3SMRA

Crystal structure of human wd repeat domain 5 with compound
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
302
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Small-molecule inhibition of MLL activity by disruption of its interaction with WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 104
structure length 302
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3smrA00
2XL2A 4JSVC 5FQDA 1A0RB 4LGNA 4FA1D 4CZYA 2Z2OA 3I2NA 4XEIC 3FGBA 5CXBA 4YVDA 1Q47A 3RSEC 5IJ7E 2Q7QA 2GNQA 5TF2A 3RFHA 4MK0B 3UVNA 2I0RA 4BH6A 4O9DA 5HE1B 3OL2B 3ODTA 4A0AA 4A08A 5EALA 4CI3A 5HE0B 2H9PA 4QRJA 3GREA 3SBPA 3SVWD 5C2WB 4PNKB 3OTTA 3MZKA 2P9IC 3MKSB 5FKQA 2AH1A 2IUQA 2Z2PA 3AL9A 3N0EA 2QC5A 1GG2B 3JAMg 4D6VA 3EI2B 3C75H 3EMHA 5GMKn 3PXSD 1GOTB 5C2VB 5HE2B 3E0CA 2H3XA 3OKWA 1FWXA 3JZNA 2OVQB 3V9FA 4A0BA 4X61B 4J82A 3ZWLB 4ERZA 4CZXA 4J8GA 3OKTA 3AL8B 4CC9A 3EI1B 3NVQA 3ULEC 3PVWB 2XL3A 1ERJA 5C9ZB 3FM0A 3SMRA 2IWKA 3NVXA 3HFQA 3UKRC 2B5MA 2AGXA 2P9NC 2I3SA 2CN2A 2AH0A 5GSAA 2PM6B 5EM2B 5B4WA 4FA9D 3SWSD 5I5IA 3CFSB 3IKOA 5THAA 3J80g 4N14A 2OVRB 4QQEA 4L3HD 4PSXB 2B5LA 1XHMA 4Y7RA 2PM9B 3A0FA 3I8EA 3SN6B 3PSLA 5GXHA 4E5ZB 2GC7A 4GM3A 4JT5C 2H6NA 4J0WA 5AFU3 3OW8A 2CE9A 1OMWB 4GQBB 3I7PA 1RI6A 2MTAH 2HKRA 3JB9L 3V5WB 4R7AB 3UKUC 3N0DA 3UVOA 3UVLA 2AQ5A 4NSXA 3ORVD 2HJBA 4G56B 3IIYA 4GM9A 5EMLB 3SCYA 5AJAA 2CO0A 1GP2B 4J78A 4ZOXA 3EWEA 2IUPA 4GGCA 5A2Qg 3SBRA 3U4YA 1N6DA 5SXMA 4GQ2P 4CY1A 4ERYA 3RN0D 2IWFA 1N6FA 1R5MA 3JZGA 4BUJC 4JSNC 2IURA 1NR0A 5K19A 4QL1A 5CXCB 5FA5B 2PM7B 3F3FA 4JSXC 4OWRA 3MXXA 2H13A 5FKSA 1PI6A 5CXBB 2H14A 1U4CA 1JJUB 4D0KA 5IT9g 4E54B 1TYQC 5HQGA 3BG0A 3C5MA 4ZN4A 2AGYA 4CY5A 1JOFA 4PXWA 2HYEA 2H9NA 4FB1D 4FA4D 1OLZA 1VYHC 5KDOB 5CYKB 4A08B 3SHFA 5EMMB 2P9PC 4EWRA 2CNXA 4H5IA 2IUVA 4A11A 4CI2A 4PSWB 5K1CC 3VA6A 5FXYA 4PBZA 3OL2A 1TBGA 3KRXB 1NEXB 2QXVA 3C99A 4CZVA 3EI3B 1PEVA 5FKRA 3L4MD 2EBSA 4X63B 3F3PA 1JMZB 3SJLD 4Y5RD 4J77A 2XYIA 4A0BB 3RLMD 1SHYB 2HJ4A 2UZXB 3EI4B 4BL0A 3EI2A 5I5MA 2CN3A 2AGWA 4J86A 3PSCB 4J73A 4GMBA 5EAMA 3I7LA 3W15A 2OK6A 4FAVD 3EI1A 5EARA 4GZ8A 3IJCA 4O45A 1XKSA 1N6EA 3I7NA 5IGQA 4L3GD 5H14A 5IC7A 3RRMC 2YNNA 5EM2A 4O1QD 5FKTA 4PC0A 3VGZA 4XYIA 3DWLC 3I7HA 4GGAA 4L1QD 4ESGA 2H6QA 2AGZA 3L4OD 1PBYB 3OKYB 2H68A 2CE8A 5IJ8E 5TEEA 2PM9A 4XYHA 4E5ZA 4FAND 1MDAH 2OJYA 2HKMA 1SQ9A 5H1MA 4I79A 4A09B 4CY2A 5JWZA 3PXWD 3SLED 3DM0A 5HE3B 3GFCA 5TDHB 2Z2NA 3RMZD 3V7DB 3I7OA 1S4UX 2P9KC 2XU7A 4IMMA 3IJ1A 4GQ1A 3IJ0A 2B5NA 4X60B 2I0TA 3SXTD 4GGDA 3JROA 4GM8A 2H9LA 3BG1A 1PGUA 4JT6C 3P4FA 4J0XA 4ES0A 2H47A 4J81A 3MKQA 1MG2A 4K3JB 5CXCA 3K27A 1GXRA 4FWWA 5EMKB 2P9LC 3CFVA 4J8BA 2OIZA 4AOWA 4A0AB 3PVUB 2W18A 5TEFA 2CO0C 2J57G 3EU7A 4ZOZA 4E54A 3J81g 5EAPA 4J87A 2HXCA 4A11B 3UR4A 2G99A 4U1EI 1JMXB 3NVNA 3RN1D 2I0SA 1YFQA 4IA9A 1B9XA 5CYKA 2YNPA 4TZ4A 1K8KC 4U7AA 2P9UC 4O3UB 4A2LA 2H9MA 3K26A 4H5JA 4CI1A 2G9AA 3I89A 2H6KA 1B9YA 3EG6A 3EI3A 3UVKA 5FLXg 2BBKH 4J79A 4LG8A 4CY3A 1U2VC 2B4EA 3JPXA 3I8CA 2YMUA 4KFMB 4FA5D 2OK4A 3AL8A 3EI4A 4J84A 1MG3A 1QNIA 4JD2C 2PBIB 3BWSA 1P22A 2OVPB 5EMJB 2IAAA 4FHLA 3FRXA 3PE7A 3MMYA 4X3EA 3VH0A 5AMSA 4HDJA 2HESX 3JRPA 3B7FA 3IIWA 3DXMC 1XIPA 3SFZA 2O9KA 4LG9A 4ERQA 4CI8A 4A7JA 3DSMA 5I5JA 2J56H 5HYNB 2AGLA 4ZOYA 3KRWB 2YB8B 3PXTD 3SBQA 4Z8LA 3MZLA 3DXKC 4UI9R 5IGOA 2YNOA 3UVMA 2TRCB 3OKYA 1SQJA 2I3TA 3CIKB 2UZYB 5GXIA 4K3ID 3F3GA 4L9OA 4OZUA 3I7KA 2GC4A 3AH8B 1K32A 4PBYA 4O3TB 4AEZA 4QT8A 4A09A 3JZHA 2BCJB 4JSPC 2P9SC 2YBAA 1L0QA 3C9CA 3RFGA 3AFCA 4A2MA 2J55H 4JXMA 4ZOVA 5H17A
chains in the Genus database with same CATH superfamily
2XL2A 4JSVC 5FQDA 1A0RB 4BP9A 4LGNA 4FA1D 4CZYA 2Z2OA 4O2WA 3I2NA 4XEIC 2XZGA 3FGBA 1UOQA 5CXBA 2QZPA 1E8MA 4YVDA 1Q47A 3RSEC 5IJ7E 2Q7QA 2GNQA 5TF2A 3RFHA 4MK0B 3UVNA 4NC4A 2I0RA 4NBMA 4BH6A 4O9DA 5HE1B 3OL2B 3ODTA 4A0AA 3DDUA 5EALA 4CI3A 4A08A 5HE0B 2H9PA 4QRJA 3GREA 4Z7OA 3SBPA 3IUNA 3SVWD 5C2WB 3NIGA 4PNKB 2EIEA 3OTTA 3MZKA 3IUMA 2P9IC 3MKSB 5FKQA 2AH1A 2IUQA 2Z2PA 3AL9A 3N0EA 2QC5A 1GG2B 3JAMg 4D6VA 3EI2B 3ZDYA 3C75H 2VDLA 3EMHA 5GMKn 3PXSD 1GOTB 5C2VB 3QHYB 5HE2B 3E0CA 3V4VA 2H3XA 3OKWA 1C9IA 1FWXA 3JZNA 2OVQB 4WK2A 3V9FA 4A0BA 4X61B 4J82A 3ZWLB 4ERZA 4CZXA 4J8GA 3OKTA 3AL8B 4CC9A 3EI1B 3NVQA 3ULEC 3PVWB 2XL3A 1H2XA 2HU7A 1ERJA 4JHNA 3IVMA 5C9ZB 3FM0A 3SMRA 2IWKA 3NVXA 3HFQA 3UKRC 1O6FA 2B5MA 2AGXA 4WJKA 2P9NC 2I3SA 2CN2A 2AH0A 5GSAA 2PM6B 5EM2B 5B4WA 4DNVA 4AMYA 4FA9D 3SWSD 5E6SA 5I5IA 3CFSB 3IKOA 5THAA 3J80g 4N14A 2OVRB 4QQEA 4L3HD 3K6SA 4PSXB 3K72A 2B5LA 4G1MA 1XHMA 4Y7RA 1M1XA 1QFMA 2PM9B 3A0FA 3I8EA 3SN6B 4AN1A 3K71A 3PSLA 5GXHA 4E5ZB 2GC7A 4GM3A 4JT5C 2VDPA 2H6NA 2WQ8A 3MUNA 3FCUA 4J0WA 5AFU3 2VDMA 3GD1I 3OW8A 4BCCA 2CE9A 2VDNA 1OMWB 4GQBB 3I7PA 1RI6A 1GOHA 4AX4A 2MTAH 1H2WA 2HKRA 3JB9L 3ZDXA 3V5WB 4R7AB 3UKUC 3N0DA 3UVOA 3UVLA 2AQ5A 4NSXA 3ORVD 2HJBA 4G56B 4G1EA 3IIYA 4GM9A 3EQ7A 5EMLB 3SCYA 5AJAA 3V4PA 2CO0A 4WK0A 1UOPA 1VZ2A 1GP2B 4J78A 4ZOXA 3EWEA 2IUPA 4GGCA 5A2Qg 3SBRA 3U4YA 1N6DA 5SXMA 4GQ2P 4CY1A 4ERYA 3RN0D 2IWFA 3O4JA 1N6FA 1R5MA 3JZGA 4AMZA 3VI4A 4BUJC 2BKLA 4JSNC 2IURA 1NR0A 5K19A 4QL1A 5CXCB 5FA5B 4BCDA 5M5VA 2PM7B 3F3FA 4JSXC 5M5RA 4OWRA 3MXXA 4Z7NA 2H13A 5FKSA 1PI6A 5CXBB 1T2XA 2H14A 3ZDZA 1U4CA 2VC2A 1JJUB 1C9LA 4D0KA 4O02A 5IT9g 4E54B 1TYQC 5HQGA 3BG0A 3C5MA 4ZN4A 2AGYA 4CY5A 1JOFA 1VE7A 3IURA 4G55A 4PXWA 5M5SA 2HYEA 2H9NA 5C92A 4FB1D 4FA4D 1OLZA 1VYHC 5KDOB 3IULA 5CYKB 4A08B 3SHFA 5EMMB 2P9PC 4EWRA 2CNXA 4H5IA 2IUVA 2VDQA 4A11A 1L5GA 4CI2A 4PSWB 5K1CC 3VA6A 1A12A 5FXYA 4PBZA 3IUJA 3OL2A 3QI0A 1UTCA 1TBGA 3KRXB 1NEXB 2QXVA 4JHPC 1GOGA 3C99A 4CZVA 3EI3B 1PEVA 5FKRA 3L4MD 2EBSA 4X63B 3F3PA 1JMZB 2XDWA 3SJLD 4Y5RD 4J77A 3MVDK 2XYIA 4A0BB 3RLMD 1SHYB 2HJ4A 2UZXB 2XE4A 3EI4B 4BL0A 3EI2A 3VI3A 4RE6A 5I5MA 5HDBA 3O4HA 2CN3A 2AGWA 4J86A 3PSCB 4J73A 4RE5A 3ZE1A 1E5TA 4GMBA 3NIDA 5EAMA 3I7LA 3OF7A 3W15A 2OK6A 4FAVD 3EI1A 4UM9A 3GC3B 2QR5A 4L1MA 5EARA 4GZ8A 3IJCA 4O45A 4IRZA 1XKSA 1N6EA 2EIDA 3I7NA 5IGQA 4L3GD 5H14A 5IC7A 4D9SA 3RRMC 2YNNA 3ZE0A 5EM2A 4O1QD 5FKTA 4NENA 4PC0A 3VGZA 4XYIA 3DWLC 3IJEA 3T3MA 3I7HA 4GGAA 4L1QD 4ESGA 2VDKA 2H6QA 2AGZA 3L4OD 2HU8A 1PBYB 3OKYB 2H68A 2CE8A 4Z7QA 5IJ8E 5TEEA 2PM9A 4XYHA 4BCBA 4E5ZA 4FAND 1MDAH 2OJYA 2HKMA 1VZ3A 1SQ9A 5H1MA 4I79A 1E8NA 4A09B 4CY2A 5JWZA 3PXWD 1H2YA 3SLED 3EQ9A 3DM0A 5HE3B 3GFCA 5TDHB 2Z2NA 4UM8A 3RMZD 3V7DB 4MMZA 3I7OA 1S4UX 2P9KC 2XU7A 3EQ8A 4IMMA 3IJ1A 4GQ1A 3IJ0A 3KCIA 1JTDB 2B5NA 4X60B 2I0TA 3SXTD 3MUOA 4GGDA 3JROA 5M5TA 4GM8A 1YR2A 2H9LA 3BG1A 1PGUA 4JT6C 4MMXA 3P4FA 4J0XA 1VE6A 3FCSA 4ES0A 2VZ1A 2H47A 4J81A 1UOOA 5E6RA 3MKQA 1MG2A 2HU5A 4K3JB 5CXCA 3K27A 1GXRA 4FWWA 3O4GA 5EMKB 2P9LC 3CFVA 4J8BA 2OIZA 4AOWA 4A0AB 3PVUB 2W18A 5TEFA 2CO0C 2J57G 2VDOA 3EU7A 4ZOZA 4E54A 3J81g 2EIBA 5EAPA 4J87A 2HXCA 4A11B 3UR4A 2G99A 4U1EI 1JMXB 3NVNA 3RN1D 2I0SA 1YFQA 4QAMA 4IA9A 1B9XA 5CYKA 2YNPA 4TZ4A 1K8KC 3NIFA 4U7AA 2P9UC 5FFOA 4O3UB 4A2LA 2H9MA 5M5UA 4AN0A 3K26A 4H5JA 2VDRA 3O4IA 4CI1A 2G9AA 3I89A 2H6KA 4BP8A 1B9YA 3EG6A 3EI3A 3UVKA 3T3PA 5FLXg 2BBKH 5E6UA 4J79A 4LG8A 4CY3A 3IUQA 1U2VC 2B4EA 3JPXA 3I8CA 2YMUA 4KFMB 4DNUA 4FA5D 2OK4A 3AL8A 1BPOA 4MMYA 3EI4A 4J84A 1MG3A 1I2MB 1QNIA 4JD2C 2PBIB 3BWSA 1TYEA 1H2ZA 4DNWA 1P22A 2OVPB 5M61A 5EMJB 2IAAA 4FHLA 2EICA 3FRXA 3PE7A 3MMYA 4X3EA 3VH0A 5AMSA 4HDJA 2HESX 2JKXA 3JRPA 3B7FA 3IIWA 3DXMC 1XIPA 3SFZA 2O9KA 4LG9A 4ERQA 4CI8A 4A7JA 3DSMA 5I5JA 2J56H 5HYNB 2AGLA 4ZOYA 3KRWB 4NAAA 2YB8B 3PXTD 3SBQA 1QFSA 4WK4A 5C86A 4Z8LA 3MZLA 1JV2A 1GOFA 3DXKC 4UI9R 5IGOA 5FFGA 2YNOA 2VZ3A 3UVMA 2TRCB 3OKYA 1SQJA 2I3TA 3CIKB 2UZYB 5GXIA 4K3ID 3F3GA 4L9OA 4OZUA 3I7KA 2GC4A 3AH8B 1K32A 4PBYA 4O3TB 4AEZA 4QT8A 4A09A 3JZHA 1K3IA 2BCJB 1O6GA 4JSPC 2P9SC 2YBAA 1U8CA 1L0QA 3C9CA 3RFGA 3ZE2A 3AFCA 4A2MA 2J55H 4JXMA 4ZOVA 5H17A
chains in the Genus database with same CATH topology
2XL2A 4JSVC 5FQDA 1A0RB 4LGNA 4FA1D 4CZYA 2Z2OA 3I2NA 4XEIC 3FGBA 5CXBA 4YVDA 1Q47A 3RSEC 5IJ7E 2Q7QA 2GNQA 5TF2A 3RFHA 4MK0B 3UVNA 2I0RA 4BH6A 4O9DA 5HE1B 3OL2B 3ODTA 4A0AA 4A08A 5EALA 4CI3A 5HE0B 2H9PA 4QRJA 3GREA 3SBPA 3SVWD 5C2WB 4PNKB 3OTTA 3MZKA 2P9IC 3MKSB 5FKQA 2AH1A 2IUQA 2Z2PA 3AL9A 3N0EA 2QC5A 1GG2B 3JAMg 4D6VA 3EI2B 3C75H 3EMHA 5GMKn 3PXSD 1GOTB 5C2VB 5HE2B 3E0CA 2H3XA 3OKWA 1FWXA 3JZNA 2OVQB 3V9FA 4A0BA 4X61B 4J82A 3ZWLB 4ERZA 4CZXA 4J8GA 3OKTA 3AL8B 4CC9A 3EI1B 3NVQA 3ULEC 3PVWB 2XL3A 1ERJA 5C9ZB 3FM0A 3SMRA 2IWKA 3NVXA 3HFQA 3UKRC 2B5MA 2AGXA 2P9NC 2I3SA 2CN2A 2AH0A 5GSAA 2PM6B 5EM2B 5B4WA 4FA9D 3SWSD 5I5IA 3CFSB 3IKOA 5THAA 3J80g 4N14A 2OVRB 4QQEA 4L3HD 4PSXB 2B5LA 1XHMA 4Y7RA 2PM9B 3A0FA 3I8EA 3SN6B 3PSLA 5GXHA 4E5ZB 2GC7A 4GM3A 4JT5C 2H6NA 4J0WA 5AFU3 3OW8A 2CE9A 1OMWB 4GQBB 3I7PA 1RI6A 2MTAH 2HKRA 3JB9L 3V5WB 4R7AB 3UKUC 3N0DA 3UVOA 3UVLA 2AQ5A 4NSXA 3ORVD 2HJBA 4G56B 3IIYA 4GM9A 5EMLB 3SCYA 5AJAA 2CO0A 1GP2B 4J78A 4ZOXA 3EWEA 2IUPA 4GGCA 5A2Qg 3SBRA 3U4YA 1N6DA 5SXMA 4GQ2P 4CY1A 4ERYA 3RN0D 2IWFA 1N6FA 1R5MA 3JZGA 4BUJC 4JSNC 2IURA 1NR0A 5K19A 4QL1A 5CXCB 5FA5B 2PM7B 3F3FA 4JSXC 4OWRA 3MXXA 2H13A 5FKSA 1PI6A 5CXBB 2H14A 1U4CA 1JJUB 4D0KA 5IT9g 4E54B 1TYQC 5HQGA 3BG0A 3C5MA 4ZN4A 2AGYA 4CY5A 1JOFA 4PXWA 2HYEA 2H9NA 4FB1D 4FA4D 1OLZA 1VYHC 5KDOB 5CYKB 4A08B 3SHFA 5EMMB 2P9PC 4EWRA 2CNXA 4H5IA 2IUVA 4A11A 4CI2A 4PSWB 5K1CC 3VA6A 5FXYA 4PBZA 3OL2A 1TBGA 3KRXB 1NEXB 2QXVA 3C99A 4CZVA 3EI3B 1PEVA 5FKRA 3L4MD 2EBSA 4X63B 3F3PA 1JMZB 3SJLD 4Y5RD 4J77A 2XYIA 4A0BB 3RLMD 1SHYB 2HJ4A 2UZXB 3EI4B 4BL0A 3EI2A 5I5MA 2CN3A 2AGWA 4J86A 3PSCB 4J73A 4GMBA 5EAMA 3I7LA 3W15A 2OK6A 4FAVD 3EI1A 5EARA 4GZ8A 3IJCA 4O45A 1XKSA 1N6EA 3I7NA 5IGQA 4L3GD 5H14A 5IC7A 3RRMC 2YNNA 5EM2A 4O1QD 5FKTA 4PC0A 3VGZA 4XYIA 3DWLC 3I7HA 4GGAA 4L1QD 4ESGA 2H6QA 2AGZA 3L4OD 1PBYB 3OKYB 2H68A 2CE8A 5IJ8E 5TEEA 2PM9A 4XYHA 4E5ZA 4FAND 1MDAH 2OJYA 2HKMA 1SQ9A 5H1MA 4I79A 4A09B 4CY2A 5JWZA 3PXWD 3SLED 3DM0A 5HE3B 3GFCA 5TDHB 2Z2NA 3RMZD 3V7DB 3I7OA 1S4UX 2P9KC 2XU7A 4IMMA 3IJ1A 4GQ1A 3IJ0A 2B5NA 4X60B 2I0TA 3SXTD 4GGDA 3JROA 4GM8A 2H9LA 3BG1A 1PGUA 4JT6C 3P4FA 4J0XA 4ES0A 2H47A 4J81A 3MKQA 1MG2A 4K3JB 5CXCA 3K27A 1GXRA 4FWWA 5EMKB 2P9LC 3CFVA 4J8BA 2OIZA 4AOWA 4A0AB 3PVUB 2W18A 5TEFA 2CO0C 2J57G 3EU7A 4ZOZA 4E54A 3J81g 5EAPA 4J87A 2HXCA 4A11B 3UR4A 2G99A 4U1EI 1JMXB 3NVNA 3RN1D 2I0SA 1YFQA 4IA9A 1B9XA 5CYKA 2YNPA 4TZ4A 1K8KC 4U7AA 2P9UC 4O3UB 4A2LA 2H9MA 3K26A 4H5JA 4CI1A 2G9AA 3I89A 2H6KA 1B9YA 3EG6A 3EI3A 3UVKA 5FLXg 2BBKH 4J79A 4LG8A 4CY3A 1U2VC 2B4EA 3JPXA 3I8CA 2YMUA 4KFMB 4FA5D 2OK4A 3AL8A 3EI4A 4J84A 1MG3A 1QNIA 4JD2C 2PBIB 3BWSA 1P22A 2OVPB 5EMJB 2IAAA 4FHLA 3FRXA 3PE7A 3MMYA 4X3EA 3VH0A 5AMSA 4HDJA 2HESX 3JRPA 3B7FA 3IIWA 3DXMC 1XIPA 3SFZA 2O9KA 4LG9A 4ERQA 4CI8A 4A7JA 3DSMA 5I5JA 2J56H 5HYNB 2AGLA 4ZOYA 3KRWB 2YB8B 3PXTD 3SBQA 4Z8LA 3MZLA 3DXKC 4UI9R 5IGOA 2YNOA 3UVMA 2TRCB 3OKYA 1SQJA 2I3TA 3CIKB 2UZYB 5GXIA 4K3ID 3F3GA 4L9OA 4OZUA 3I7KA 2GC4A 3AH8B 1K32A 4PBYA 4O3TB 4AEZA 4QT8A 4A09A 3JZHA 2BCJB 4JSPC 2P9SC 2YBAA 1L0QA 3C9CA 3RFGA 3AFCA 4A2MA 2J55H 4JXMA 4ZOVA 5H17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XL2 A;  4JSV C;  5FQD A;  1A0R B;  4LGN A;  4FA1 D;  4CZY A;  2Z2O A;  3I2N A;  4XEI C;  3FGB A;  5CXB A;  4YVD A;  1Q47 A;  3RSE C;  5IJ7 E;  2Q7Q A;  2GNQ A;  5TF2 A;  3RFH A;  4MK0 B;  3UVN A;  2I0R A;  4BH6 A;  4O9D A;  5HE1 B;  3OL2 B;  3ODT A;  4A0A A;  4A08 A;  5EAL A;  4CI3 A;  5HE0 B;  2H9P A;  4QRJ A;  3GRE A;  3SBP A;  3SVW D;  5C2W B;  4PNK B;  3OTT A;  3MZK A;  2P9I C;  3MKS B;  5FKQ A;  2AH1 A;  2IUQ A;  2Z2P A;  3AL9 A;  3N0E A;  2QC5 A;  1GG2 B;  3JAM g;  4D6V A;  3EI2 B;  3C75 H;  3EMH A;  5GMK n;  3PXS D;  1GOT B;  5C2V B;  5HE2 B;  3E0C A;  2H3X A;  3OKW A;  1FWX A;  3JZN A;  2OVQ B;  3V9F A;  4A0B A;  4X61 B;  4J82 A;  3ZWL B;  4ERZ A;  4CZX A;  4J8G A;  3OKT A;  3AL8 B;  4CC9 A;  3EI1 B;  3NVQ A;  3ULE C;  3PVW B;  2XL3 A;  1ERJ A;  5C9Z B;  3FM0 A;  3SMR A;  2IWK A;  3NVX A;  3HFQ A;  3UKR C;  2B5M A;  2AGX A;  2P9N C;  2I3S A;  2CN2 A;  2AH0 A;  5GSA A;  2PM6 B;  5EM2 B;  5B4W A;  4FA9 D;  3SWS D;  5I5I A;  3CFS B;  3IKO A;  5THA A;  3J80 g;  4N14 A;  2OVR B;  4QQE A;  4L3H D;  4PSX B;  2B5L A;  1XHM A;  4Y7R A;  2PM9 B;  3A0F A;  3I8E A;  3SN6 B;  3PSL A;  5GXH A;  4E5Z B;  2GC7 A;  4GM3 A;  4JT5 C;  2H6N A;  4J0W A;  5AFU 3;  3OW8 A;  2CE9 A;  1OMW B;  4GQB B;  3I7P A;  1RI6 A;  2MTA H;  2HKR A;  3JB9 L;  3V5W B;  4R7A B;  3UKU C;  3N0D A;  3UVO A;  3UVL A;  2AQ5 A;  4NSX A;  3ORV D;  2HJB A;  4G56 B;  3IIY A;  4GM9 A;  5EML B;  3SCY A;  5AJA A;  2CO0 A;  1GP2 B;  4J78 A;  4ZOX A;  3EWE A;  2IUP A;  4GGC A;  5A2Q g;  3SBR A;  3U4Y A;  1N6D A;  5SXM A;  4GQ2 P;  4CY1 A;  4ERY A;  3RN0 D;  2IWF A;  1N6F A;  1R5M A;  3JZG A;  4BUJ C;  4JSN C;  2IUR A;  1NR0 A;  5K19 A;  4QL1 A;  5CXC B;  5FA5 B;  2PM7 B;  3F3F A;  4JSX C;  4OWR A;  3MXX A;  2H13 A;  5FKS A;  1PI6 A;  5CXB B;  2H14 A;  1U4C A;  1JJU B;  4D0K A;  5IT9 g;  4E54 B;  1TYQ C;  5HQG A;  3BG0 A;  3C5M A;  4ZN4 A;  2AGY A;  4CY5 A;  1JOF A;  4PXW A;  2HYE A;  2H9N A;  4FB1 D;  4FA4 D;  1OLZ A;  1VYH C;  5KDO B;  5CYK B;  4A08 B;  3SHF A;  5EMM B;  2P9P C;  4EWR A;  2CNX A;  4H5I A;  2IUV A;  4A11 A;  4CI2 A;  4PSW B;  5K1C C;  3VA6 A;  5FXY A;  4PBZ A;  3OL2 A;  1TBG A;  3KRX B;  1NEX B;  2QXV A;  3C99 A;  4CZV A;  3EI3 B;  1PEV A;  5FKR A;  3L4M D;  2EBS A;  4X63 B;  3F3P A;  1JMZ B;  3SJL D;  4Y5R D;  4J77 A;  2XYI A;  4A0B B;  3RLM D;  1SHY B;  2HJ4 A;  2UZX B;  3EI4 B;  4BL0 A;  3EI2 A;  5I5M A;  2CN3 A;  2AGW A;  4J86 A;  3PSC B;  4J73 A;  4GMB A;  5EAM A;  3I7L A;  3W15 A;  2OK6 A;  4FAV D;  3EI1 A;  5EAR A;  4GZ8 A;  3IJC A;  4O45 A;  1XKS A;  1N6E A;  3I7N A;  5IGQ A;  4L3G D;  5H14 A;  5IC7 A;  3RRM C;  2YNN A;  5EM2 A;  4O1Q D;  5FKT A;  4PC0 A;  3VGZ A;  4XYI A;  3DWL C;  3I7H A;  4GGA A;  4L1Q D;  4ESG A;  2H6Q A;  2AGZ A;  3L4O D;  1PBY B;  3OKY B;  2H68 A;  2CE8 A;  5IJ8 E;  5TEE A;  2PM9 A;  4XYH A;  4E5Z A;  4FAN D;  1MDA H;  2OJY A;  2HKM A;  1SQ9 A;  5H1M A;  4I79 A;  4A09 B;  4CY2 A;  5JWZ A;  3PXW D;  3SLE D;  3DM0 A;  5HE3 B;  3GFC A;  5TDH B;  2Z2N A;  3RMZ D;  3V7D B;  3I7O A;  1S4U X;  2P9K C;  2XU7 A;  4IMM A;  3IJ1 A;  4GQ1 A;  3IJ0 A;  2B5N A;  4X60 B;  2I0T A;  3SXT D;  4GGD A;  3JRO A;  4GM8 A;  2H9L A;  3BG1 A;  1PGU A;  4JT6 C;  3P4F A;  4J0X A;  4ES0 A;  2H47 A;  4J81 A;  3MKQ A;  1MG2 A;  4K3J B;  5CXC A;  3K27 A;  1GXR A;  4FWW A;  5EMK B;  2P9L C;  3CFV A;  4J8B A;  2OIZ A;  4AOW A;  4A0A B;  3PVU B;  2W18 A;  5TEF A;  2CO0 C;  2J57 G;  3EU7 A;  4ZOZ A;  4E54 A;  3J81 g;  5EAP A;  4J87 A;  2HXC A;  4A11 B;  3UR4 A;  2G99 A;  4U1E I;  1JMX B;  3NVN A;  3RN1 D;  2I0S A;  1YFQ A;  4IA9 A;  1B9X A;  5CYK A;  2YNP A;  4TZ4 A;  1K8K C;  4U7A A;  2P9U C;  4O3U B;  4A2L A;  2H9M A;  3K26 A;  4H5J A;  4CI1 A;  2G9A A;  3I89 A;  2H6K A;  1B9Y A;  3EG6 A;  3EI3 A;  3UVK A;  5FLX g;  2BBK H;  4J79 A;  4LG8 A;  4CY3 A;  1U2V C;  2B4E A;  3JPX A;  3I8C A;  2YMU A;  4KFM B;  4FA5 D;  2OK4 A;  3AL8 A;  3EI4 A;  4J84 A;  1MG3 A;  1QNI A;  4JD2 C;  2PBI B;  3BWS A;  1P22 A;  2OVP B;  5EMJ B;  2IAA A;  4FHL A;  3FRX A;  3PE7 A;  3MMY A;  4X3E A;  3VH0 A;  5AMS A;  4HDJ A;  2HES X;  3JRP A;  3B7F A;  3IIW A;  3DXM C;  1XIP A;  3SFZ A;  2O9K A;  4LG9 A;  4ERQ A;  4CI8 A;  4A7J A;  3DSM A;  5I5J A;  2J56 H;  5HYN B;  2AGL A;  4ZOY A;  3KRW B;  2YB8 B;  3PXT D;  3SBQ A;  4Z8L A;  3MZL A;  3DXK C;  4UI9 R;  5IGO A;  2YNO A;  3UVM A;  2TRC B;  3OKY A;  1SQJ A;  2I3T A;  3CIK B;  2UZY B;  5GXI A;  4K3I D;  3F3G A;  4L9O A;  4OZU A;  3I7K A;  2GC4 A;  3AH8 B;  1K32 A;  4PBY A;  4O3T B;  4AEZ A;  4QT8 A;  4A09 A;  3JZH A;  2BCJ B;  4JSP C;  2P9S C;  2YBA A;  1L0Q A;  3C9C A;  3RFG A;  3AFC A;  4A2M A;  2J55 H;  4JXM A;  4ZOV A;  5H17 A; 
#chains in the Genus database with same CATH topology
 2XL2 A;  4JSV C;  5FQD A;  1A0R B;  4BP9 A;  4LGN A;  4FA1 D;  4CZY A;  2Z2O A;  4O2W A;  3I2N A;  4XEI C;  2XZG A;  3FGB A;  1UOQ A;  5CXB A;  2QZP A;  1E8M A;  4YVD A;  1Q47 A;  3RSE C;  5IJ7 E;  2Q7Q A;  2GNQ A;  5TF2 A;  3RFH A;  4MK0 B;  3UVN A;  4NC4 A;  2I0R A;  4NBM A;  4BH6 A;  4O9D A;  5HE1 B;  3OL2 B;  3ODT A;  4A0A A;  3DDU A;  5EAL A;  4CI3 A;  4A08 A;  5HE0 B;  2H9P A;  4QRJ A;  3GRE A;  4Z7O A;  3SBP A;  3IUN A;  3SVW D;  5C2W B;  3NIG A;  4PNK B;  2EIE A;  3OTT A;  3MZK A;  3IUM A;  2P9I C;  3MKS B;  5FKQ A;  2AH1 A;  2IUQ A;  2Z2P A;  3AL9 A;  3N0E A;  2QC5 A;  1GG2 B;  3JAM g;  4D6V A;  3EI2 B;  3ZDY A;  3C75 H;  2VDL A;  3EMH A;  5GMK n;  3PXS D;  1GOT B;  5C2V B;  3QHY B;  5HE2 B;  3E0C A;  3V4V A;  2H3X A;  3OKW A;  1C9I A;  1FWX A;  3JZN A;  2OVQ B;  4WK2 A;  3V9F A;  4A0B A;  4X61 B;  4J82 A;  3ZWL B;  4ERZ A;  4CZX A;  4J8G A;  3OKT A;  3AL8 B;  4CC9 A;  3EI1 B;  3NVQ A;  3ULE C;  3PVW B;  2XL3 A;  1H2X A;  2HU7 A;  1ERJ A;  4JHN A;  3IVM A;  5C9Z B;  3FM0 A;  3SMR A;  2IWK A;  3NVX A;  3HFQ A;  3UKR C;  1O6F A;  2B5M A;  2AGX A;  4WJK A;  2P9N C;  2I3S A;  2CN2 A;  2AH0 A;  5GSA A;  2PM6 B;  5EM2 B;  5B4W A;  4DNV A;  4AMY A;  4FA9 D;  3SWS D;  5E6S A;  5I5I A;  3CFS B;  3IKO A;  5THA A;  3J80 g;  4N14 A;  2OVR B;  4QQE A;  4L3H D;  3K6S A;  4PSX B;  3K72 A;  2B5L A;  4G1M A;  1XHM A;  4Y7R A;  1M1X A;  1QFM A;  2PM9 B;  3A0F A;  3I8E A;  3SN6 B;  4AN1 A;  3K71 A;  3PSL A;  5GXH A;  4E5Z B;  2GC7 A;  4GM3 A;  4JT5 C;  2VDP A;  2H6N A;  2WQ8 A;  3MUN A;  3FCU A;  4J0W A;  5AFU 3;  2VDM A;  3GD1 I;  3OW8 A;  4BCC A;  2CE9 A;  2VDN A;  1OMW B;  4GQB B;  3I7P A;  1RI6 A;  1GOH A;  4AX4 A;  2MTA H;  1H2W A;  2HKR A;  3JB9 L;  3ZDX A;  3V5W B;  4R7A B;  3UKU C;  3N0D A;  3UVO A;  3UVL A;  2AQ5 A;  4NSX A;  3ORV D;  2HJB A;  4G56 B;  4G1E A;  3IIY A;  4GM9 A;  3EQ7 A;  5EML B;  3SCY A;  5AJA A;  3V4P A;  2CO0 A;  4WK0 A;  1UOP A;  1VZ2 A;  1GP2 B;  4J78 A;  4ZOX A;  3EWE A;  2IUP A;  4GGC A;  5A2Q g;  3SBR A;  3U4Y A;  1N6D A;  5SXM A;  4GQ2 P;  4CY1 A;  4ERY A;  3RN0 D;  2IWF A;  3O4J A;  1N6F A;  1R5M A;  3JZG A;  4AMZ A;  3VI4 A;  4BUJ C;  2BKL A;  4JSN C;  2IUR A;  1NR0 A;  5K19 A;  4QL1 A;  5CXC B;  5FA5 B;  4BCD A;  5M5V A;  2PM7 B;  3F3F A;  4JSX C;  5M5R A;  4OWR A;  3MXX A;  4Z7N A;  2H13 A;  5FKS A;  1PI6 A;  5CXB B;  1T2X A;  2H14 A;  3ZDZ A;  1U4C A;  2VC2 A;  1JJU B;  1C9L A;  4D0K A;  4O02 A;  5IT9 g;  4E54 B;  1TYQ C;  5HQG A;  3BG0 A;  3C5M A;  4ZN4 A;  2AGY A;  4CY5 A;  1JOF A;  1VE7 A;  3IUR A;  4G55 A;  4PXW A;  5M5S A;  2HYE A;  2H9N A;  5C92 A;  4FB1 D;  4FA4 D;  1OLZ A;  1VYH C;  5KDO B;  3IUL A;  5CYK B;  4A08 B;  3SHF A;  5EMM B;  2P9P C;  4EWR A;  2CNX A;  4H5I A;  2IUV A;  2VDQ A;  4A11 A;  1L5G A;  4CI2 A;  4PSW B;  5K1C C;  3VA6 A;  1A12 A;  5FXY A;  4PBZ A;  3IUJ A;  3OL2 A;  3QI0 A;  1UTC A;  1TBG A;  3KRX B;  1NEX B;  2QXV A;  4JHP C;  1GOG A;  3C99 A;  4CZV A;  3EI3 B;  1PEV A;  5FKR A;  3L4M D;  2EBS A;  4X63 B;  3F3P A;  1JMZ B;  2XDW A;  3SJL D;  4Y5R D;  4J77 A;  3MVD K;  2XYI A;  4A0B B;  3RLM D;  1SHY B;  2HJ4 A;  2UZX B;  2XE4 A;  3EI4 B;  4BL0 A;  3EI2 A;  3VI3 A;  4RE6 A;  5I5M A;  5HDB A;  3O4H A;  2CN3 A;  2AGW A;  4J86 A;  3PSC B;  4J73 A;  4RE5 A;  3ZE1 A;  1E5T A;  4GMB A;  3NID A;  5EAM A;  3I7L A;  3OF7 A;  3W15 A;  2OK6 A;  4FAV D;  3EI1 A;  4UM9 A;  3GC3 B;  2QR5 A;  4L1M A;  5EAR A;  4GZ8 A;  3IJC A;  4O45 A;  4IRZ A;  1XKS A;  1N6E A;  2EID A;  3I7N A;  5IGQ A;  4L3G D;  5H14 A;  5IC7 A;  4D9S A;  3RRM C;  2YNN A;  3ZE0 A;  5EM2 A;  4O1Q D;  5FKT A;  4NEN A;  4PC0 A;  3VGZ A;  4XYI A;  3DWL C;  3IJE A;  3T3M A;  3I7H A;  4GGA A;  4L1Q D;  4ESG A;  2VDK A;  2H6Q A;  2AGZ A;  3L4O D;  2HU8 A;  1PBY B;  3OKY B;  2H68 A;  2CE8 A;  4Z7Q A;  5IJ8 E;  5TEE A;  2PM9 A;  4XYH A;  4BCB A;  4E5Z A;  4FAN D;  1MDA H;  2OJY A;  2HKM A;  1VZ3 A;  1SQ9 A;  5H1M A;  4I79 A;  1E8N A;  4A09 B;  4CY2 A;  5JWZ A;  3PXW D;  1H2Y A;  3SLE D;  3EQ9 A;  3DM0 A;  5HE3 B;  3GFC A;  5TDH B;  2Z2N A;  4UM8 A;  3RMZ D;  3V7D B;  4MMZ A;  3I7O A;  1S4U X;  2P9K C;  2XU7 A;  3EQ8 A;  4IMM A;  3IJ1 A;  4GQ1 A;  3IJ0 A;  3KCI A;  1JTD B;  2B5N A;  4X60 B;  2I0T A;  3SXT D;  3MUO A;  4GGD A;  3JRO A;  5M5T A;  4GM8 A;  1YR2 A;  2H9L A;  3BG1 A;  1PGU A;  4JT6 C;  4MMX A;  3P4F A;  4J0X A;  1VE6 A;  3FCS A;  4ES0 A;  2VZ1 A;  2H47 A;  4J81 A;  1UOO A;  5E6R A;  3MKQ A;  1MG2 A;  2HU5 A;  4K3J B;  5CXC A;  3K27 A;  1GXR A;  4FWW A;  3O4G A;  5EMK B;  2P9L C;  3CFV A;  4J8B A;  2OIZ A;  4AOW A;  4A0A B;  3PVU B;  2W18 A;  5TEF A;  2CO0 C;  2J57 G;  2VDO A;  3EU7 A;  4ZOZ A;  4E54 A;  3J81 g;  2EIB A;  5EAP A;  4J87 A;  2HXC A;  4A11 B;  3UR4 A;  2G99 A;  4U1E I;  1JMX B;  3NVN A;  3RN1 D;  2I0S A;  1YFQ A;  4QAM A;  4IA9 A;  1B9X A;  5CYK A;  2YNP A;  4TZ4 A;  1K8K C;  3NIF A;  4U7A A;  2P9U C;  5FFO A;  4O3U B;  4A2L A;  2H9M A;  5M5U A;  4AN0 A;  3K26 A;  4H5J A;  2VDR A;  3O4I A;  4CI1 A;  2G9A A;  3I89 A;  2H6K A;  4BP8 A;  1B9Y A;  3EG6 A;  3EI3 A;  3UVK A;  3T3P A;  5FLX g;  2BBK H;  5E6U A;  4J79 A;  4LG8 A;  4CY3 A;  3IUQ A;  1U2V C;  2B4E A;  3JPX A;  3I8C A;  2YMU A;  4KFM B;  4DNU A;  4FA5 D;  2OK4 A;  3AL8 A;  1BPO A;  4MMY A;  3EI4 A;  4J84 A;  1MG3 A;  1I2M B;  1QNI A;  4JD2 C;  2PBI B;  3BWS A;  1TYE A;  1H2Z A;  4DNW A;  1P22 A;  2OVP B;  5M61 A;  5EMJ B;  2IAA A;  4FHL A;  2EIC A;  3FRX A;  3PE7 A;  3MMY A;  4X3E A;  3VH0 A;  5AMS A;  4HDJ A;  2HES X;  2JKX A;  3JRP A;  3B7F A;  3IIW A;  3DXM C;  1XIP A;  3SFZ A;  2O9K A;  4LG9 A;  4ERQ A;  4CI8 A;  4A7J A;  3DSM A;  5I5J A;  2J56 H;  5HYN B;  2AGL A;  4ZOY A;  3KRW B;  4NAA A;  2YB8 B;  3PXT D;  3SBQ A;  1QFS A;  4WK4 A;  5C86 A;  4Z8L A;  3MZL A;  1JV2 A;  1GOF A;  3DXK C;  4UI9 R;  5IGO A;  5FFG A;  2YNO A;  2VZ3 A;  3UVM A;  2TRC B;  3OKY A;  1SQJ A;  2I3T A;  3CIK B;  2UZY B;  5GXI A;  4K3I D;  3F3G A;  4L9O A;  4OZU A;  3I7K A;  2GC4 A;  3AH8 B;  1K32 A;  4PBY A;  4O3T B;  4AEZ A;  4QT8 A;  4A09 A;  3JZH A;  1K3I A;  2BCJ B;  1O6G A;  4JSP C;  2P9S C;  2YBA A;  1U8C A;  1L0Q A;  3C9C A;  3RFG A;  3ZE2 A;  3AFC A;  4A2M A;  2J55 H;  4JXM A;  4ZOV A;  5H17 A; 
#chains in the Genus database with same CATH homology
 2XL2 A;  4JSV C;  5FQD A;  1A0R B;  4LGN A;  4FA1 D;  4CZY A;  2Z2O A;  3I2N A;  4XEI C;  3FGB A;  5CXB A;  4YVD A;  1Q47 A;  3RSE C;  5IJ7 E;  2Q7Q A;  2GNQ A;  5TF2 A;  3RFH A;  4MK0 B;  3UVN A;  2I0R A;  4BH6 A;  4O9D A;  5HE1 B;  3OL2 B;  3ODT A;  4A0A A;  4A08 A;  5EAL A;  4CI3 A;  5HE0 B;  2H9P A;  4QRJ A;  3GRE A;  3SBP A;  3SVW D;  5C2W B;  4PNK B;  3OTT A;  3MZK A;  2P9I C;  3MKS B;  5FKQ A;  2AH1 A;  2IUQ A;  2Z2P A;  3AL9 A;  3N0E A;  2QC5 A;  1GG2 B;  3JAM g;  4D6V A;  3EI2 B;  3C75 H;  3EMH A;  5GMK n;  3PXS D;  1GOT B;  5C2V B;  5HE2 B;  3E0C A;  2H3X A;  3OKW A;  1FWX A;  3JZN A;  2OVQ B;  3V9F A;  4A0B A;  4X61 B;  4J82 A;  3ZWL B;  4ERZ A;  4CZX A;  4J8G A;  3OKT A;  3AL8 B;  4CC9 A;  3EI1 B;  3NVQ A;  3ULE C;  3PVW B;  2XL3 A;  1ERJ A;  5C9Z B;  3FM0 A;  3SMR A;  2IWK A;  3NVX A;  3HFQ A;  3UKR C;  2B5M A;  2AGX A;  2P9N C;  2I3S A;  2CN2 A;  2AH0 A;  5GSA A;  2PM6 B;  5EM2 B;  5B4W A;  4FA9 D;  3SWS D;  5I5I A;  3CFS B;  3IKO A;  5THA A;  3J80 g;  4N14 A;  2OVR B;  4QQE A;  4L3H D;  4PSX B;  2B5L A;  1XHM A;  4Y7R A;  2PM9 B;  3A0F A;  3I8E A;  3SN6 B;  3PSL A;  5GXH A;  4E5Z B;  2GC7 A;  4GM3 A;  4JT5 C;  2H6N A;  4J0W A;  5AFU 3;  3OW8 A;  2CE9 A;  1OMW B;  4GQB B;  3I7P A;  1RI6 A;  2MTA H;  2HKR A;  3JB9 L;  3V5W B;  4R7A B;  3UKU C;  3N0D A;  3UVO A;  3UVL A;  2AQ5 A;  4NSX A;  3ORV D;  2HJB A;  4G56 B;  3IIY A;  4GM9 A;  5EML B;  3SCY A;  5AJA A;  2CO0 A;  1GP2 B;  4J78 A;  4ZOX A;  3EWE A;  2IUP A;  4GGC A;  5A2Q g;  3SBR A;  3U4Y A;  1N6D A;  5SXM A;  4GQ2 P;  4CY1 A;  4ERY A;  3RN0 D;  2IWF A;  1N6F A;  1R5M A;  3JZG A;  4BUJ C;  4JSN C;  2IUR A;  1NR0 A;  5K19 A;  4QL1 A;  5CXC B;  5FA5 B;  2PM7 B;  3F3F A;  4JSX C;  4OWR A;  3MXX A;  2H13 A;  5FKS A;  1PI6 A;  5CXB B;  2H14 A;  1U4C A;  1JJU B;  4D0K A;  5IT9 g;  4E54 B;  1TYQ C;  5HQG A;  3BG0 A;  3C5M A;  4ZN4 A;  2AGY A;  4CY5 A;  1JOF A;  4PXW A;  2HYE A;  2H9N A;  4FB1 D;  4FA4 D;  1OLZ A;  1VYH C;  5KDO B;  5CYK B;  4A08 B;  3SHF A;  5EMM B;  2P9P C;  4EWR A;  2CNX A;  4H5I A;  2IUV A;  4A11 A;  4CI2 A;  4PSW B;  5K1C C;  3VA6 A;  5FXY A;  4PBZ A;  3OL2 A;  1TBG A;  3KRX B;  1NEX B;  2QXV A;  3C99 A;  4CZV A;  3EI3 B;  1PEV A;  5FKR A;  3L4M D;  2EBS A;  4X63 B;  3F3P A;  1JMZ B;  3SJL D;  4Y5R D;  4J77 A;  2XYI A;  4A0B B;  3RLM D;  1SHY B;  2HJ4 A;  2UZX B;  3EI4 B;  4BL0 A;  3EI2 A;  5I5M A;  2CN3 A;  2AGW A;  4J86 A;  3PSC B;  4J73 A;  4GMB A;  5EAM A;  3I7L A;  3W15 A;  2OK6 A;  4FAV D;  3EI1 A;  5EAR A;  4GZ8 A;  3IJC A;  4O45 A;  1XKS A;  1N6E A;  3I7N A;  5IGQ A;  4L3G D;  5H14 A;  5IC7 A;  3RRM C;  2YNN A;  5EM2 A;  4O1Q D;  5FKT A;  4PC0 A;  3VGZ A;  4XYI A;  3DWL C;  3I7H A;  4GGA A;  4L1Q D;  4ESG A;  2H6Q A;  2AGZ A;  3L4O D;  1PBY B;  3OKY B;  2H68 A;  2CE8 A;  5IJ8 E;  5TEE A;  2PM9 A;  4XYH A;  4E5Z A;  4FAN D;  1MDA H;  2OJY A;  2HKM A;  1SQ9 A;  5H1M A;  4I79 A;  4A09 B;  4CY2 A;  5JWZ A;  3PXW D;  3SLE D;  3DM0 A;  5HE3 B;  3GFC A;  5TDH B;  2Z2N A;  3RMZ D;  3V7D B;  3I7O A;  1S4U X;  2P9K C;  2XU7 A;  4IMM A;  3IJ1 A;  4GQ1 A;  3IJ0 A;  2B5N A;  4X60 B;  2I0T A;  3SXT D;  4GGD A;  3JRO A;  4GM8 A;  2H9L A;  3BG1 A;  1PGU A;  4JT6 C;  3P4F A;  4J0X A;  4ES0 A;  2H47 A;  4J81 A;  3MKQ A;  1MG2 A;  4K3J B;  5CXC A;  3K27 A;  1GXR A;  4FWW A;  5EMK B;  2P9L C;  3CFV A;  4J8B A;  2OIZ A;  4AOW A;  4A0A B;  3PVU B;  2W18 A;  5TEF A;  2CO0 C;  2J57 G;  3EU7 A;  4ZOZ A;  4E54 A;  3J81 g;  5EAP A;  4J87 A;  2HXC A;  4A11 B;  3UR4 A;  2G99 A;  4U1E I;  1JMX B;  3NVN A;  3RN1 D;  2I0S A;  1YFQ A;  4IA9 A;  1B9X A;  5CYK A;  2YNP A;  4TZ4 A;  1K8K C;  4U7A A;  2P9U C;  4O3U B;  4A2L A;  2H9M A;  3K26 A;  4H5J A;  4CI1 A;  2G9A A;  3I89 A;  2H6K A;  1B9Y A;  3EG6 A;  3EI3 A;  3UVK A;  5FLX g;  2BBK H;  4J79 A;  4LG8 A;  4CY3 A;  1U2V C;  2B4E A;  3JPX A;  3I8C A;  2YMU A;  4KFM B;  4FA5 D;  2OK4 A;  3AL8 A;  3EI4 A;  4J84 A;  1MG3 A;  1QNI A;  4JD2 C;  2PBI B;  3BWS A;  1P22 A;  2OVP B;  5EMJ B;  2IAA A;  4FHL A;  3FRX A;  3PE7 A;  3MMY A;  4X3E A;  3VH0 A;  5AMS A;  4HDJ A;  2HES X;  3JRP A;  3B7F A;  3IIW A;  3DXM C;  1XIP A;  3SFZ A;  2O9K A;  4LG9 A;  4ERQ A;  4CI8 A;  4A7J A;  3DSM A;  5I5J A;  2J56 H;  5HYN B;  2AGL A;  4ZOY A;  3KRW B;  2YB8 B;  3PXT D;  3SBQ A;  4Z8L A;  3MZL A;  3DXK C;  4UI9 R;  5IGO A;  2YNO A;  3UVM A;  2TRC B;  3OKY A;  1SQJ A;  2I3T A;  3CIK B;  2UZY B;  5GXI A;  4K3I D;  3F3G A;  4L9O A;  4OZU A;  3I7K A;  2GC4 A;  3AH8 B;  1K32 A;  4PBY A;  4O3T B;  4AEZ A;  4QT8 A;  4A09 A;  3JZH A;  2BCJ B;  4JSP C;  2P9S C;  2YBA A;  1L0Q A;  3C9C A;  3RFG A;  3AFC A;  4A2M A;  2J55 H;  4JXM A;  4ZOV A;  5H17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...