4JHPC

The crystal structure of the rpgr rcc1-like domain in complex with pde6d
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
362
structure length
362
Chain Sequence
b'LMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodie
publication title The interplay between RPGR, PDE-delta and Arl2/3 regulate the ciliary targeting of farnesylated cargo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 93
structure length 362
sequence length 362
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4jhpC00
3MVDK 4QAMA 3OF7A 4JHPC 4DNUA 4NC4A 3KCIA 3QI0A 4DNWA 1JTDB 4D9SA 3QHYB 1A12A 4O2WA 4NAAA 1I2MB 4NBMA 4L1MA 4JHNA 4DNVA
chains in the Genus database with same CATH superfamily
2OVRB 3EI1B 4J87A 2EIDA 4X61B 5AFU3 2JKXA 2P9IC 3V7DB 2I3TA 1GXRA 4CZYA 4BUJC 2VDQA 3MUNA 1S4UX 3SLED 5FKQA 1K32A 2H6KA 4FB1D 1A12A 4AMZA 3RSEC 3BG1A 1N6EA 3F3GA 4J0WA 3L4MD 4IA9A 4IMMA 2B5NA 2CNXA 3CFVA 2H6NA 3PXTD 3JAMg 3K72A 3K27A 4FWWA 4JSPC 4L3HD 2Q7QA 4BP9A 4AMYA 1B9XA 3ORVD 5HYNB 2VDOA 4X63B 3I7LA 2P9NC 4U7AA 2PBIB 3V9FA 5GSAA 1PBYB 1P22A 3O4GA 4BP8A 4O45A 4PSXB 2XE4A 4LGNA 5E6UA 5A2Qg 3B7FA 3F3PA 1QFSA 5HE3B 2AQ5A 3W15A 4XEIC 1UOOA 3OKYB 3SMRA 3MZLA 4O9DA 1H2YA 4A0BB 3SBPA 4G56B 5TEFA 4J81A 3C9CA 4JSVC 3J81g 1GP2B 3JPXA 4GM8A 3IVMA 1VE6A 2EIBA 3SJLD 1B9YA 3DSMA 5C9ZB 5EALA 4ZN4A 2IUQA 4J86A 1FWXA 2MTAH 1BPOA 1PGUA 2PM9A 4PSWB 3ZWLB 1RI6A 3AL8A 2P9KC 3JZNA 4JHNA 4FA4D 3SXTD 5CXCB 4GGAA 1K3IA 5IGOA 4K3ID 5KDOB 1E8NA 3HFQA 4EWRA 4CI1A 3OTTA 4AOWA 1Q47A 3IUNA 2VDRA 2XL3A 4J8BA 4I79A 3RN1D 1U8CA 4CI2A 1MG2A 3JRPA 4H5JA 4NC4A 2YBAA 5K1CC 5JWZA 1H2ZA 5H1MA 3PSCB 5HQGA 4A11A 3OKTA 2I0SA 3ZDXA 4JT6C 4O1QD 1SQ9A 5CYKA 4CI8A 1UOQA 3GREA 3K26A 4GQ2P 3NVNA 3F3FA 4U1EI 4QQEA 2AGWA 3AH8B 3UVKA 5H14A 3BWSA 3VH0A 4A08A 2HJBA 5SXMA 4DNUA 1T2XA 3P4FA 4J79A 3V4PA 1UTCA 5IC7A 4CI3A 3SBQA 2QC5A 4DNWA 2P9UC 3RFHA 3K71A 3EG6A 5HE1B 3BG0A 4E54A 4A0AA 3AFCA 4G55A 5FKRA 2J57G 3ZDZA 5K19A 2PM9B 2GC4A 2UZYB 3MUOA 3EWEA 3IJ1A 5HE2B 3N0DA 3V5WB 5IGQA 5EMMB 3IIYA 2QR5A 4CY3A 3A0FA 3OL2A 4CY1A 2TRCB 5M5VA 2BCJB 4O02A 3ZDYA 4WK0A 1VZ2A 1NEXB 2HXCA 2EICA 1JTDB 2IWFA 3UKRC 3JB9L 4A2MA 4A11B 2HESX 2YB8B 1TYQC 5IT9g 3SWSD 3IJ0A 4DNVA 2UZXB 1L0QA 4Z7OA 3MKQA 4BL0A 2G9AA 3K6SA 2GNQA 4NENA 4R7AB 3MXXA 3UKUC 5C2WB 4H5IA 4JXMA 3U4YA 1TYEA 3GC3B 3QI0A 3ZE0A 1N6FA 2BBKH 2CN2A 4KFMB 5H17A 2AGZA 2IAAA 4D9SA 2XL2A 1PEVA 2W18A 1I2MB 3NVXA 5CXBA 3MZKA 4GGCA 3SCYA 1YFQA 3PVUB 2H3XA 3FGBA 2CN3A 4CZXA 4ES0A 4E54B 2HKRA 5EMKB 2CE9A 3FCSA 4PBYA 1H2XA 5FQDA 4MMXA 5IJ7E 4CC9A 3I7KA 4ERQA 3VI4A 4E5ZA 1MDAH 2G99A 4IRZA 5M5TA 2AGXA 3PXSD 5EM2A 5GXIA 2H14A 3PXWD 4TZ4A 3SVWD 1SQJA 4BCCA 3PE7A 4NAAA 3EI2A 4Z7QA 5AJAA 4L1MA 4CY2A 2I0TA 3EQ7A 3I7OA 1L5GA 4A2LA 4AN1A 5IJ8E 1U2VC 3RLMD 2H9LA 2O9KA 4FAVD 4UI9R 2AGYA 3GD1I 2HU7A 2PM7B 1XHMA 3C99A 4WK4A 3PVWB 2AH1A 3FRXA 1M1XA 2H9NA 3IJCA 2IWKA 3PSLA 1C9IA 2H6QA 4J0XA 3ODTA 4GQ1A 4UM9A 4QT8A 1C9LA 3I8EA 4NBMA 3EI3A 1JJUB 1GOTB 4JSXC 4J77A 1VZ3A 3EI1A 5FA5B 3I8CA 2VDMA 3MVDK 5C2VB 2PM6B 3OW8A 1UOPA 3ZE2A 3RFGA 1N6DA 3OKWA 2VC2A 4XYIA 2OK6A 4BCDA 1OLZA 4J73A 2B4EA 4ZOYA 1GOFA 4HDJA 3DM0A 3JROA 3FM0A 1O6FA 2P9SC 1ERJA 5FKSA 1QNIA 2VDKA 4L3GD 5THAA 3RRMC 2I0RA 5TDHB 3SN6B 3UVLA 5FLXg 3RN0D 3J80g 4X3EA 2HU8A 3AL8B 3I7HA 1H2WA 3GFCA 2IURA 2CO0C 2VDLA 4L9OA 5EAPA 3T3PA 2QXVA 5GMKn 2BKLA 3EQ9A 5FFGA 2YNOA 5EAMA 4MMYA 3MKSB 1R5MA 2Z2NA 5FKTA 4XYHA 4PNKB 4RE6A 5CYKB 4J84A 3OKYA 1E5TA 4ZOVA 4A0BA 3I2NA 2VDPA 3OF7A 3O4IA 1XIPA 4Z7NA 3IUMA 4G1MA 4JHPC 2XZGA 4JSNC 2VZ3A 4L1QD 5M61A 4A08B 3RMZD 3IJEA 2GC7A 3SFZA 4FHLA 4O3TB 4CY5A 3DDUA 1VYHC 5EARA 4LG8A 4X60B 5CXCA 5AMSA 5I5IA 4GGDA 3SBRA 2P9LC 5M5UA 3NIFA 2HJ4A 1JMZB 2CE8A 3NIGA 3IUJA 4A0AB 2H9PA 2Z2OA 2B5MA 4GM3A 4QAMA 4Y7RA 2CO0A 1NR0A 3IKOA 1MG3A 4Z8LA 2OJYA 3VA6A 4A09A 2H13A 2OK4A 3AL9A 4K3JB 4N14A 3OL2B 4OWRA 3EI4A 3VGZA 1VE7A 1GOGA 3EQ8A 3VI3A 2VZ1A 4GMBA 4QRJA 3E0CA 3I7PA 2VDNA 5E6RA 3EMHA 5EMJB 4MMZA 1O6GA 4O2WA 4FA9D 3ZE1A 5E6SA 4PXWA 5GXHA 1QFMA 3ULEC 3N0EA 1E8MA 2OVPB 3O4HA 4ZOZA 1XKSA 2IUPA 2AH0A 3L4OD 4ERYA 2H9MA 3NVQA 3UR4A 4FA5D 2P9PC 2WQ8A 3KRWB 1OMWB 4ZOXA 5M5RA 2HU5A 1GOHA 1JV2A 3IUQA 3UVOA 3I7NA 4OZUA 3FCUA 2OVQB 4BH6A 4FAND 1SHYB 5TF2A 2YMUA 5CXBB 4AN0A 3CFSB 3V4VA 2XYIA 5FXYA 4QL1A 3IURA 2OIZA 3JZHA 4O3UB 1YR2A 3UVMA 4D0KA 4ERZA 4J8GA 5I5MA 2HKMA 4RE5A 3C5MA 4JD2C 4WK2A 4LG9A 5FFOA 5HE0B 1A0RB 1GG2B 5I5JA 4A09B 2IUVA 4MK0B 3O4JA 4GM9A 3KCIA 2J55H 3DWLC 3KRXB 4GZ8A 4JT5C 2H47A 4E5ZB 3EI4B 3JZGA 4AEZA 3NIDA 4G1EA 4FA1D 4AX4A 5M5SA 5EM2B 2YNPA 5C92A 2EIEA 2J56H 3EI2B 5HDBA 3T3MA 4A7JA 2YNNA 2AGLA 3C75H 4WJKA 3DXKC 5TEEA 1U4CA 2XU7A 4UM8A 4D6VA 4GQBB 3IULA 3I89A 4J78A 4NSXA 4PC0A 3CIKB 4CZVA 3EU7A 4Y5RD 2XDWA 1JOFA 5EMLB 1K8KC 2HYEA 1JMXB 2Z2PA 2B5LA 1TBGA 4J82A 3QHYB 4YVDA 2I3SA 3UVNA 4PBZA 5B4WA 2QZPA 4ESGA 2EBSA 3IIWA 3MMYA 4BCBA 5C86A 1PI6A 3SHFA 3DXMC 3EI3B 2H68A
chains in the Genus database with same CATH topology
3MVDK 4QAMA 3OF7A 4JHPC 4DNUA 4NC4A 3KCIA 3QI0A 4DNWA 1JTDB 4D9SA 3QHYB 1A12A 4O2WA 4NAAA 1I2MB 4NBMA 4L1MA 4JHNA 4DNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD K;  4QAM A;  3OF7 A;  4JHP C;  4DNU A;  4NC4 A;  3KCI A;  3QI0 A;  4DNW A;  1JTD B;  4D9S A;  3QHY B;  1A12 A;  4O2W A;  4NAA A;  1I2M B;  4NBM A;  4L1M A;  4JHN A;  4DNV A; 
#chains in the Genus database with same CATH topology
 2OVR B;  3EI1 B;  4J87 A;  2EID A;  4X61 B;  5AFU 3;  2JKX A;  2P9I C;  3V7D B;  2I3T A;  1GXR A;  4CZY A;  4BUJ C;  2VDQ A;  3MUN A;  1S4U X;  3SLE D;  5FKQ A;  1K32 A;  2H6K A;  4FB1 D;  1A12 A;  4AMZ A;  3RSE C;  3BG1 A;  1N6E A;  3F3G A;  4J0W A;  3L4M D;  4IA9 A;  4IMM A;  2B5N A;  2CNX A;  3CFV A;  2H6N A;  3PXT D;  3JAM g;  3K72 A;  3K27 A;  4FWW A;  4JSP C;  4L3H D;  2Q7Q A;  4BP9 A;  4AMY A;  1B9X A;  3ORV D;  5HYN B;  2VDO A;  4X63 B;  3I7L A;  2P9N C;  4U7A A;  2PBI B;  3V9F A;  5GSA A;  1PBY B;  1P22 A;  3O4G A;  4BP8 A;  4O45 A;  4PSX B;  2XE4 A;  4LGN A;  5E6U A;  5A2Q g;  3B7F A;  3F3P A;  1QFS A;  5HE3 B;  2AQ5 A;  3W15 A;  4XEI C;  1UOO A;  3OKY B;  3SMR A;  3MZL A;  4O9D A;  1H2Y A;  4A0B B;  3SBP A;  4G56 B;  5TEF A;  4J81 A;  3C9C A;  4JSV C;  3J81 g;  1GP2 B;  3JPX A;  4GM8 A;  3IVM A;  1VE6 A;  2EIB A;  3SJL D;  1B9Y A;  3DSM A;  5C9Z B;  5EAL A;  4ZN4 A;  2IUQ A;  4J86 A;  1FWX A;  2MTA H;  1BPO A;  1PGU A;  2PM9 A;  4PSW B;  3ZWL B;  1RI6 A;  3AL8 A;  2P9K C;  3JZN A;  4JHN A;  4FA4 D;  3SXT D;  5CXC B;  4GGA A;  1K3I A;  5IGO A;  4K3I D;  5KDO B;  1E8N A;  3HFQ A;  4EWR A;  4CI1 A;  3OTT A;  4AOW A;  1Q47 A;  3IUN A;  2VDR A;  2XL3 A;  4J8B A;  4I79 A;  3RN1 D;  1U8C A;  4CI2 A;  1MG2 A;  3JRP A;  4H5J A;  4NC4 A;  2YBA A;  5K1C C;  5JWZ A;  1H2Z A;  5H1M A;  3PSC B;  5HQG A;  4A11 A;  3OKT A;  2I0S A;  3ZDX A;  4JT6 C;  4O1Q D;  1SQ9 A;  5CYK A;  4CI8 A;  1UOQ A;  3GRE A;  3K26 A;  4GQ2 P;  3NVN A;  3F3F A;  4U1E I;  4QQE A;  2AGW A;  3AH8 B;  3UVK A;  5H14 A;  3BWS A;  3VH0 A;  4A08 A;  2HJB A;  5SXM A;  4DNU A;  1T2X A;  3P4F A;  4J79 A;  3V4P A;  1UTC A;  5IC7 A;  4CI3 A;  3SBQ A;  2QC5 A;  4DNW A;  2P9U C;  3RFH A;  3K71 A;  3EG6 A;  5HE1 B;  3BG0 A;  4E54 A;  4A0A A;  3AFC A;  4G55 A;  5FKR A;  2J57 G;  3ZDZ A;  5K19 A;  2PM9 B;  2GC4 A;  2UZY B;  3MUO A;  3EWE A;  3IJ1 A;  5HE2 B;  3N0D A;  3V5W B;  5IGQ A;  5EMM B;  3IIY A;  2QR5 A;  4CY3 A;  3A0F A;  3OL2 A;  4CY1 A;  2TRC B;  5M5V A;  2BCJ B;  4O02 A;  3ZDY A;  4WK0 A;  1VZ2 A;  1NEX B;  2HXC A;  2EIC A;  1JTD B;  2IWF A;  3UKR C;  3JB9 L;  4A2M A;  4A11 B;  2HES X;  2YB8 B;  1TYQ C;  5IT9 g;  3SWS D;  3IJ0 A;  4DNV A;  2UZX B;  1L0Q A;  4Z7O A;  3MKQ A;  4BL0 A;  2G9A A;  3K6S A;  2GNQ A;  4NEN A;  4R7A B;  3MXX A;  3UKU C;  5C2W B;  4H5I A;  4JXM A;  3U4Y A;  1TYE A;  3GC3 B;  3QI0 A;  3ZE0 A;  1N6F A;  2BBK H;  2CN2 A;  4KFM B;  5H17 A;  2AGZ A;  2IAA A;  4D9S A;  2XL2 A;  1PEV A;  2W18 A;  1I2M B;  3NVX A;  5CXB A;  3MZK A;  4GGC A;  3SCY A;  1YFQ A;  3PVU B;  2H3X A;  3FGB A;  2CN3 A;  4CZX A;  4ES0 A;  4E54 B;  2HKR A;  5EMK B;  2CE9 A;  3FCS A;  4PBY A;  1H2X A;  5FQD A;  4MMX A;  5IJ7 E;  4CC9 A;  3I7K A;  4ERQ A;  3VI4 A;  4E5Z A;  1MDA H;  2G99 A;  4IRZ A;  5M5T A;  2AGX A;  3PXS D;  5EM2 A;  5GXI A;  2H14 A;  3PXW D;  4TZ4 A;  3SVW D;  1SQJ A;  4BCC A;  3PE7 A;  4NAA A;  3EI2 A;  4Z7Q A;  5AJA A;  4L1M A;  4CY2 A;  2I0T A;  3EQ7 A;  3I7O A;  1L5G A;  4A2L A;  4AN1 A;  5IJ8 E;  1U2V C;  3RLM D;  2H9L A;  2O9K A;  4FAV D;  4UI9 R;  2AGY A;  3GD1 I;  2HU7 A;  2PM7 B;  1XHM A;  3C99 A;  4WK4 A;  3PVW B;  2AH1 A;  3FRX A;  1M1X A;  2H9N A;  3IJC A;  2IWK A;  3PSL A;  1C9I A;  2H6Q A;  4J0X A;  3ODT A;  4GQ1 A;  4UM9 A;  4QT8 A;  1C9L A;  3I8E A;  4NBM A;  3EI3 A;  1JJU B;  1GOT B;  4JSX C;  4J77 A;  1VZ3 A;  3EI1 A;  5FA5 B;  3I8C A;  2VDM A;  3MVD K;  5C2V B;  2PM6 B;  3OW8 A;  1UOP A;  3ZE2 A;  3RFG A;  1N6D A;  3OKW A;  2VC2 A;  4XYI A;  2OK6 A;  4BCD A;  1OLZ A;  4J73 A;  2B4E A;  4ZOY A;  1GOF A;  4HDJ A;  3DM0 A;  3JRO A;  3FM0 A;  1O6F A;  2P9S C;  1ERJ A;  5FKS A;  1QNI A;  2VDK A;  4L3G D;  5THA A;  3RRM C;  2I0R A;  5TDH B;  3SN6 B;  3UVL A;  5FLX g;  3RN0 D;  3J80 g;  4X3E A;  2HU8 A;  3AL8 B;  3I7H A;  1H2W A;  3GFC A;  2IUR A;  2CO0 C;  2VDL A;  4L9O A;  5EAP A;  3T3P A;  2QXV A;  5GMK n;  2BKL A;  3EQ9 A;  5FFG A;  2YNO A;  5EAM A;  4MMY A;  3MKS B;  1R5M A;  2Z2N A;  5FKT A;  4XYH A;  4PNK B;  4RE6 A;  5CYK B;  4J84 A;  3OKY A;  1E5T A;  4ZOV A;  4A0B A;  3I2N A;  2VDP A;  3OF7 A;  3O4I A;  1XIP A;  4Z7N A;  3IUM A;  4G1M A;  4JHP C;  2XZG A;  4JSN C;  2VZ3 A;  4L1Q D;  5M61 A;  4A08 B;  3RMZ D;  3IJE A;  2GC7 A;  3SFZ A;  4FHL A;  4O3T B;  4CY5 A;  3DDU A;  1VYH C;  5EAR A;  4LG8 A;  4X60 B;  5CXC A;  5AMS A;  5I5I A;  4GGD A;  3SBR A;  2P9L C;  5M5U A;  3NIF A;  2HJ4 A;  1JMZ B;  2CE8 A;  3NIG A;  3IUJ A;  4A0A B;  2H9P A;  2Z2O A;  2B5M A;  4GM3 A;  4QAM A;  4Y7R A;  2CO0 A;  1NR0 A;  3IKO A;  1MG3 A;  4Z8L A;  2OJY A;  3VA6 A;  4A09 A;  2H13 A;  2OK4 A;  3AL9 A;  4K3J B;  4N14 A;  3OL2 B;  4OWR A;  3EI4 A;  3VGZ A;  1VE7 A;  1GOG A;  3EQ8 A;  3VI3 A;  2VZ1 A;  4GMB A;  4QRJ A;  3E0C A;  3I7P A;  2VDN A;  5E6R A;  3EMH A;  5EMJ B;  4MMZ A;  1O6G A;  4O2W A;  4FA9 D;  3ZE1 A;  5E6S A;  4PXW A;  5GXH A;  1QFM A;  3ULE C;  3N0E A;  1E8M A;  2OVP B;  3O4H A;  4ZOZ A;  1XKS A;  2IUP A;  2AH0 A;  3L4O D;  4ERY A;  2H9M A;  3NVQ A;  3UR4 A;  4FA5 D;  2P9P C;  2WQ8 A;  3KRW B;  1OMW B;  4ZOX A;  5M5R A;  2HU5 A;  1GOH A;  1JV2 A;  3IUQ A;  3UVO A;  3I7N A;  4OZU A;  3FCU A;  2OVQ B;  4BH6 A;  4FAN D;  1SHY B;  5TF2 A;  2YMU A;  5CXB B;  4AN0 A;  3CFS B;  3V4V A;  2XYI A;  5FXY A;  4QL1 A;  3IUR A;  2OIZ A;  3JZH A;  4O3U B;  1YR2 A;  3UVM A;  4D0K A;  4ERZ A;  4J8G A;  5I5M A;  2HKM A;  4RE5 A;  3C5M A;  4JD2 C;  4WK2 A;  4LG9 A;  5FFO A;  5HE0 B;  1A0R B;  1GG2 B;  5I5J A;  4A09 B;  2IUV A;  4MK0 B;  3O4J A;  4GM9 A;  3KCI A;  2J55 H;  3DWL C;  3KRX B;  4GZ8 A;  4JT5 C;  2H47 A;  4E5Z B;  3EI4 B;  3JZG A;  4AEZ A;  3NID A;  4G1E A;  4FA1 D;  4AX4 A;  5M5S A;  5EM2 B;  2YNP A;  5C92 A;  2EIE A;  2J56 H;  3EI2 B;  5HDB A;  3T3M A;  4A7J A;  2YNN A;  2AGL A;  3C75 H;  4WJK A;  3DXK C;  5TEE A;  1U4C A;  2XU7 A;  4UM8 A;  4D6V A;  4GQB B;  3IUL A;  3I89 A;  4J78 A;  4NSX A;  4PC0 A;  3CIK B;  4CZV A;  3EU7 A;  4Y5R D;  2XDW A;  1JOF A;  5EML B;  1K8K C;  2HYE A;  1JMX B;  2Z2P A;  2B5L A;  1TBG A;  4J82 A;  3QHY B;  4YVD A;  2I3S A;  3UVN A;  4PBZ A;  5B4W A;  2QZP A;  4ESG A;  2EBS A;  3IIW A;  3MMY A;  4BCB A;  5C86 A;  1PI6 A;  3SHF A;  3DXM C;  3EI3 B;  2H68 A; 
#chains in the Genus database with same CATH homology
 3MVD K;  4QAM A;  3OF7 A;  4JHP C;  4DNU A;  4NC4 A;  3KCI A;  3QI0 A;  4DNW A;  1JTD B;  4D9S A;  3QHY B;  1A12 A;  4O2W A;  4NAA A;  1I2M B;  4NBM A;  4L1M A;  4JHN A;  4DNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...