3SMRA

Crystal structure of human wd repeat domain 5 with compound
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
302
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
publication title Small-molecule inhibition of MLL activity by disruption of its interaction with WDR5.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 302
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3smrA00
2B5LA 3VH0A 4JSXC 1QNIA 3ZWLB 2YB8B 4N14A 2Z2OA 3F3FA 4X61B 5HE3B 4A08A 3N0EA 5HYNB 4U7AA 3I7OA 1SQ9A 3IKOA 3FGBA 5EMJB 3NVNA 4XYIA 4GGCA 3JZGA 3ORVD 3EI4A 4J82A 5GSAA 4A08B 2H47A 2AGWA 3C5MA 1K32A 2YMUA 1JMZB 4Y5RD 3DXMC 4J78A 1FWXA 4CI2A 1JJUB 3RFGA 3AH8B 2HXCA 3EI4B 5H1MA 5HE1B 3UVOA 4JSNC 4L1QD 4J8BA 2CO0C 2CO0A 2IWKA 3ODTA 2OK4A 5AMSA 5HQGA 2IUVA 4J79A 4L3HD 4QRJA 2OK6A 3AFCA 4K3ID 3SLED 2H3XA 3L4MD 4JT6C 3PXTD 3RFHA 2GC4A 3JB9L 2PM9A 1U4CA 4PC0A 4XEIC 4OZUA 4ERQA 2XYIA 4EWRA 3JZHA 2H14A 2P9IC 1B9YA 1TYQC 3IJ1A 1GXRA 2H13A 5K19A 3PSLA 2PM9B 3E0CA 4GQ2P 2IURA 3PXWD 1VYHC 3C99A 3EMHA 3IIYA 2P9NC 3F3PA 1JMXB 3PVUB 1MG2A 3NVXA 5I5IA 2QC5A 4J73A 5IGQA 4U1EI 3UVNA 4O3UB 4CZVA 5EAPA 2CE9A 3K26A 4CI8A 5EMKB 1L0QA 2H6QA 2HJ4A 4J84A 3RN0D 5A2Qg 4JD2C 4MK0B 5H17A 4PNKB 4AEZA 3MZKA 4FHLA 2BBKH 3I7LA 2CE8A 1K8KC 1XKSA 3OKYB 3KRWB 5GMKn 2OVRB 3FRXA 5FA5B 3PE7A 5FXYA 3UKRC 4X63B 4J81A 2J55H 4ZOVA 2I3TA 3UR4A 4A09A 3BG0A 5FKTA 4PBYA 2YBAA 3I8CA 5IC7A 3UVKA 4JT5C 5EAMA 3GREA 5TEEA 3RLMD 2QXVA 4XYHA 3SN6B 1XIPA 4A09B 3W15A 4O45A 3HFQA 4FWWA 3SBQA 5EMMB 5KDOB 2Z2PA 2I0RA 3SMRA 3EU7A 4BUJC 4ZOYA 4BL0A 3V5WB 2CN2A 2GC7A 3SXTD 1GG2B 2YNNA 4KFMB 4J86A 2AGZA 1ERJA 3ULEC 2YNPA 5C9ZB 2HYEA 4D6VA 1RI6A 4CZYA 4ESGA 4ZN4A 1MG3A 3I7HA 4GM9A 1JOFA 2O9KA 4LG9A 4FB1D 3SWSD 1N6EA 3I2NA 4X3EA 1TBGA 4A7JA 3CFVA 2AGXA 4H5IA 3SFZA 5EMLB 2B4EA 4J77A 2XL2A 4BH6A 2IUQA 3NVQA 3UVLA 3V9FA 1PBYB 4A0AA 3VA6A 3OTTA 4YVDA 4ZOXA 2GNQA 3J80g 2AH1A 3F3GA 5GXHA 4FAVD 3EI2A 2AQ5A 4J8GA 4O3TB 4A0AB 4FA9D 3N0DA 4GGDA 2UZYB 4TZ4A 1N6FA 2Z2NA 4G56B 3EI2B 1GP2B 5HE0B 5C2WB 4Y7RA 2P9LC 4ES0A 1PEVA 3JROA 2B5MA 2CNXA 1OMWB 4CY5A 4CI3A 2H68A 3KRXB 4J0XA 4L9OA 3PXSD 3EI3A 3JZNA 5AJAA 2AH0A 5K1CC 3FM0A 5CXBA 2HKRA 2IUPA 2HJBA 2OVPB 1GOTB 4J87A 4JSPC 2UZXB 4QQEA 3EI3B 5CXBB 2G9AA 4A11A 5GXIA 3JRPA 3AL9A 3DXKC 1MDAH 4PBZA 2J56H 3DM0A 5EARA 2XL3A 3IJ0A 2H9LA 4GMBA 4GQBB 3I89A 4IMMA 2H6NA 2AGLA 4FA4D 2Q7QA 2HESX 4GM3A 3OW8A 4K3JB 4A11B 4GGAA 1S4UX 3MMYA 4GZ8A 2B5NA 1SHYB 1NR0A 4ERYA 3U4YA 3RSEC 4LGNA 3JPXA 3PSCB 5FKSA 4NSXA 4A2LA 2MTAH 3EG6A 5FKQA 2J57G 5TF2A 3BG1A 1OLZA 3PVWB 5SXMA 4E54A 3AL8A 4CZXA 3BWSA 2H9PA 2W18A 5THAA 2H6KA 4I79A 5I5MA 4ZOZA 5HE2B 3SCYA 4E54B 1A0RB 2BCJB 5FQDA 3SBPA 2OVQB 3AL8B 4FAND 1NEXB 2XU7A 2YNOA 3DSMA 4PSWB 3VGZA 3I7KA 3MXXA 5IT9g 2G99A 4A0BA 4IA9A 1P22A 3GFCA 4PXWA 4CY1A 5CXCA 4JXMA 5FKRA 4D0KA 3SBRA 2OJYA 1XHMA 2P9KC 5C2VB 2H9NA 3SVWD 4A0BB 2TRCB 4O1QD 4CY3A 5CXCB 3IIWA 4LG8A 1R5MA 4PSXB 2CN3A 4GQ1A 3RMZD 3I8EA 3L4OD 3V7DB 3MKQA 3JAMg 4Z8LA 4O9DA 2PM6B 5B4WA 5IGOA 4R7AB 3K27A 3DWLC 4CY2A 3C75H 4QT8A 1SQJA 3SJLD 4ERZA 4H5JA 5H14A 3SHFA 4L3GD 5IJ8E 1U2VC 4CC9A 3MKSB 3RRMC 1PI6A 3EI1A 2PM7B 4UI9R 4X60B 3UKUC 3C9CA 2HKMA 4GM8A 3J81g 2H9MA 2IWFA 4FA5D 5FLXg 5JWZA 4OWRA 3UVMA 5AFU3 5CYKA 3I7NA 3EI1B 2AGYA 3B7FA 3P4FA 4JSVC 5EALA 3RN1D 5IJ7E 5TEFA 4A2MA 2IAAA 3CFSB 4QL1A 1PGUA 4E5ZA 2P9PC 2I0SA 3OKYA 1Q47A 3A0FA 4CI1A 3OL2A 5EM2A 5CYKB 2EBSA 4HDJA 5I5JA 1B9XA 4E5ZB 4FA1D 3MZLA 3OKWA 2PBIB 2P9SC 5TDHB 4AOWA 2I3SA 3I7PA 3OL2B 2OIZA 3EWEA 4J0WA 5EM2B 2I0TA 3IJCA 1N6DA 1YFQA 3CIKB 2P9UC 3OKTA
chains in the Genus database with same CATH superfamily
2B5LA 2VDMA 3VH0A 4JSXC 5FFGA 1QNIA 3ZWLB 2YB8B 4N14A 2Z2OA 3F3FA 4X61B 5HE3B 4A08A 1H2ZA 1O6GA 3GD1I 3N0EA 5HYNB 4U7AA 3I7OA 1SQ9A 3IKOA 3QHYB 3FGBA 5EMJB 3NVNA 4XYIA 4GGCA 3O4GA 3JZGA 3ORVD 3EI4A 4J82A 5GSAA 4Z7OA 4A08B 2H47A 2AGWA 4DNVA 3C5MA 1K32A 2YMUA 1M1XA 1JMZB 3NIGA 4Y5RD 3DXMC 4BCCA 4AN1A 4DNWA 4J78A 1FWXA 4CI2A 1JJUB 3RFGA 3AH8B 2HXCA 1UOOA 3EI4B 5H1MA 5HE1B 3UVOA 4JSNC 2VDRA 4NC4A 4G55A 1JV2A 4L1QD 4J8BA 2CO0C 2CO0A 2IWKA 3ODTA 2OK4A 5AMSA 5HQGA 2IUVA 4J79A 3GC3B 4L3HD 4QRJA 1I2MB 1L5GA 2OK6A 3AFCA 4K3ID 4Z7QA 3SLED 2H3XA 3L4MD 4JT6C 3PXTD 1GOFA 3RFHA 2GC4A 3JB9L 2PM9A 1U4CA 4PC0A 4XEIC 4OZUA 4ERQA 2XYIA 4EWRA 3JZHA 3MVDK 2H14A 4MMYA 4UM9A 2JKXA 2P9IC 1B9YA 1TYQC 4AX4A 4AMYA 3IJ1A 1GXRA 4L1MA 2H13A 5K19A 3PSLA 2PM9B 1GOGA 5C86A 3E0CA 4GQ2P 2IURA 3PXWD 1VYHC 3C99A 3EMHA 3IIYA 2VDNA 2P9NC 3F3PA 1JMXB 3PVUB 1MG2A 3NIDA 3NVXA 5I5IA 2QC5A 1VE6A 3OF7A 2QZPA 3O4HA 4J73A 5IGQA 4U1EI 3UVNA 4O3UB 4CZVA 5EAPA 1VE7A 2CE9A 3K26A 3ZE2A 4CI8A 5EMKB 1L0QA 2H6QA 2HJ4A 4J84A 3RN0D 3IJEA 3IUJA 5A2Qg 4JD2C 4MK0B 3EQ7A 5H17A 4PNKB 4WJKA 4AEZA 3MZKA 4NAAA 3O4IA 4FHLA 2BBKH 3I7LA 2CE8A 1K8KC 4UM8A 1XKSA 3OKYB 3KRWB 5GMKn 2OVRB 3FRXA 4G1MA 5E6RA 5FA5B 3FCSA 1C9IA 3PE7A 5FXYA 3UKRC 4X63B 4J81A 2J55H 2VZ3A 4G1EA 4ZOVA 2I3TA 3UR4A 4A09A 3BG0A 4JHPC 5FKTA 4PBYA 4MMZA 2YBAA 3I8CA 5IC7A 4Z7NA 3DDUA 4BCDA 3UVKA 4JT5C 5M5UA 1K3IA 5EAMA 3GREA 1H2YA 2VDLA 5TEEA 2VDOA 3MUNA 3RLMD 2QXVA 3K72A 4XYHA 3SN6B 1XIPA 4A09B 3W15A 4O45A 3HFQA 4FWWA 3SBQA 5EMMB 5KDOB 2Z2PA 2I0RA 3SMRA 3EU7A 4BUJC 4ZOYA 4BL0A 3V5WB 2CN2A 2GC7A 3SXTD 1UOQA 1GG2B 1E5TA 2YNNA 4KFMB 4J86A 4O02A 2AGZA 1ERJA 3ULEC 2HU7A 2YNPA 5C9ZB 3IVMA 2HYEA 4D6VA 1RI6A 4CZYA 4ESGA 1GOHA 4ZN4A 1MG3A 3I7HA 4GM9A 2HU8A 1JOFA 2O9KA 4LG9A 4FB1D 3SWSD 4AN0A 1N6EA 3I2NA 4X3EA 1TBGA 4A7JA 1JTDB 3CFVA 2AGXA 3EQ8A 3KCIA 4H5IA 3SFZA 5EMLB 2B4EA 4J77A 2XL2A 4BH6A 4RE5A 2IUQA 3NVQA 3UVLA 3V9FA 1PBYB 4A0AA 3VA6A 3OTTA 4YVDA 3ZE0A 4ZOXA 2GNQA 4WK2A 3J80g 2AH1A 1E8NA 1TYEA 3F3GA 5GXHA 4FAVD 3EI2A 4DNUA 2AQ5A 1A12A 4J8GA 4QAMA 3VI3A 4O3TB 4A0AB 4FA9D 3N0DA 4AMZA 4GGDA 2UZYB 4TZ4A 1N6FA 2Z2NA 5M5VA 4G56B 3EI2B 1GP2B 3MUOA 5HE0B 3IURA 5C2WB 4RE6A 4Y7RA 2XDWA 4BCBA 3K6SA 2P9LC 4ES0A 1PEVA 2EIEA 3JROA 4NENA 2B5MA 2CNXA 4BP9A 1QFMA 1OMWB 4CY5A 2XE4A 4CI3A 2H68A 3KRXB 4J0XA 4L9OA 2VC2A 5C92A 3K71A 3PXSD 3EI3A 3JZNA 5AJAA 2AH0A 5K1CC 3FM0A 3O4JA 5CXBA 1YR2A 2HKRA 2BKLA 2IUPA 2HJBA 2OVPB 3ZDYA 1VZ3A 2HU5A 4O2WA 1GOTB 4J87A 3ZDZA 4JSPC 3IUNA 2UZXB 4QQEA 3EI3B 5CXBB 2G9AA 2QR5A 4A11A 5GXIA 3JRPA 3AL9A 3DXKC 1MDAH 1C9LA 4PBZA 2J56H 2XZGA 3DM0A 5EARA 4JHNA 2XL3A 3IJ0A 2H9LA 4GMBA 4GQBB 3I89A 4IMMA 2H6NA 2AGLA 3VI4A 4FA4D 2Q7QA 3IULA 1E8MA 2HESX 4GM3A 3OW8A 4K3JB 5M61A 4A11B 4GGAA 1S4UX 3MMYA 4GZ8A 2EICA 2B5NA 5M5SA 1SHYB 1NR0A 4ERYA 3NIFA 3U4YA 3RSEC 4LGNA 3JPXA 3PSCB 5FKSA 1O6FA 4NSXA 4A2LA 2MTAH 3EG6A 5FKQA 3ZE1A 2J57G 5TF2A 3BG1A 1OLZA 3PVWB 5SXMA 4E54A 3AL8A 4CZXA 3BWSA 2H9PA 2W18A 5THAA 2H6KA 4I79A 5I5MA 4ZOZA 5HE2B 3SCYA 2VDKA 4E54B 1A0RB 2BCJB 5FQDA 3SBPA 2OVQB 3V4PA 3AL8B 4FAND 3QI0A 3EQ9A 1NEXB 2XU7A 2WQ8A 2YNOA 1T2XA 3DSMA 4PSWB 3I7KA 3MXXA 3VGZA 5IT9g 2G99A 4A0BA 4IA9A 1P22A 3GFCA 4PXWA 4CY1A 5CXCA 4JXMA 1BPOA 3T3MA 5FKRA 4D0KA 5HDBA 3SBRA 2OJYA 1XHMA 2P9KC 5C2VB 2H9NA 3SVWD 4A0BB 2TRCB 4O1QD 3V4VA 4CY3A 5CXCB 3IIWA 4LG8A 5M5TA 1R5MA 3FCUA 4PSXB 2CN3A 4GQ1A 2EIDA 3RMZD 3I8EA 3L4OD 3V7DB 3MKQA 3JAMg 4Z8LA 4NBMA 4O9DA 2PM6B 5B4WA 5IGOA 4R7AB 3K27A 4WK4A 3DWLC 5M5RA 4CY2A 4WK0A 3C75H 1UTCA 1SQJA 4QT8A 3SJLD 4ERZA 2VDPA 4H5JA 2EIBA 5H14A 3SHFA 4L3GD 5IJ8E 1U2VC 4CC9A 3MKSB 3RRMC 1PI6A 3EI1A 2PM7B 4UI9R 4X60B 3UKUC 3C9CA 2VZ1A 2VDQA 2HKMA 4GM8A 3J81g 1QFSA 2H9MA 1UOPA 2IWFA 4BP8A 4FA5D 3IUQA 5FLXg 5JWZA 4OWRA 3UVMA 5AFU3 1H2XA 5CYKA 4D9SA 3I7NA 3EI1B 2AGYA 3B7FA 3P4FA 4JSVC 5EALA 3RN1D 5IJ7E 5TEFA 4A2MA 2IAAA 3CFSB 4QL1A 1PGUA 4E5ZA 2P9PC 3T3PA 2I0SA 4IRZA 3OKYA 1Q47A 3A0FA 4CI1A 3OL2A 5EM2A 5CYKB 2EBSA 4HDJA 1H2WA 5I5JA 5E6UA 1B9XA 4E5ZB 4FA1D 3MZLA 3OKWA 3IUMA 2PBIB 2P9SC 5TDHB 4AOWA 2I3SA 3I7PA 4MMXA 3OL2B 5FFOA 2OIZA 3EWEA 4J0WA 5EM2B 2I0TA 3IJCA 1U8CA 1N6DA 3ZDXA 1YFQA 3CIKB 2P9UC 1VZ2A 5E6SA 3OKTA
chains in the Genus database with same CATH topology
2B5LA 3VH0A 4JSXC 1QNIA 3ZWLB 2YB8B 4N14A 2Z2OA 3F3FA 4X61B 5HE3B 4A08A 3N0EA 5HYNB 4U7AA 3I7OA 1SQ9A 3IKOA 3FGBA 5EMJB 3NVNA 4XYIA 4GGCA 3JZGA 3ORVD 3EI4A 4J82A 5GSAA 4A08B 2H47A 2AGWA 3C5MA 1K32A 2YMUA 1JMZB 4Y5RD 3DXMC 4J78A 1FWXA 4CI2A 1JJUB 3RFGA 3AH8B 2HXCA 3EI4B 5H1MA 5HE1B 3UVOA 4JSNC 4L1QD 4J8BA 2CO0C 2CO0A 2IWKA 3ODTA 2OK4A 5AMSA 5HQGA 2IUVA 4J79A 4L3HD 4QRJA 2OK6A 3AFCA 4K3ID 3SLED 2H3XA 3L4MD 4JT6C 3PXTD 3RFHA 2GC4A 3JB9L 2PM9A 1U4CA 4PC0A 4XEIC 4OZUA 4ERQA 2XYIA 4EWRA 3JZHA 2H14A 2P9IC 1B9YA 1TYQC 3IJ1A 1GXRA 2H13A 5K19A 3PSLA 2PM9B 3E0CA 4GQ2P 2IURA 3PXWD 1VYHC 3C99A 3EMHA 3IIYA 2P9NC 3F3PA 1JMXB 3PVUB 1MG2A 3NVXA 5I5IA 2QC5A 4J73A 5IGQA 4U1EI 3UVNA 4O3UB 4CZVA 5EAPA 2CE9A 3K26A 4CI8A 5EMKB 1L0QA 2H6QA 2HJ4A 4J84A 3RN0D 5A2Qg 4JD2C 4MK0B 5H17A 4PNKB 4AEZA 3MZKA 4FHLA 2BBKH 3I7LA 2CE8A 1K8KC 1XKSA 3OKYB 3KRWB 5GMKn 2OVRB 3FRXA 5FA5B 3PE7A 5FXYA 3UKRC 4X63B 4J81A 2J55H 4ZOVA 2I3TA 3UR4A 4A09A 3BG0A 5FKTA 4PBYA 2YBAA 3I8CA 5IC7A 3UVKA 4JT5C 5EAMA 3GREA 5TEEA 3RLMD 2QXVA 4XYHA 3SN6B 1XIPA 4A09B 3W15A 4O45A 3HFQA 4FWWA 3SBQA 5EMMB 5KDOB 2Z2PA 2I0RA 3SMRA 3EU7A 4BUJC 4ZOYA 4BL0A 3V5WB 2CN2A 2GC7A 3SXTD 1GG2B 2YNNA 4KFMB 4J86A 2AGZA 1ERJA 3ULEC 2YNPA 5C9ZB 2HYEA 4D6VA 1RI6A 4CZYA 4ESGA 4ZN4A 1MG3A 3I7HA 4GM9A 1JOFA 2O9KA 4LG9A 4FB1D 3SWSD 1N6EA 3I2NA 4X3EA 1TBGA 4A7JA 3CFVA 2AGXA 4H5IA 3SFZA 5EMLB 2B4EA 4J77A 2XL2A 4BH6A 2IUQA 3NVQA 3UVLA 3V9FA 1PBYB 4A0AA 3VA6A 3OTTA 4YVDA 4ZOXA 2GNQA 3J80g 2AH1A 3F3GA 5GXHA 4FAVD 3EI2A 2AQ5A 4J8GA 4O3TB 4A0AB 4FA9D 3N0DA 4GGDA 2UZYB 4TZ4A 1N6FA 2Z2NA 4G56B 3EI2B 1GP2B 5HE0B 5C2WB 4Y7RA 2P9LC 4ES0A 1PEVA 3JROA 2B5MA 2CNXA 1OMWB 4CY5A 4CI3A 2H68A 3KRXB 4J0XA 4L9OA 3PXSD 3EI3A 3JZNA 5AJAA 2AH0A 5K1CC 3FM0A 5CXBA 2HKRA 2IUPA 2HJBA 2OVPB 1GOTB 4J87A 4JSPC 2UZXB 4QQEA 3EI3B 5CXBB 2G9AA 4A11A 5GXIA 3JRPA 3AL9A 3DXKC 1MDAH 4PBZA 2J56H 3DM0A 5EARA 2XL3A 3IJ0A 2H9LA 4GMBA 4GQBB 3I89A 4IMMA 2H6NA 2AGLA 4FA4D 2Q7QA 2HESX 4GM3A 3OW8A 4K3JB 4A11B 4GGAA 1S4UX 3MMYA 4GZ8A 2B5NA 1SHYB 1NR0A 4ERYA 3U4YA 3RSEC 4LGNA 3JPXA 3PSCB 5FKSA 4NSXA 4A2LA 2MTAH 3EG6A 5FKQA 2J57G 5TF2A 3BG1A 1OLZA 3PVWB 5SXMA 4E54A 3AL8A 4CZXA 3BWSA 2H9PA 2W18A 5THAA 2H6KA 4I79A 5I5MA 4ZOZA 5HE2B 3SCYA 4E54B 1A0RB 2BCJB 5FQDA 3SBPA 2OVQB 3AL8B 4FAND 1NEXB 2XU7A 2YNOA 3DSMA 4PSWB 3VGZA 3I7KA 3MXXA 5IT9g 2G99A 4A0BA 4IA9A 1P22A 3GFCA 4PXWA 4CY1A 5CXCA 4JXMA 5FKRA 4D0KA 3SBRA 2OJYA 1XHMA 2P9KC 5C2VB 2H9NA 3SVWD 4A0BB 2TRCB 4O1QD 4CY3A 5CXCB 3IIWA 4LG8A 1R5MA 4PSXB 2CN3A 4GQ1A 3RMZD 3I8EA 3L4OD 3V7DB 3MKQA 3JAMg 4Z8LA 4O9DA 2PM6B 5B4WA 5IGOA 4R7AB 3K27A 3DWLC 4CY2A 3C75H 4QT8A 1SQJA 3SJLD 4ERZA 4H5JA 5H14A 3SHFA 4L3GD 5IJ8E 1U2VC 4CC9A 3MKSB 3RRMC 1PI6A 3EI1A 2PM7B 4UI9R 4X60B 3UKUC 3C9CA 2HKMA 4GM8A 3J81g 2H9MA 2IWFA 4FA5D 5FLXg 5JWZA 4OWRA 3UVMA 5AFU3 5CYKA 3I7NA 3EI1B 2AGYA 3B7FA 3P4FA 4JSVC 5EALA 3RN1D 5IJ7E 5TEFA 4A2MA 2IAAA 3CFSB 4QL1A 1PGUA 4E5ZA 2P9PC 2I0SA 3OKYA 1Q47A 3A0FA 4CI1A 3OL2A 5EM2A 5CYKB 2EBSA 4HDJA 5I5JA 1B9XA 4E5ZB 4FA1D 3MZLA 3OKWA 2PBIB 2P9SC 5TDHB 4AOWA 2I3SA 3I7PA 3OL2B 2OIZA 3EWEA 4J0WA 5EM2B 2I0TA 3IJCA 1N6DA 1YFQA 3CIKB 2P9UC 3OKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5L A;  3VH0 A;  4JSX C;  1QNI A;  3ZWL B;  2YB8 B;  4N14 A;  2Z2O A;  3F3F A;  4X61 B;  5HE3 B;  4A08 A;  3N0E A;  5HYN B;  4U7A A;  3I7O A;  1SQ9 A;  3IKO A;  3FGB A;  5EMJ B;  3NVN A;  4XYI A;  4GGC A;  3JZG A;  3ORV D;  3EI4 A;  4J82 A;  5GSA A;  4A08 B;  2H47 A;  2AGW A;  3C5M A;  1K32 A;  2YMU A;  1JMZ B;  4Y5R D;  3DXM C;  4J78 A;  1FWX A;  4CI2 A;  1JJU B;  3RFG A;  3AH8 B;  2HXC A;  3EI4 B;  5H1M A;  5HE1 B;  3UVO A;  4JSN C;  4L1Q D;  4J8B A;  2CO0 C;  2CO0 A;  2IWK A;  3ODT A;  2OK4 A;  5AMS A;  5HQG A;  2IUV A;  4J79 A;  4L3H D;  4QRJ A;  2OK6 A;  3AFC A;  4K3I D;  3SLE D;  2H3X A;  3L4M D;  4JT6 C;  3PXT D;  3RFH A;  2GC4 A;  3JB9 L;  2PM9 A;  1U4C A;  4PC0 A;  4XEI C;  4OZU A;  4ERQ A;  2XYI A;  4EWR A;  3JZH A;  2H14 A;  2P9I C;  1B9Y A;  1TYQ C;  3IJ1 A;  1GXR A;  2H13 A;  5K19 A;  3PSL A;  2PM9 B;  3E0C A;  4GQ2 P;  2IUR A;  3PXW D;  1VYH C;  3C99 A;  3EMH A;  3IIY A;  2P9N C;  3F3P A;  1JMX B;  3PVU B;  1MG2 A;  3NVX A;  5I5I A;  2QC5 A;  4J73 A;  5IGQ A;  4U1E I;  3UVN A;  4O3U B;  4CZV A;  5EAP A;  2CE9 A;  3K26 A;  4CI8 A;  5EMK B;  1L0Q A;  2H6Q A;  2HJ4 A;  4J84 A;  3RN0 D;  5A2Q g;  4JD2 C;  4MK0 B;  5H17 A;  4PNK B;  4AEZ A;  3MZK A;  4FHL A;  2BBK H;  3I7L A;  2CE8 A;  1K8K C;  1XKS A;  3OKY B;  3KRW B;  5GMK n;  2OVR B;  3FRX A;  5FA5 B;  3PE7 A;  5FXY A;  3UKR C;  4X63 B;  4J81 A;  2J55 H;  4ZOV A;  2I3T A;  3UR4 A;  4A09 A;  3BG0 A;  5FKT A;  4PBY A;  2YBA A;  3I8C A;  5IC7 A;  3UVK A;  4JT5 C;  5EAM A;  3GRE A;  5TEE A;  3RLM D;  2QXV A;  4XYH A;  3SN6 B;  1XIP A;  4A09 B;  3W15 A;  4O45 A;  3HFQ A;  4FWW A;  3SBQ A;  5EMM B;  5KDO B;  2Z2P A;  2I0R A;  3SMR A;  3EU7 A;  4BUJ C;  4ZOY A;  4BL0 A;  3V5W B;  2CN2 A;  2GC7 A;  3SXT D;  1GG2 B;  2YNN A;  4KFM B;  4J86 A;  2AGZ A;  1ERJ A;  3ULE C;  2YNP A;  5C9Z B;  2HYE A;  4D6V A;  1RI6 A;  4CZY A;  4ESG A;  4ZN4 A;  1MG3 A;  3I7H A;  4GM9 A;  1JOF A;  2O9K A;  4LG9 A;  4FB1 D;  3SWS D;  1N6E A;  3I2N A;  4X3E A;  1TBG A;  4A7J A;  3CFV A;  2AGX A;  4H5I A;  3SFZ A;  5EML B;  2B4E A;  4J77 A;  2XL2 A;  4BH6 A;  2IUQ A;  3NVQ A;  3UVL A;  3V9F A;  1PBY B;  4A0A A;  3VA6 A;  3OTT A;  4YVD A;  4ZOX A;  2GNQ A;  3J80 g;  2AH1 A;  3F3G A;  5GXH A;  4FAV D;  3EI2 A;  2AQ5 A;  4J8G A;  4O3T B;  4A0A B;  4FA9 D;  3N0D A;  4GGD A;  2UZY B;  4TZ4 A;  1N6F A;  2Z2N A;  4G56 B;  3EI2 B;  1GP2 B;  5HE0 B;  5C2W B;  4Y7R A;  2P9L C;  4ES0 A;  1PEV A;  3JRO A;  2B5M A;  2CNX A;  1OMW B;  4CY5 A;  4CI3 A;  2H68 A;  3KRX B;  4J0X A;  4L9O A;  3PXS D;  3EI3 A;  3JZN A;  5AJA A;  2AH0 A;  5K1C C;  3FM0 A;  5CXB A;  2HKR A;  2IUP A;  2HJB A;  2OVP B;  1GOT B;  4J87 A;  4JSP C;  2UZX B;  4QQE A;  3EI3 B;  5CXB B;  2G9A A;  4A11 A;  5GXI A;  3JRP A;  3AL9 A;  3DXK C;  1MDA H;  4PBZ A;  2J56 H;  3DM0 A;  5EAR A;  2XL3 A;  3IJ0 A;  2H9L A;  4GMB A;  4GQB B;  3I89 A;  4IMM A;  2H6N A;  2AGL A;  4FA4 D;  2Q7Q A;  2HES X;  4GM3 A;  3OW8 A;  4K3J B;  4A11 B;  4GGA A;  1S4U X;  3MMY A;  4GZ8 A;  2B5N A;  1SHY B;  1NR0 A;  4ERY A;  3U4Y A;  3RSE C;  4LGN A;  3JPX A;  3PSC B;  5FKS A;  4NSX A;  4A2L A;  2MTA H;  3EG6 A;  5FKQ A;  2J57 G;  5TF2 A;  3BG1 A;  1OLZ A;  3PVW B;  5SXM A;  4E54 A;  3AL8 A;  4CZX A;  3BWS A;  2H9P A;  2W18 A;  5THA A;  2H6K A;  4I79 A;  5I5M A;  4ZOZ A;  5HE2 B;  3SCY A;  4E54 B;  1A0R B;  2BCJ B;  5FQD A;  3SBP A;  2OVQ B;  3AL8 B;  4FAN D;  1NEX B;  2XU7 A;  2YNO A;  3DSM A;  4PSW B;  3VGZ A;  3I7K A;  3MXX A;  5IT9 g;  2G99 A;  4A0B A;  4IA9 A;  1P22 A;  3GFC A;  4PXW A;  4CY1 A;  5CXC A;  4JXM A;  5FKR A;  4D0K A;  3SBR A;  2OJY A;  1XHM A;  2P9K C;  5C2V B;  2H9N A;  3SVW D;  4A0B B;  2TRC B;  4O1Q D;  4CY3 A;  5CXC B;  3IIW A;  4LG8 A;  1R5M A;  4PSX B;  2CN3 A;  4GQ1 A;  3RMZ D;  3I8E A;  3L4O D;  3V7D B;  3MKQ A;  3JAM g;  4Z8L A;  4O9D A;  2PM6 B;  5B4W A;  5IGO A;  4R7A B;  3K27 A;  3DWL C;  4CY2 A;  3C75 H;  4QT8 A;  1SQJ A;  3SJL D;  4ERZ A;  4H5J A;  5H14 A;  3SHF A;  4L3G D;  5IJ8 E;  1U2V C;  4CC9 A;  3MKS B;  3RRM C;  1PI6 A;  3EI1 A;  2PM7 B;  4UI9 R;  4X60 B;  3UKU C;  3C9C A;  2HKM A;  4GM8 A;  3J81 g;  2H9M A;  2IWF A;  4FA5 D;  5FLX g;  5JWZ A;  4OWR A;  3UVM A;  5AFU 3;  5CYK A;  3I7N A;  3EI1 B;  2AGY A;  3B7F A;  3P4F A;  4JSV C;  5EAL A;  3RN1 D;  5IJ7 E;  5TEF A;  4A2M A;  2IAA A;  3CFS B;  4QL1 A;  1PGU A;  4E5Z A;  2P9P C;  2I0S A;  3OKY A;  1Q47 A;  3A0F A;  4CI1 A;  3OL2 A;  5EM2 A;  5CYK B;  2EBS A;  4HDJ A;  5I5J A;  1B9X A;  4E5Z B;  4FA1 D;  3MZL A;  3OKW A;  2PBI B;  2P9S C;  5TDH B;  4AOW A;  2I3S A;  3I7P A;  3OL2 B;  2OIZ A;  3EWE A;  4J0W A;  5EM2 B;  2I0T A;  3IJC A;  1N6D A;  1YFQ A;  3CIK B;  2P9U C;  3OKT A; 
#chains in the Genus database with same CATH topology
 2B5L A;  2VDM A;  3VH0 A;  4JSX C;  5FFG A;  1QNI A;  3ZWL B;  2YB8 B;  4N14 A;  2Z2O A;  3F3F A;  4X61 B;  5HE3 B;  4A08 A;  1H2Z A;  1O6G A;  3GD1 I;  3N0E A;  5HYN B;  4U7A A;  3I7O A;  1SQ9 A;  3IKO A;  3QHY B;  3FGB A;  5EMJ B;  3NVN A;  4XYI A;  4GGC A;  3O4G A;  3JZG A;  3ORV D;  3EI4 A;  4J82 A;  5GSA A;  4Z7O A;  4A08 B;  2H47 A;  2AGW A;  4DNV A;  3C5M A;  1K32 A;  2YMU A;  1M1X A;  1JMZ B;  3NIG A;  4Y5R D;  3DXM C;  4BCC A;  4AN1 A;  4DNW A;  4J78 A;  1FWX A;  4CI2 A;  1JJU B;  3RFG A;  3AH8 B;  2HXC A;  1UOO A;  3EI4 B;  5H1M A;  5HE1 B;  3UVO A;  4JSN C;  2VDR A;  4NC4 A;  4G55 A;  1JV2 A;  4L1Q D;  4J8B A;  2CO0 C;  2CO0 A;  2IWK A;  3ODT A;  2OK4 A;  5AMS A;  5HQG A;  2IUV A;  4J79 A;  3GC3 B;  4L3H D;  4QRJ A;  1I2M B;  1L5G A;  2OK6 A;  3AFC A;  4K3I D;  4Z7Q A;  3SLE D;  2H3X A;  3L4M D;  4JT6 C;  3PXT D;  1GOF A;  3RFH A;  2GC4 A;  3JB9 L;  2PM9 A;  1U4C A;  4PC0 A;  4XEI C;  4OZU A;  4ERQ A;  2XYI A;  4EWR A;  3JZH A;  3MVD K;  2H14 A;  4MMY A;  4UM9 A;  2JKX A;  2P9I C;  1B9Y A;  1TYQ C;  4AX4 A;  4AMY A;  3IJ1 A;  1GXR A;  4L1M A;  2H13 A;  5K19 A;  3PSL A;  2PM9 B;  1GOG A;  5C86 A;  3E0C A;  4GQ2 P;  2IUR A;  3PXW D;  1VYH C;  3C99 A;  3EMH A;  3IIY A;  2VDN A;  2P9N C;  3F3P A;  1JMX B;  3PVU B;  1MG2 A;  3NID A;  3NVX A;  5I5I A;  2QC5 A;  1VE6 A;  3OF7 A;  2QZP A;  3O4H A;  4J73 A;  5IGQ A;  4U1E I;  3UVN A;  4O3U B;  4CZV A;  5EAP A;  1VE7 A;  2CE9 A;  3K26 A;  3ZE2 A;  4CI8 A;  5EMK B;  1L0Q A;  2H6Q A;  2HJ4 A;  4J84 A;  3RN0 D;  3IJE A;  3IUJ A;  5A2Q g;  4JD2 C;  4MK0 B;  3EQ7 A;  5H17 A;  4PNK B;  4WJK A;  4AEZ A;  3MZK A;  4NAA A;  3O4I A;  4FHL A;  2BBK H;  3I7L A;  2CE8 A;  1K8K C;  4UM8 A;  1XKS A;  3OKY B;  3KRW B;  5GMK n;  2OVR B;  3FRX A;  4G1M A;  5E6R A;  5FA5 B;  3FCS A;  1C9I A;  3PE7 A;  5FXY A;  3UKR C;  4X63 B;  4J81 A;  2J55 H;  2VZ3 A;  4G1E A;  4ZOV A;  2I3T A;  3UR4 A;  4A09 A;  3BG0 A;  4JHP C;  5FKT A;  4PBY A;  4MMZ A;  2YBA A;  3I8C A;  5IC7 A;  4Z7N A;  3DDU A;  4BCD A;  3UVK A;  4JT5 C;  5M5U A;  1K3I A;  5EAM A;  3GRE A;  1H2Y A;  2VDL A;  5TEE A;  2VDO A;  3MUN A;  3RLM D;  2QXV A;  3K72 A;  4XYH A;  3SN6 B;  1XIP A;  4A09 B;  3W15 A;  4O45 A;  3HFQ A;  4FWW A;  3SBQ A;  5EMM B;  5KDO B;  2Z2P A;  2I0R A;  3SMR A;  3EU7 A;  4BUJ C;  4ZOY A;  4BL0 A;  3V5W B;  2CN2 A;  2GC7 A;  3SXT D;  1UOQ A;  1GG2 B;  1E5T A;  2YNN A;  4KFM B;  4J86 A;  4O02 A;  2AGZ A;  1ERJ A;  3ULE C;  2HU7 A;  2YNP A;  5C9Z B;  3IVM A;  2HYE A;  4D6V A;  1RI6 A;  4CZY A;  4ESG A;  1GOH A;  4ZN4 A;  1MG3 A;  3I7H A;  4GM9 A;  2HU8 A;  1JOF A;  2O9K A;  4LG9 A;  4FB1 D;  3SWS D;  4AN0 A;  1N6E A;  3I2N A;  4X3E A;  1TBG A;  4A7J A;  1JTD B;  3CFV A;  2AGX A;  3EQ8 A;  3KCI A;  4H5I A;  3SFZ A;  5EML B;  2B4E A;  4J77 A;  2XL2 A;  4BH6 A;  4RE5 A;  2IUQ A;  3NVQ A;  3UVL A;  3V9F A;  1PBY B;  4A0A A;  3VA6 A;  3OTT A;  4YVD A;  3ZE0 A;  4ZOX A;  2GNQ A;  4WK2 A;  3J80 g;  2AH1 A;  1E8N A;  1TYE A;  3F3G A;  5GXH A;  4FAV D;  3EI2 A;  4DNU A;  2AQ5 A;  1A12 A;  4J8G A;  4QAM A;  3VI3 A;  4O3T B;  4A0A B;  4FA9 D;  3N0D A;  4AMZ A;  4GGD A;  2UZY B;  4TZ4 A;  1N6F A;  2Z2N A;  5M5V A;  4G56 B;  3EI2 B;  1GP2 B;  3MUO A;  5HE0 B;  3IUR A;  5C2W B;  4RE6 A;  4Y7R A;  2XDW A;  4BCB A;  3K6S A;  2P9L C;  4ES0 A;  1PEV A;  2EIE A;  3JRO A;  4NEN A;  2B5M A;  2CNX A;  4BP9 A;  1QFM A;  1OMW B;  4CY5 A;  2XE4 A;  4CI3 A;  2H68 A;  3KRX B;  4J0X A;  4L9O A;  2VC2 A;  5C92 A;  3K71 A;  3PXS D;  3EI3 A;  3JZN A;  5AJA A;  2AH0 A;  5K1C C;  3FM0 A;  3O4J A;  5CXB A;  1YR2 A;  2HKR A;  2BKL A;  2IUP A;  2HJB A;  2OVP B;  3ZDY A;  1VZ3 A;  2HU5 A;  4O2W A;  1GOT B;  4J87 A;  3ZDZ A;  4JSP C;  3IUN A;  2UZX B;  4QQE A;  3EI3 B;  5CXB B;  2G9A A;  2QR5 A;  4A11 A;  5GXI A;  3JRP A;  3AL9 A;  3DXK C;  1MDA H;  1C9L A;  4PBZ A;  2J56 H;  2XZG A;  3DM0 A;  5EAR A;  4JHN A;  2XL3 A;  3IJ0 A;  2H9L A;  4GMB A;  4GQB B;  3I89 A;  4IMM A;  2H6N A;  2AGL A;  3VI4 A;  4FA4 D;  2Q7Q A;  3IUL A;  1E8M A;  2HES X;  4GM3 A;  3OW8 A;  4K3J B;  5M61 A;  4A11 B;  4GGA A;  1S4U X;  3MMY A;  4GZ8 A;  2EIC A;  2B5N A;  5M5S A;  1SHY B;  1NR0 A;  4ERY A;  3NIF A;  3U4Y A;  3RSE C;  4LGN A;  3JPX A;  3PSC B;  5FKS A;  1O6F A;  4NSX A;  4A2L A;  2MTA H;  3EG6 A;  5FKQ A;  3ZE1 A;  2J57 G;  5TF2 A;  3BG1 A;  1OLZ A;  3PVW B;  5SXM A;  4E54 A;  3AL8 A;  4CZX A;  3BWS A;  2H9P A;  2W18 A;  5THA A;  2H6K A;  4I79 A;  5I5M A;  4ZOZ A;  5HE2 B;  3SCY A;  2VDK A;  4E54 B;  1A0R B;  2BCJ B;  5FQD A;  3SBP A;  2OVQ B;  3V4P A;  3AL8 B;  4FAN D;  3QI0 A;  3EQ9 A;  1NEX B;  2XU7 A;  2WQ8 A;  2YNO A;  1T2X A;  3DSM A;  4PSW B;  3I7K A;  3MXX A;  3VGZ A;  5IT9 g;  2G99 A;  4A0B A;  4IA9 A;  1P22 A;  3GFC A;  4PXW A;  4CY1 A;  5CXC A;  4JXM A;  1BPO A;  3T3M A;  5FKR A;  4D0K A;  5HDB A;  3SBR A;  2OJY A;  1XHM A;  2P9K C;  5C2V B;  2H9N A;  3SVW D;  4A0B B;  2TRC B;  4O1Q D;  3V4V A;  4CY3 A;  5CXC B;  3IIW A;  4LG8 A;  5M5T A;  1R5M A;  3FCU A;  4PSX B;  2CN3 A;  4GQ1 A;  2EID A;  3RMZ D;  3I8E A;  3L4O D;  3V7D B;  3MKQ A;  3JAM g;  4Z8L A;  4NBM A;  4O9D A;  2PM6 B;  5B4W A;  5IGO A;  4R7A B;  3K27 A;  4WK4 A;  3DWL C;  5M5R A;  4CY2 A;  4WK0 A;  3C75 H;  1UTC A;  1SQJ A;  4QT8 A;  3SJL D;  4ERZ A;  2VDP A;  4H5J A;  2EIB A;  5H14 A;  3SHF A;  4L3G D;  5IJ8 E;  1U2V C;  4CC9 A;  3MKS B;  3RRM C;  1PI6 A;  3EI1 A;  2PM7 B;  4UI9 R;  4X60 B;  3UKU C;  3C9C A;  2VZ1 A;  2VDQ A;  2HKM A;  4GM8 A;  3J81 g;  1QFS A;  2H9M A;  1UOP A;  2IWF A;  4BP8 A;  4FA5 D;  3IUQ A;  5FLX g;  5JWZ A;  4OWR A;  3UVM A;  5AFU 3;  1H2X A;  5CYK A;  4D9S A;  3I7N A;  3EI1 B;  2AGY A;  3B7F A;  3P4F A;  4JSV C;  5EAL A;  3RN1 D;  5IJ7 E;  5TEF A;  4A2M A;  2IAA A;  3CFS B;  4QL1 A;  1PGU A;  4E5Z A;  2P9P C;  3T3P A;  2I0S A;  4IRZ A;  3OKY A;  1Q47 A;  3A0F A;  4CI1 A;  3OL2 A;  5EM2 A;  5CYK B;  2EBS A;  4HDJ A;  1H2W A;  5I5J A;  5E6U A;  1B9X A;  4E5Z B;  4FA1 D;  3MZL A;  3OKW A;  3IUM A;  2PBI B;  2P9S C;  5TDH B;  4AOW A;  2I3S A;  3I7P A;  4MMX A;  3OL2 B;  5FFO A;  2OIZ A;  3EWE A;  4J0W A;  5EM2 B;  2I0T A;  3IJC A;  1U8C A;  1N6D A;  3ZDX A;  1YFQ A;  3CIK B;  2P9U C;  1VZ2 A;  5E6S A;  3OKT A; 
#chains in the Genus database with same CATH homology
 2B5L A;  3VH0 A;  4JSX C;  1QNI A;  3ZWL B;  2YB8 B;  4N14 A;  2Z2O A;  3F3F A;  4X61 B;  5HE3 B;  4A08 A;  3N0E A;  5HYN B;  4U7A A;  3I7O A;  1SQ9 A;  3IKO A;  3FGB A;  5EMJ B;  3NVN A;  4XYI A;  4GGC A;  3JZG A;  3ORV D;  3EI4 A;  4J82 A;  5GSA A;  4A08 B;  2H47 A;  2AGW A;  3C5M A;  1K32 A;  2YMU A;  1JMZ B;  4Y5R D;  3DXM C;  4J78 A;  1FWX A;  4CI2 A;  1JJU B;  3RFG A;  3AH8 B;  2HXC A;  3EI4 B;  5H1M A;  5HE1 B;  3UVO A;  4JSN C;  4L1Q D;  4J8B A;  2CO0 C;  2CO0 A;  2IWK A;  3ODT A;  2OK4 A;  5AMS A;  5HQG A;  2IUV A;  4J79 A;  4L3H D;  4QRJ A;  2OK6 A;  3AFC A;  4K3I D;  3SLE D;  2H3X A;  3L4M D;  4JT6 C;  3PXT D;  3RFH A;  2GC4 A;  3JB9 L;  2PM9 A;  1U4C A;  4PC0 A;  4XEI C;  4OZU A;  4ERQ A;  2XYI A;  4EWR A;  3JZH A;  2H14 A;  2P9I C;  1B9Y A;  1TYQ C;  3IJ1 A;  1GXR A;  2H13 A;  5K19 A;  3PSL A;  2PM9 B;  3E0C A;  4GQ2 P;  2IUR A;  3PXW D;  1VYH C;  3C99 A;  3EMH A;  3IIY A;  2P9N C;  3F3P A;  1JMX B;  3PVU B;  1MG2 A;  3NVX A;  5I5I A;  2QC5 A;  4J73 A;  5IGQ A;  4U1E I;  3UVN A;  4O3U B;  4CZV A;  5EAP A;  2CE9 A;  3K26 A;  4CI8 A;  5EMK B;  1L0Q A;  2H6Q A;  2HJ4 A;  4J84 A;  3RN0 D;  5A2Q g;  4JD2 C;  4MK0 B;  5H17 A;  4PNK B;  4AEZ A;  3MZK A;  4FHL A;  2BBK H;  3I7L A;  2CE8 A;  1K8K C;  1XKS A;  3OKY B;  3KRW B;  5GMK n;  2OVR B;  3FRX A;  5FA5 B;  3PE7 A;  5FXY A;  3UKR C;  4X63 B;  4J81 A;  2J55 H;  4ZOV A;  2I3T A;  3UR4 A;  4A09 A;  3BG0 A;  5FKT A;  4PBY A;  2YBA A;  3I8C A;  5IC7 A;  3UVK A;  4JT5 C;  5EAM A;  3GRE A;  5TEE A;  3RLM D;  2QXV A;  4XYH A;  3SN6 B;  1XIP A;  4A09 B;  3W15 A;  4O45 A;  3HFQ A;  4FWW A;  3SBQ A;  5EMM B;  5KDO B;  2Z2P A;  2I0R A;  3SMR A;  3EU7 A;  4BUJ C;  4ZOY A;  4BL0 A;  3V5W B;  2CN2 A;  2GC7 A;  3SXT D;  1GG2 B;  2YNN A;  4KFM B;  4J86 A;  2AGZ A;  1ERJ A;  3ULE C;  2YNP A;  5C9Z B;  2HYE A;  4D6V A;  1RI6 A;  4CZY A;  4ESG A;  4ZN4 A;  1MG3 A;  3I7H A;  4GM9 A;  1JOF A;  2O9K A;  4LG9 A;  4FB1 D;  3SWS D;  1N6E A;  3I2N A;  4X3E A;  1TBG A;  4A7J A;  3CFV A;  2AGX A;  4H5I A;  3SFZ A;  5EML B;  2B4E A;  4J77 A;  2XL2 A;  4BH6 A;  2IUQ A;  3NVQ A;  3UVL A;  3V9F A;  1PBY B;  4A0A A;  3VA6 A;  3OTT A;  4YVD A;  4ZOX A;  2GNQ A;  3J80 g;  2AH1 A;  3F3G A;  5GXH A;  4FAV D;  3EI2 A;  2AQ5 A;  4J8G A;  4O3T B;  4A0A B;  4FA9 D;  3N0D A;  4GGD A;  2UZY B;  4TZ4 A;  1N6F A;  2Z2N A;  4G56 B;  3EI2 B;  1GP2 B;  5HE0 B;  5C2W B;  4Y7R A;  2P9L C;  4ES0 A;  1PEV A;  3JRO A;  2B5M A;  2CNX A;  1OMW B;  4CY5 A;  4CI3 A;  2H68 A;  3KRX B;  4J0X A;  4L9O A;  3PXS D;  3EI3 A;  3JZN A;  5AJA A;  2AH0 A;  5K1C C;  3FM0 A;  5CXB A;  2HKR A;  2IUP A;  2HJB A;  2OVP B;  1GOT B;  4J87 A;  4JSP C;  2UZX B;  4QQE A;  3EI3 B;  5CXB B;  2G9A A;  4A11 A;  5GXI A;  3JRP A;  3AL9 A;  3DXK C;  1MDA H;  4PBZ A;  2J56 H;  3DM0 A;  5EAR A;  2XL3 A;  3IJ0 A;  2H9L A;  4GMB A;  4GQB B;  3I89 A;  4IMM A;  2H6N A;  2AGL A;  4FA4 D;  2Q7Q A;  2HES X;  4GM3 A;  3OW8 A;  4K3J B;  4A11 B;  4GGA A;  1S4U X;  3MMY A;  4GZ8 A;  2B5N A;  1SHY B;  1NR0 A;  4ERY A;  3U4Y A;  3RSE C;  4LGN A;  3JPX A;  3PSC B;  5FKS A;  4NSX A;  4A2L A;  2MTA H;  3EG6 A;  5FKQ A;  2J57 G;  5TF2 A;  3BG1 A;  1OLZ A;  3PVW B;  5SXM A;  4E54 A;  3AL8 A;  4CZX A;  3BWS A;  2H9P A;  2W18 A;  5THA A;  2H6K A;  4I79 A;  5I5M A;  4ZOZ A;  5HE2 B;  3SCY A;  4E54 B;  1A0R B;  2BCJ B;  5FQD A;  3SBP A;  2OVQ B;  3AL8 B;  4FAN D;  1NEX B;  2XU7 A;  2YNO A;  3DSM A;  4PSW B;  3VGZ A;  3I7K A;  3MXX A;  5IT9 g;  2G99 A;  4A0B A;  4IA9 A;  1P22 A;  3GFC A;  4PXW A;  4CY1 A;  5CXC A;  4JXM A;  5FKR A;  4D0K A;  3SBR A;  2OJY A;  1XHM A;  2P9K C;  5C2V B;  2H9N A;  3SVW D;  4A0B B;  2TRC B;  4O1Q D;  4CY3 A;  5CXC B;  3IIW A;  4LG8 A;  1R5M A;  4PSX B;  2CN3 A;  4GQ1 A;  3RMZ D;  3I8E A;  3L4O D;  3V7D B;  3MKQ A;  3JAM g;  4Z8L A;  4O9D A;  2PM6 B;  5B4W A;  5IGO A;  4R7A B;  3K27 A;  3DWL C;  4CY2 A;  3C75 H;  4QT8 A;  1SQJ A;  3SJL D;  4ERZ A;  4H5J A;  5H14 A;  3SHF A;  4L3G D;  5IJ8 E;  1U2V C;  4CC9 A;  3MKS B;  3RRM C;  1PI6 A;  3EI1 A;  2PM7 B;  4UI9 R;  4X60 B;  3UKU C;  3C9C A;  2HKM A;  4GM8 A;  3J81 g;  2H9M A;  2IWF A;  4FA5 D;  5FLX g;  5JWZ A;  4OWR A;  3UVM A;  5AFU 3;  5CYK A;  3I7N A;  3EI1 B;  2AGY A;  3B7F A;  3P4F A;  4JSV C;  5EAL A;  3RN1 D;  5IJ7 E;  5TEF A;  4A2M A;  2IAA A;  3CFS B;  4QL1 A;  1PGU A;  4E5Z A;  2P9P C;  2I0S A;  3OKY A;  1Q47 A;  3A0F A;  4CI1 A;  3OL2 A;  5EM2 A;  5CYK B;  2EBS A;  4HDJ A;  5I5J A;  1B9X A;  4E5Z B;  4FA1 D;  3MZL A;  3OKW A;  2PBI B;  2P9S C;  5TDH B;  4AOW A;  2I3S A;  3I7P A;  3OL2 B;  2OIZ A;  3EWE A;  4J0W A;  5EM2 B;  2I0T A;  3IJC A;  1N6D A;  1YFQ A;  3CIK B;  2P9U C;  3OKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...