;  4A0A A;  3UKR C;  1YFQ A;  1SHY B;  4FHL A;  4UM8 A;  3I7K A;  3ZDZ A;  5TF2 A;  4KFM B;  5C2V B;  4O45 A;  4L1M A;  3C99 A;  4A11 B;  3OKY A;  2IWF A;  3DSM A;  4CI8 A;  5HYN B;  5HE3 B;  2PBI B;  3V7D B;  2EIC A;  3I7O A;  4J0W A;  3T3P A;  3V4P A;  5GXH A;  2H9P A;  4BP8 A;  3A0F A;  4A11 A;  2VDK A;  2H6K A;  4LG8 A;  4QT8 A;  2VDN A;  2QC5 A;  2VDL A;  3SLE D;  3IUM A;  2G9A A;  4Z7O A;  5M5S A;  2H3X A;  3FGB A;  3C75 H;  1M1X A;  2H14 A;  4Z8L A;  2GC7 A;  4E54 B;  3I8E A;  4GQ2 P;  3E0C A;  2P9S C;  3DXM C;  3SFZ A;  4FA1 D;  2CN2 A;  2AGL A;  2YMU A;  4A2L A;  3L4O D;  2I0S A;  1O6F A;  4ZOV A;  2W18 A;  3VGZ A;  3V4V A;  4K3I D;  3PSC B;  3ZE2 A;  4BL0 A;  2I3T A;  5JWZ A;  2IUP A;  3DXK C;  4E54 A;  1K3I A;  1E8M A;  1O6G A;  4IA9 A;  4CY3 A;  5I5I A;  2YNP A;  2XU7 A;  3SN6 B;  1GOH A;  4A08 B;  2CE8 A;  4GM8 A;  5GMK n;  5GSA A;  4GZ8 A;  4JT5 C;  4O1Q D;  3OTT A;  3DM0 A;  2IUR A;  3C9C A;  3FCU A;  2VDP A;  3HFQ A;  1B9X A;  4G1E A;  3NIG A;  4XYH A;  2PM9 B;  3GD1 I;  5EML B;  3RFG A;  3J80 g;  4JT6 C;  2EBS A;  1U2V C;  4X63 B;  1UOP A;  4X3E A;  4A08 A;  1JTD B;  3MKQ A;  3O4J A;  3EI3 A;  4OWR A;  3SCY A;  4O02 A;  1VZ2 A;  3JZN A;  4J79 A;  5EM2 A;  2P9P C;  2PM9 A;  3EI4 B;  1BPO A;  1JMX B;  4CZX A;  3V9F A;  2P9L C;  3SWS D;  5AMS A;  5GXI A;  3UR4 A;  4FA9 D;  1I2M B;  4Y5R D;  3IUQ A;  4CI2 A;  4NEN A;  5TEF A;  1N6D A;  1MG3 A;  1B9Y A;  3RN1 D;  3MUN A;  4WK4 A;  3EQ7 A;  3OW8 A;  2PM6 B;  2HKM A;  3EI4 A;  4O3U B;  1JOF A;  2B5N A;  3C5M A;  3NVQ A;  4GGC A;  4CZY A;  2H13 A;  4LG9 A;  4ZN4 A;  3B7F A;  2HU7 A;  4O3T B;  4PXW A;  4PBZ A;  1SQJ A;  2HU5 A;  3NVN A;  4AOW A;  4O2W A;  3ZWL B; 
#chains in the Genus database with same CATH homology
 4NAA A;  3MVD K;  4DNV A;  4QAM A;  3QI0 A;  1I2M B;  4JHP C;  4L1M A;  3OF7 A;  4DNU A;  1A12 A;  3KCI A;  4D9S A;  4DNW A;  1JTD B;  4JHN A;  3QHY B;  4NBM A;  4NC4 A;  4O2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...