3SMRA

Crystal structure of human wd repeat domain 5 with compound
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
302
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Small-molecule inhibition of MLL activity by disruption of its interaction with WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 104
structure length 302
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3smrA00
2I0RA 4O3TB 3AH8B 3ZWLB 1MG2A 2YNOA 1B9YA 2H14A 2YB8B 3ODTA 2Q7QA 3AL8B 3FRXA 3N0DA 5GSAA 5I5MA 2CN2A 4JD2C 4A09B 3SLED 5AFU3 2I3SA 4PBYA 2I0SA 3K26A 1GP2B 4CC9A 5EMKB 3V7DB 1VYHC 3UR4A 3DWLC 3MZKA 2CN3A 2XL3A 3B7FA 4O3UB 3I7PA 5FQDA 5H14A 4CY5A 2J56H 3SBPA 3AL8A 2P9PC 2H47A 3DSMA 2IUPA 4G56B 4H5IA 2UZYB 3P4FA 2EBSA 4J86A 5TDHB 2Z2OA 4A09A 2GC4A 3UVLA 3JPXA 3BWSA 4GM3A 3E0CA 5FLXg 4IMMA 1TBGA 1YFQA 3SHFA 2IUVA 2HXCA 3DXMC 2Z2PA 3BG0A 2I3TA 1JJUB 4J8BA 2HYEA 3IJ1A 4CI8A 4A08B 2B5MA 1R5MA 3L4OD 3SXTD 4X60B 3V5WB 2G9AA 2H9PA 5FXYA 4J87A 2YBAA 5EM2B 4J82A 1PI6A 4J8GA 3C99A 3KRXB 4R7AB 4O1QD 5K1CC 4JSNC 4E5ZB 3IIYA 4L3HD 4X61B 1RI6A 5KDOB 3C5MA 2PM7B 1N6FA 3I7KA 3EG6A 4KFMB 3PXTD 4ERQA 4FA5D 5HE2B 2OVQB 3RFHA 4J77A 4D0KA 1PBYB 4A08A 2GNQA 3OW8A 3SJLD 1XIPA 4CZXA 4Z8LA 5B4WA 3OKTA 3PXSD 5I5IA 1GXRA 1N6DA 5EM2A 3ORVD 4I79A 5IC7A 4FAVD 4QQEA 2AQ5A 2HJBA 4EWRA 5TEFA 2AGWA 4A11B 4GQ1A 4E5ZA 2CE8A 4L3GD 3U4YA 3IKOA 3MXXA 4K3JB 2Z2NA 5CXBA 4AOWA 3JROA 4GQ2P 1K8KC 5TF2A 5C9ZB 4E54B 3CFVA 1L0QA 4BH6A 3FGBA 5EMJB 2P9NC 4JT6C 3A0FA 4XYHA 2J57G 4CZVA 3J81g 3OL2B 5IGOA 3V9FA 1P22A 1MDAH 3KRWB 1SHYB 1XKSA 4GMBA 2PBIB 4XYIA 5EAMA 2MTAH 1NEXB 3PSLA 4A11A 2OK6A 4IA9A 1N6EA 5I5JA 3OTTA 4ERZA 4J0XA 5H17A 5FKSA 4MK0B 2H9NA 3DM0A 4E54A 5EMLB 5AJAA 3MMYA 1NR0A 2H6NA 2IUQA 4NSXA 5GXHA 1FWXA 3F3PA 2H6QA 3SWSD 4Y7RA 4CZYA 3C75H 2W18A 3RSEC 3JRPA 4FA4D 5GMKn 3OL2A 5CXCA 1Q47A 2AH0A 4UI9R 3VGZA 4ZOXA 3EI1B 3RMZD 3GFCA 3IJ0A 2UZXB 1A0RB 5FKQA 4FB1D 4K3ID 4GGAA 3EI2A 2B5NA 5HE1B 1K32A 3MZLA 4PXWA 4HDJA 5SXMA 3JZGA 4CY2A 3JB9L 3SFZA 5CYKB 3DXKC 5EALA 3AL9A 1XHMA 5IT9g 4A2MA 4PNKB 5A2Qg 1S4UX 4PSXB 3EI1A 4FWWA 3F3FA 1U2VC 4U7AA 4ERYA 4GZ8A 2P9UC 3W15A 3VH0A 3PVUB 3GREA 3RLMD 2QXVA 3IIWA 5THAA 5CXBB 4N14A 1JMZB 2YNNA 3I7OA 3PSCB 2AGZA 3I7LA 2H3XA 3RRMC 4A0AB 3NVXA 4LG8A 2AGXA 3SCYA 4CY3A 3PXWD 3IJCA 2OJYA 4L9OA 4GGCA 2H68A 4L1QD 2J55H 4J73A 3UKRC 4JT5C 2P9SC 2GC7A 2IWKA 2CNXA 1PGUA 2P9KC 2OIZA 5CYKA 3NVQA 5IJ7E 3MKQA 5HQGA 3N0EA 4YVDA 1B9XA 4FA9D 4GGDA 2YMUA 1JOFA 3EI4B 4BL0A 3HFQA 2YNPA 5EARA 3JZHA 4GM8A 2CE9A 4PC0A 3J80g 5C2VB 2P9LC 4J81A 4J78A 3UVKA 2HKMA 3VA6A 4A0AA 5JWZA 4ZOVA 5HE0B 2G99A 4JSXC 2CO0A 4PSWB 2OVRB 2TRCB 4LGNA 4X3EA 4QL1A 2B5LA 5CXCB 4JXMA 4CY1A 1JMXB 4A0BB 4Y5RD 3F3GA 4FA1D 3EI4A 4QT8A 4J79A 4OWRA 3PVWB 3I8CA 4FHLA 4CI1A 4JSVC 3SMRA 5GXIA 3UKUC 5IGQA 3C9CA 3I8EA 2IURA 3OKYB 2OVPB 3RFGA 3EI2B 2CO0C 2H9LA 4CI3A 5FKTA 5HYNB 3SN6B 4X63B 3EMHA 4QRJA 3PE7A 2B4EA 1GG2B 4ES0A 5C2WB 1GOTB 3ULEC 3EI3B 4O9DA 5TEEA 4A0BA 1MG3A 3SBRA 3UVMA 4CI2A 4GQBB 2H13A 5FKRA 3RN0D 4U1EI 3OKWA 3OKYA 4D6VA 1SQJA 2H6KA 2IAAA 2PM9B 3CFSB 1QNIA 2P9IC 4AEZA 4TZ4A 3K27A 2OK4A 5H1MA 2IWFA 3UVOA 4ESGA 5K19A 4J84A 4ZOZA 2XU7A 4ZOYA 2PM6B 4BUJC 5EMMB 5IJ8E 3SVWD 3JZNA 5EAPA 3AFCA 3EI3A 3JAMg 2H9MA 3UVNA 4XEIC 2AH1A 3L4MD 4LG9A 4GM9A 4A7JA 2BBKH 3I2NA 3I7NA 5HE3B 2XL2A 1SQ9A 3I89A 4OZUA 2PM9A 2O9KA 2XYIA 3FM0A 3NVNA 2HESX 4FAND 2BCJB 4H5JA 4A2LA 3EU7A 4PBZA 1TYQC 1U4CA 4ZN4A 2AGYA 2QC5A 5AMSA 3EWEA 4J0WA 1PEVA 3SBQA 2HKRA 3CIKB 4O45A 3RN1D 2I0TA 3BG1A 3MKSB 2AGLA 1ERJA 2HJ4A 3I7HA 5FA5B 1OMWB 1OLZA 4JSPC
chains in the Genus database with same CATH superfamily
5C86A 2I0RA 4O3TB 3AH8B 3ZWLB 1MG2A 2YNOA 3EQ8A 1B9YA 2H14A 2YB8B 1E8NA 2VDMA 3ODTA 2Q7QA 1U8CA 4G55A 3AL8B 3FRXA 3N0DA 5M5TA 5GSAA 5I5MA 2CN2A 4JD2C 5E6UA 4A09B 3ZDYA 1L5GA 3SLED 5AFU3 1A12A 2I3SA 2XE4A 4PBYA 2I0SA 3K26A 1GP2B 4CC9A 3NIGA 5EMKB 3V7DB 1VYHC 3UR4A 4WK4A 3DWLC 2HU5A 3NIDA 3MZKA 2CN3A 2XL3A 3B7FA 4BP8A 4O3UB 4AX4A 1C9LA 3I7PA 5FQDA 5H14A 4CY5A 2J56H 3SBPA 4QAMA 3AL8A 3IUJA 2P9PC 2H47A 4RE5A 3DSMA 3VI4A 2IUPA 4G56B 4H5IA 2UZYB 4JHPC 5E6RA 3P4FA 2EBSA 4J86A 5TDHB 2Z2OA 4A09A 1I2MB 4DNUA 3IUMA 2GC4A 3UVLA 3JPXA 3BWSA 4GM3A 1BPOA 3NIFA 3E0CA 5FLXg 4IMMA 4AMYA 3ZE2A 3EQ7A 1TBGA 1YFQA 3SHFA 2IUVA 2HXCA 3KCIA 3ZE0A 3DXMC 2Z2PA 3ZE1A 3BG0A 2I3TA 1JJUB 2VZ3A 4J8BA 2HYEA 3IJ1A 3IUNA 4CI8A 4A08B 2B5MA 1VZ2A 1R5MA 3T3PA 3L4OD 3SXTD 4X60B 3V5WB 4MMXA 2G9AA 1YR2A 2H9PA 5FXYA 4J87A 2YBAA 5EM2B 4J82A 1PI6A 4J8GA 3C99A 3KRXB 4R7AB 4O1QD 5K1CC 4JSNC 3MUOA 4E5ZB 3IIYA 4L3HD 1H2YA 4X61B 1RI6A 5KDOB 3C5MA 2PM7B 1N6FA 3I7KA 3EG6A 4KFMB 3PXTD 4ERQA 1O6GA 4FA5D 5HE2B 1QFMA 2OVQB 3RFHA 4G1MA 1JV2A 4J77A 1UOOA 4D0KA 1PBYB 4NBMA 4D9SA 2GNQA 4A08A 3OW8A 3SJLD 1XIPA 5FFOA 4L1MA 4CZXA 1M1XA 4Z8LA 5B4WA 3OKTA 3PXSD 5I5IA 1GXRA 4UM8A 1N6DA 5EM2A 3ORVD 4I79A 5IC7A 4FAVD 4MMZA 4QQEA 2AQ5A 2HJBA 4EWRA 5TEFA 2AGWA 4A11B 4GQ1A 5FFGA 4E5ZA 2CE8A 4L3GD 3U4YA 3IKOA 3MXXA 4K3JB 2Z2NA 5CXBA 4AOWA 3JROA 4GQ2P 1K8KC 5TF2A 3MUNA 5C9ZB 2HU7A 2EICA 4Z7OA 4E54B 3CFVA 1L0QA 4BH6A 1E5TA 3FGBA 5EMJB 2P9NC 4JT6C 5M61A 3A0FA 4XYHA 5M5UA 2XZGA 2J57G 4CZVA 1VE7A 1E8MA 3J81g 2HU8A 3OL2B 4IRZA 5IGOA 3V9FA 1P22A 1MDAH 4BP9A 3KRWB 1SHYB 1XKSA 4GMBA 3MVDK 2PBIB 2WQ8A 1UOPA 4XYIA 5EAMA 2MTAH 4BCDA 1NEXB 3PSLA 2JKXA 4A11A 2OK6A 4IA9A 1N6EA 5I5JA 1T2XA 3OTTA 4ERZA 3VI3A 4J0XA 5H17A 5FKSA 4MK0B 2H9NA 3DM0A 1O6FA 4E54A 5EMLB 5AJAA 3MMYA 1NR0A 5M5RA 2H6NA 2IUQA 4NSXA 5GXHA 1FWXA 3F3PA 2H6QA 1K3IA 4WJKA 4O02A 4Y7RA 3SWSD 3C75H 4CZYA 2W18A 4WK0A 4RE6A 3RSEC 3JRPA 4FA4D 5GMKn 3OL2A 5CXCA 1Q47A 2AH0A 4UI9R 3VGZA 4ZOXA 3EI1B 3RMZD 3ZDXA 3IVMA 3GFCA 2QZPA 3O4GA 5M5VA 3IJ0A 2UZXB 4NC4A 1A0RB 5HDBA 5FKQA 4FB1D 4K3ID 3QI0A 4GGAA 2VDRA 4BCBA 3EI2A 2B5NA 5HE1B 1K32A 3MZLA 4PXWA 1VE6A 4HDJA 5SXMA 3JZGA 4CY2A 3JB9L 3SFZA 5CYKB 3DXKC 3K72A 5EALA 3AL9A 1XHMA 5IT9g 4A2MA 4PNKB 2VDNA 4AN0A 1S4UX 4PSXB 5A2Qg 4FWWA 3EI1A 3O4IA 3F3FA 1U2VC 4U7AA 4ERYA 4DNVA 4GZ8A 2P9UC 3W15A 3VH0A 3PVUB 3GREA 3RLMD 2QXVA 3IIWA 2XDWA 5THAA 5CXBB 4N14A 1JMZB 3V4VA 2YNNA 3I7OA 3PSCB 2AGZA 3I7LA 2H3XA 3RRMC 4A0AB 3NVXA 4LG8A 2AGXA 5E6SA 3SCYA 4CY3A 3PXWD 3IJCA 2OJYA 4L9OA 4GGCA 2H68A 4L1QD 2J55H 4J73A 2VC2A 3UKRC 4JT5C 2P9SC 2GC7A 3OF7A 2IWKA 2CNXA 1PGUA 2P9KC 2OIZA 5CYKA 2VDKA 3EQ9A 3NVQA 5IJ7E 3MKQA 5HQGA 3N0EA 1UTCA 4YVDA 1B9XA 4FA9D 2EIEA 4GGDA 2YMUA 1JOFA 3EI4B 4BL0A 3HFQA 2YNPA 5EARA 3JZHA 4GM8A 2CE9A 4PC0A 3J80g 1GOFA 5C2VB 2P9LC 3IURA 4JHNA 4NENA 4J81A 4J78A 3UVKA 2HKMA 3VA6A 4A0AA 5JWZA 4ZOVA 5HE0B 2G99A 4JSXC 2CO0A 4PSWB 2OVRB 2TRCB 4LGNA 2BKLA 4X3EA 4QL1A 3V4PA 2B5LA 5CXCB 4JXMA 4CY1A 1JMXB 1C9IA 4A0BB 2EIDA 3DDUA 4Y5RD 1QFSA 3F3GA 4FA1D 3EI4A 4QT8A 4BCCA 4J79A 4OWRA 3PVWB 3I8CA 4FHLA 3FCUA 4CI1A 4JSVC 3SMRA 5GXIA 3UKUC 3GC3B 5IGQA 4MMYA 1H2ZA 3C9CA 3I8EA 2IURA 3OKYB 2OVPB 4WK2A 2QR5A 3RFGA 2VZ1A 2VDPA 3T3MA 2CO0C 3EI2B 2H9LA 4CI3A 2VDOA 4O2WA 5FKTA 5HYNB 2VDLA 1UOQA 3SN6B 3O4HA 4X63B 3EMHA 4G1EA 4QRJA 1JTDB 3PE7A 2B4EA 1GG2B 4DNWA 4ES0A 5C2WB 4AMZA 5M5SA 1GOTB 3ULEC 3EI3B 4O9DA 5TEEA 4A0BA 1MG3A 3QHYB 3FCSA 4AN1A 3SBRA 3UVMA 4CI2A 4Z7QA 4GQBB 2H13A 5FKRA 3RN0D 4U1EI 1GOHA 3OKWA 3OKYA 4D6VA 1SQJA 2H6KA 2IAAA 2PM9B 3CFSB 1GOGA 1QNIA 1H2WA 2P9IC 4UM9A 4AEZA 4TZ4A 3K27A 2OK4A 5H1MA 2IWFA 3UVOA 4ESGA 5K19A 4J84A 4ZOZA 1H2XA 2XU7A 4ZOYA 2PM6B 4BUJC 5EMMB 5C92A 3K71A 3K6SA 5IJ8E 3SVWD 3JZNA 5EAPA 3AFCA 3EI3A 2VDQA 3JAMg 2H9MA 3IJEA 3UVNA 4XEIC 2AH1A 3L4MD 4LG9A 2EIBA 4GM9A 4A7JA 2BBKH 3ZDZA 3IUQA 3I2NA 3I7NA 5HE3B 2XL2A 1SQ9A 3I89A 4OZUA 2PM9A 2O9KA 3O4JA 2XYIA 3FM0A 3NVNA 2HESX 4FAND 2BCJB 4H5JA 4A2LA 3EU7A 4PBZA 1TYQC 1U4CA 4ZN4A 2AGYA 2QC5A 5AMSA 4NAAA 3EWEA 4J0WA 1PEVA 3SBQA 1TYEA 2HKRA 3CIKB 4O45A 3RN1D 2I0TA 3BG1A 3GD1I 3MKSB 2AGLA 1ERJA 2HJ4A 3I7HA 5FA5B 3IULA 1OMWB 1VZ3A 4Z7NA 1OLZA 4JSPC
chains in the Genus database with same CATH topology
2I0RA 4O3TB 3AH8B 3ZWLB 1MG2A 2YNOA 1B9YA 2H14A 2YB8B 3ODTA 2Q7QA 3AL8B 3FRXA 3N0DA 5GSAA 5I5MA 2CN2A 4JD2C 4A09B 3SLED 5AFU3 2I3SA 4PBYA 2I0SA 3K26A 1GP2B 4CC9A 5EMKB 3V7DB 1VYHC 3UR4A 3DWLC 3MZKA 2CN3A 2XL3A 3B7FA 4O3UB 3I7PA 5FQDA 5H14A 4CY5A 2J56H 3SBPA 3AL8A 2P9PC 2H47A 3DSMA 2IUPA 4G56B 4H5IA 2UZYB 3P4FA 2EBSA 4J86A 5TDHB 2Z2OA 4A09A 2GC4A 3UVLA 3JPXA 3BWSA 4GM3A 3E0CA 5FLXg 4IMMA 1TBGA 1YFQA 3SHFA 2IUVA 2HXCA 3DXMC 2Z2PA 3BG0A 2I3TA 1JJUB 4J8BA 2HYEA 3IJ1A 4CI8A 4A08B 2B5MA 1R5MA 3L4OD 3SXTD 4X60B 3V5WB 2G9AA 2H9PA 5FXYA 4J87A 2YBAA 5EM2B 4J82A 1PI6A 4J8GA 3C99A 3KRXB 4R7AB 4O1QD 5K1CC 4JSNC 4E5ZB 3IIYA 4L3HD 4X61B 1RI6A 5KDOB 3C5MA 2PM7B 1N6FA 3I7KA 3EG6A 4KFMB 3PXTD 4ERQA 4FA5D 5HE2B 2OVQB 3RFHA 4J77A 4D0KA 1PBYB 4A08A 2GNQA 3OW8A 3SJLD 1XIPA 4CZXA 4Z8LA 5B4WA 3OKTA 3PXSD 5I5IA 1GXRA 1N6DA 5EM2A 3ORVD 4I79A 5IC7A 4FAVD 4QQEA 2AQ5A 2HJBA 4EWRA 5TEFA 2AGWA 4A11B 4GQ1A 4E5ZA 2CE8A 4L3GD 3U4YA 3IKOA 3MXXA 4K3JB 2Z2NA 5CXBA 4AOWA 3JROA 4GQ2P 1K8KC 5TF2A 5C9ZB 4E54B 3CFVA 1L0QA 4BH6A 3FGBA 5EMJB 2P9NC 4JT6C 3A0FA 4XYHA 2J57G 4CZVA 3J81g 3OL2B 5IGOA 3V9FA 1P22A 1MDAH 3KRWB 1SHYB 1XKSA 4GMBA 2PBIB 4XYIA 5EAMA 2MTAH 1NEXB 3PSLA 4A11A 2OK6A 4IA9A 1N6EA 5I5JA 3OTTA 4ERZA 4J0XA 5H17A 5FKSA 4MK0B 2H9NA 3DM0A 4E54A 5EMLB 5AJAA 3MMYA 1NR0A 2H6NA 2IUQA 4NSXA 5GXHA 1FWXA 3F3PA 2H6QA 3SWSD 4Y7RA 4CZYA 3C75H 2W18A 3RSEC 3JRPA 4FA4D 5GMKn 3OL2A 5CXCA 1Q47A 2AH0A 4UI9R 3VGZA 4ZOXA 3EI1B 3RMZD 3GFCA 3IJ0A 2UZXB 1A0RB 5FKQA 4FB1D 4K3ID 4GGAA 3EI2A 2B5NA 5HE1B 1K32A 3MZLA 4PXWA 4HDJA 5SXMA 3JZGA 4CY2A 3JB9L 3SFZA 5CYKB 3DXKC 5EALA 3AL9A 1XHMA 5IT9g 4A2MA 4PNKB 5A2Qg 1S4UX 4PSXB 3EI1A 4FWWA 3F3FA 1U2VC 4U7AA 4ERYA 4GZ8A 2P9UC 3W15A 3VH0A 3PVUB 3GREA 3RLMD 2QXVA 3IIWA 5THAA 5CXBB 4N14A 1JMZB 2YNNA 3I7OA 3PSCB 2AGZA 3I7LA 2H3XA 3RRMC 4A0AB 3NVXA 4LG8A 2AGXA 3SCYA 4CY3A 3PXWD 3IJCA 2OJYA 4L9OA 4GGCA 2H68A 4L1QD 2J55H 4J73A 3UKRC 4JT5C 2P9SC 2GC7A 2IWKA 2CNXA 1PGUA 2P9KC 2OIZA 5CYKA 3NVQA 5IJ7E 3MKQA 5HQGA 3N0EA 4YVDA 1B9XA 4FA9D 4GGDA 2YMUA 1JOFA 3EI4B 4BL0A 3HFQA 2YNPA 5EARA 3JZHA 4GM8A 2CE9A 4PC0A 3J80g 5C2VB 2P9LC 4J81A 4J78A 3UVKA 2HKMA 3VA6A 4A0AA 5JWZA 4ZOVA 5HE0B 2G99A 4JSXC 2CO0A 4PSWB 2OVRB 2TRCB 4LGNA 4X3EA 4QL1A 2B5LA 5CXCB 4JXMA 4CY1A 1JMXB 4A0BB 4Y5RD 3F3GA 4FA1D 3EI4A 4QT8A 4J79A 4OWRA 3PVWB 3I8CA 4FHLA 4CI1A 4JSVC 3SMRA 5GXIA 3UKUC 5IGQA 3C9CA 3I8EA 2IURA 3OKYB 2OVPB 3RFGA 3EI2B 2CO0C 2H9LA 4CI3A 5FKTA 5HYNB 3SN6B 4X63B 3EMHA 4QRJA 3PE7A 2B4EA 1GG2B 4ES0A 5C2WB 1GOTB 3ULEC 3EI3B 4O9DA 5TEEA 4A0BA 1MG3A 3SBRA 3UVMA 4CI2A 4GQBB 2H13A 5FKRA 3RN0D 4U1EI 3OKWA 3OKYA 4D6VA 1SQJA 2H6KA 2IAAA 2PM9B 3CFSB 1QNIA 2P9IC 4AEZA 4TZ4A 3K27A 2OK4A 5H1MA 2IWFA 3UVOA 4ESGA 5K19A 4J84A 4ZOZA 2XU7A 4ZOYA 2PM6B 4BUJC 5EMMB 5IJ8E 3SVWD 3JZNA 5EAPA 3AFCA 3EI3A 3JAMg 2H9MA 3UVNA 4XEIC 2AH1A 3L4MD 4LG9A 4GM9A 4A7JA 2BBKH 3I2NA 3I7NA 5HE3B 2XL2A 1SQ9A 3I89A 4OZUA 2PM9A 2O9KA 2XYIA 3FM0A 3NVNA 2HESX 4FAND 2BCJB 4H5JA 4A2LA 3EU7A 4PBZA 1TYQC 1U4CA 4ZN4A 2AGYA 2QC5A 5AMSA 3EWEA 4J0WA 1PEVA 3SBQA 2HKRA 3CIKB 4O45A 3RN1D 2I0TA 3BG1A 3MKSB 2AGLA 1ERJA 2HJ4A 3I7HA 5FA5B 1OMWB 1OLZA 4JSPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0R A;  4O3T B;  3AH8 B;  3ZWL B;  1MG2 A;  2YNO A;  1B9Y A;  2H14 A;  2YB8 B;  3ODT A;  2Q7Q A;  3AL8 B;  3FRX A;  3N0D A;  5GSA A;  5I5M A;  2CN2 A;  4JD2 C;  4A09 B;  3SLE D;  5AFU 3;  2I3S A;  4PBY A;  2I0S A;  3K26 A;  1GP2 B;  4CC9 A;  5EMK B;  3V7D B;  1VYH C;  3UR4 A;  3DWL C;  3MZK A;  2CN3 A;  2XL3 A;  3B7F A;  4O3U B;  3I7P A;  5FQD A;  5H14 A;  4CY5 A;  2J56 H;  3SBP A;  3AL8 A;  2P9P C;  2H47 A;  3DSM A;  2IUP A;  4G56 B;  4H5I A;  2UZY B;  3P4F A;  2EBS A;  4J86 A;  5TDH B;  2Z2O A;  4A09 A;  2GC4 A;  3UVL A;  3JPX A;  3BWS A;  4GM3 A;  3E0C A;  5FLX g;  4IMM A;  1TBG A;  1YFQ A;  3SHF A;  2IUV A;  2HXC A;  3DXM C;  2Z2P A;  3BG0 A;  2I3T A;  1JJU B;  4J8B A;  2HYE A;  3IJ1 A;  4CI8 A;  4A08 B;  2B5M A;  1R5M A;  3L4O D;  3SXT D;  4X60 B;  3V5W B;  2G9A A;  2H9P A;  5FXY A;  4J87 A;  2YBA A;  5EM2 B;  4J82 A;  1PI6 A;  4J8G A;  3C99 A;  3KRX B;  4R7A B;  4O1Q D;  5K1C C;  4JSN C;  4E5Z B;  3IIY A;  4L3H D;  4X61 B;  1RI6 A;  5KDO B;  3C5M A;  2PM7 B;  1N6F A;  3I7K A;  3EG6 A;  4KFM B;  3PXT D;  4ERQ A;  4FA5 D;  5HE2 B;  2OVQ B;  3RFH A;  4J77 A;  4D0K A;  1PBY B;  4A08 A;  2GNQ A;  3OW8 A;  3SJL D;  1XIP A;  4CZX A;  4Z8L A;  5B4W A;  3OKT A;  3PXS D;  5I5I A;  1GXR A;  1N6D A;  5EM2 A;  3ORV D;  4I79 A;  5IC7 A;  4FAV D;  4QQE A;  2AQ5 A;  2HJB A;  4EWR A;  5TEF A;  2AGW A;  4A11 B;  4GQ1 A;  4E5Z A;  2CE8 A;  4L3G D;  3U4Y A;  3IKO A;  3MXX A;  4K3J B;  2Z2N A;  5CXB A;  4AOW A;  3JRO A;  4GQ2 P;  1K8K C;  5TF2 A;  5C9Z B;  4E54 B;  3CFV A;  1L0Q A;  4BH6 A;  3FGB A;  5EMJ B;  2P9N C;  4JT6 C;  3A0F A;  4XYH A;  2J57 G;  4CZV A;  3J81 g;  3OL2 B;  5IGO A;  3V9F A;  1P22 A;  1MDA H;  3KRW B;  1SHY B;  1XKS A;  4GMB A;  2PBI B;  4XYI A;  5EAM A;  2MTA H;  1NEX B;  3PSL A;  4A11 A;  2OK6 A;  4IA9 A;  1N6E A;  5I5J A;  3OTT A;  4ERZ A;  4J0X A;  5H17 A;  5FKS A;  4MK0 B;  2H9N A;  3DM0 A;  4E54 A;  5EML B;  5AJA A;  3MMY A;  1NR0 A;  2H6N A;  2IUQ A;  4NSX A;  5GXH A;  1FWX A;  3F3P A;  2H6Q A;  3SWS D;  4Y7R A;  4CZY A;  3C75 H;  2W18 A;  3RSE C;  3JRP A;  4FA4 D;  5GMK n;  3OL2 A;  5CXC A;  1Q47 A;  2AH0 A;  4UI9 R;  3VGZ A;  4ZOX A;  3EI1 B;  3RMZ D;  3GFC A;  3IJ0 A;  2UZX B;  1A0R B;  5FKQ A;  4FB1 D;  4K3I D;  4GGA A;  3EI2 A;  2B5N A;  5HE1 B;  1K32 A;  3MZL A;  4PXW A;  4HDJ A;  5SXM A;  3JZG A;  4CY2 A;  3JB9 L;  3SFZ A;  5CYK B;  3DXK C;  5EAL A;  3AL9 A;  1XHM A;  5IT9 g;  4A2M A;  4PNK B;  5A2Q g;  1S4U X;  4PSX B;  3EI1 A;  4FWW A;  3F3F A;  1U2V C;  4U7A A;  4ERY A;  4GZ8 A;  2P9U C;  3W15 A;  3VH0 A;  3PVU B;  3GRE A;  3RLM D;  2QXV A;  3IIW A;  5THA A;  5CXB B;  4N14 A;  1JMZ B;  2YNN A;  3I7O A;  3PSC B;  2AGZ A;  3I7L A;  2H3X A;  3RRM C;  4A0A B;  3NVX A;  4LG8 A;  2AGX A;  3SCY A;  4CY3 A;  3PXW D;  3IJC A;  2OJY A;  4L9O A;  4GGC A;  2H68 A;  4L1Q D;  2J55 H;  4J73 A;  3UKR C;  4JT5 C;  2P9S C;  2GC7 A;  2IWK A;  2CNX A;  1PGU A;  2P9K C;  2OIZ A;  5CYK A;  3NVQ A;  5IJ7 E;  3MKQ A;  5HQG A;  3N0E A;  4YVD A;  1B9X A;  4FA9 D;  4GGD A;  2YMU A;  1JOF A;  3EI4 B;  4BL0 A;  3HFQ A;  2YNP A;  5EAR A;  3JZH A;  4GM8 A;  2CE9 A;  4PC0 A;  3J80 g;  5C2V B;  2P9L C;  4J81 A;  4J78 A;  3UVK A;  2HKM A;  3VA6 A;  4A0A A;  5JWZ A;  4ZOV A;  5HE0 B;  2G99 A;  4JSX C;  2CO0 A;  4PSW B;  2OVR B;  2TRC B;  4LGN A;  4X3E A;  4QL1 A;  2B5L A;  5CXC B;  4JXM A;  4CY1 A;  1JMX B;  4A0B B;  4Y5R D;  3F3G A;  4FA1 D;  3EI4 A;  4QT8 A;  4J79 A;  4OWR A;  3PVW B;  3I8C A;  4FHL A;  4CI1 A;  4JSV C;  3SMR A;  5GXI A;  3UKU C;  5IGQ A;  3C9C A;  3I8E A;  2IUR A;  3OKY B;  2OVP B;  3RFG A;  3EI2 B;  2CO0 C;  2H9L A;  4CI3 A;  5FKT A;  5HYN B;  3SN6 B;  4X63 B;  3EMH A;  4QRJ A;  3PE7 A;  2B4E A;  1GG2 B;  4ES0 A;  5C2W B;  1GOT B;  3ULE C;  3EI3 B;  4O9D A;  5TEE A;  4A0B A;  1MG3 A;  3SBR A;  3UVM A;  4CI2 A;  4GQB B;  2H13 A;  5FKR A;  3RN0 D;  4U1E I;  3OKW A;  3OKY A;  4D6V A;  1SQJ A;  2H6K A;  2IAA A;  2PM9 B;  3CFS B;  1QNI A;  2P9I C;  4AEZ A;  4TZ4 A;  3K27 A;  2OK4 A;  5H1M A;  2IWF A;  3UVO A;  4ESG A;  5K19 A;  4J84 A;  4ZOZ A;  2XU7 A;  4ZOY A;  2PM6 B;  4BUJ C;  5EMM B;  5IJ8 E;  3SVW D;  3JZN A;  5EAP A;  3AFC A;  3EI3 A;  3JAM g;  2H9M A;  3UVN A;  4XEI C;  2AH1 A;  3L4M D;  4LG9 A;  4GM9 A;  4A7J A;  2BBK H;  3I2N A;  3I7N A;  5HE3 B;  2XL2 A;  1SQ9 A;  3I89 A;  4OZU A;  2PM9 A;  2O9K A;  2XYI A;  3FM0 A;  3NVN A;  2HES X;  4FAN D;  2BCJ B;  4H5J A;  4A2L A;  3EU7 A;  4PBZ A;  1TYQ C;  1U4C A;  4ZN4 A;  2AGY A;  2QC5 A;  5AMS A;  3EWE A;  4J0W A;  1PEV A;  3SBQ A;  2HKR A;  3CIK B;  4O45 A;  3RN1 D;  2I0T A;  3BG1 A;  3MKS B;  2AGL A;  1ERJ A;  2HJ4 A;  3I7H A;  5FA5 B;  1OMW B;  1OLZ A;  4JSP C; 
#chains in the Genus database with same CATH topology
 5C86 A;  2I0R A;  4O3T B;  3AH8 B;  3ZWL B;  1MG2 A;  2YNO A;  3EQ8 A;  1B9Y A;  2H14 A;  2YB8 B;  1E8N A;  2VDM A;  3ODT A;  2Q7Q A;  1U8C A;  4G55 A;  3AL8 B;  3FRX A;  3N0D A;  5M5T A;  5GSA A;  5I5M A;  2CN2 A;  4JD2 C;  5E6U A;  4A09 B;  3ZDY A;  1L5G A;  3SLE D;  5AFU 3;  1A12 A;  2I3S A;  2XE4 A;  4PBY A;  2I0S A;  3K26 A;  1GP2 B;  4CC9 A;  3NIG A;  5EMK B;  3V7D B;  1VYH C;  3UR4 A;  4WK4 A;  3DWL C;  2HU5 A;  3NID A;  3MZK A;  2CN3 A;  2XL3 A;  3B7F A;  4BP8 A;  4O3U B;  4AX4 A;  1C9L A;  3I7P A;  5FQD A;  5H14 A;  4CY5 A;  2J56 H;  3SBP A;  4QAM A;  3AL8 A;  3IUJ A;  2P9P C;  2H47 A;  4RE5 A;  3DSM A;  3VI4 A;  2IUP A;  4G56 B;  4H5I A;  2UZY B;  4JHP C;  5E6R A;  3P4F A;  2EBS A;  4J86 A;  5TDH B;  2Z2O A;  4A09 A;  1I2M B;  4DNU A;  3IUM A;  2GC4 A;  3UVL A;  3JPX A;  3BWS A;  4GM3 A;  1BPO A;  3NIF A;  3E0C A;  5FLX g;  4IMM A;  4AMY A;  3ZE2 A;  3EQ7 A;  1TBG A;  1YFQ A;  3SHF A;  2IUV A;  2HXC A;  3KCI A;  3ZE0 A;  3DXM C;  2Z2P A;  3ZE1 A;  3BG0 A;  2I3T A;  1JJU B;  2VZ3 A;  4J8B A;  2HYE A;  3IJ1 A;  3IUN A;  4CI8 A;  4A08 B;  2B5M A;  1VZ2 A;  1R5M A;  3T3P A;  3L4O D;  3SXT D;  4X60 B;  3V5W B;  4MMX A;  2G9A A;  1YR2 A;  2H9P A;  5FXY A;  4J87 A;  2YBA A;  5EM2 B;  4J82 A;  1PI6 A;  4J8G A;  3C99 A;  3KRX B;  4R7A B;  4O1Q D;  5K1C C;  4JSN C;  3MUO A;  4E5Z B;  3IIY A;  4L3H D;  1H2Y A;  4X61 B;  1RI6 A;  5KDO B;  3C5M A;  2PM7 B;  1N6F A;  3I7K A;  3EG6 A;  4KFM B;  3PXT D;  4ERQ A;  1O6G A;  4FA5 D;  5HE2 B;  1QFM A;  2OVQ B;  3RFH A;  4G1M A;  1JV2 A;  4J77 A;  1UOO A;  4D0K A;  1PBY B;  4NBM A;  4D9S A;  2GNQ A;  4A08 A;  3OW8 A;  3SJL D;  1XIP A;  5FFO A;  4L1M A;  4CZX A;  1M1X A;  4Z8L A;  5B4W A;  3OKT A;  3PXS D;  5I5I A;  1GXR A;  4UM8 A;  1N6D A;  5EM2 A;  3ORV D;  4I79 A;  5IC7 A;  4FAV D;  4MMZ A;  4QQE A;  2AQ5 A;  2HJB A;  4EWR A;  5TEF A;  2AGW A;  4A11 B;  4GQ1 A;  5FFG A;  4E5Z A;  2CE8 A;  4L3G D;  3U4Y A;  3IKO A;  3MXX A;  4K3J B;  2Z2N A;  5CXB A;  4AOW A;  3JRO A;  4GQ2 P;  1K8K C;  5TF2 A;  3MUN A;  5C9Z B;  2HU7 A;  2EIC A;  4Z7O A;  4E54 B;  3CFV A;  1L0Q A;  4BH6 A;  1E5T A;  3FGB A;  5EMJ B;  2P9N C;  4JT6 C;  5M61 A;  3A0F A;  4XYH A;  5M5U A;  2XZG A;  2J57 G;  4CZV A;  1VE7 A;  1E8M A;  3J81 g;  2HU8 A;  3OL2 B;  4IRZ A;  5IGO A;  3V9F A;  1P22 A;  1MDA H;  4BP9 A;  3KRW B;  1SHY B;  1XKS A;  4GMB A;  3MVD K;  2PBI B;  2WQ8 A;  1UOP A;  4XYI A;  5EAM A;  2MTA H;  4BCD A;  1NEX B;  3PSL A;  2JKX A;  4A11 A;  2OK6 A;  4IA9 A;  1N6E A;  5I5J A;  1T2X A;  3OTT A;  4ERZ A;  3VI3 A;  4J0X A;  5H17 A;  5FKS A;  4MK0 B;  2H9N A;  3DM0 A;  1O6F A;  4E54 A;  5EML B;  5AJA A;  3MMY A;  1NR0 A;  5M5R A;  2H6N A;  2IUQ A;  4NSX A;  5GXH A;  1FWX A;  3F3P A;  2H6Q A;  1K3I A;  4WJK A;  4O02 A;  4Y7R A;  3SWS D;  3C75 H;  4CZY A;  2W18 A;  4WK0 A;  4RE6 A;  3RSE C;  3JRP A;  4FA4 D;  5GMK n;  3OL2 A;  5CXC A;  1Q47 A;  2AH0 A;  4UI9 R;  3VGZ A;  4ZOX A;  3EI1 B;  3RMZ D;  3ZDX A;  3IVM A;  3GFC A;  2QZP A;  3O4G A;  5M5V A;  3IJ0 A;  2UZX B;  4NC4 A;  1A0R B;  5HDB A;  5FKQ A;  4FB1 D;  4K3I D;  3QI0 A;  4GGA A;  2VDR A;  4BCB A;  3EI2 A;  2B5N A;  5HE1 B;  1K32 A;  3MZL A;  4PXW A;  1VE6 A;  4HDJ A;  5SXM A;  3JZG A;  4CY2 A;  3JB9 L;  3SFZ A;  5CYK B;  3DXK C;  3K72 A;  5EAL A;  3AL9 A;  1XHM A;  5IT9 g;  4A2M A;  4PNK B;  2VDN A;  4AN0 A;  1S4U X;  4PSX B;  5A2Q g;  4FWW A;  3EI1 A;  3O4I A;  3F3F A;  1U2V C;  4U7A A;  4ERY A;  4DNV A;  4GZ8 A;  2P9U C;  3W15 A;  3VH0 A;  3PVU B;  3GRE A;  3RLM D;  2QXV A;  3IIW A;  2XDW A;  5THA A;  5CXB B;  4N14 A;  1JMZ B;  3V4V A;  2YNN A;  3I7O A;  3PSC B;  2AGZ A;  3I7L A;  2H3X A;  3RRM C;  4A0A B;  3NVX A;  4LG8 A;  2AGX A;  5E6S A;  3SCY A;  4CY3 A;  3PXW D;  3IJC A;  2OJY A;  4L9O A;  4GGC A;  2H68 A;  4L1Q D;  2J55 H;  4J73 A;  2VC2 A;  3UKR C;  4JT5 C;  2P9S C;  2GC7 A;  3OF7 A;  2IWK A;  2CNX A;  1PGU A;  2P9K C;  2OIZ A;  5CYK A;  2VDK A;  3EQ9 A;  3NVQ A;  5IJ7 E;  3MKQ A;  5HQG A;  3N0E A;  1UTC A;  4YVD A;  1B9X A;  4FA9 D;  2EIE A;  4GGD A;  2YMU A;  1JOF A;  3EI4 B;  4BL0 A;  3HFQ A;  2YNP A;  5EAR A;  3JZH A;  4GM8 A;  2CE9 A;  4PC0 A;  3J80 g;  1GOF A;  5C2V B;  2P9L C;  3IUR A;  4JHN A;  4NEN A;  4J81 A;  4J78 A;  3UVK A;  2HKM A;  3VA6 A;  4A0A A;  5JWZ A;  4ZOV A;  5HE0 B;  2G99 A;  4JSX C;  2CO0 A;  4PSW B;  2OVR B;  2TRC B;  4LGN A;  2BKL A;  4X3E A;  4QL1 A;  3V4P A;  2B5L A;  5CXC B;  4JXM A;  4CY1 A;  1JMX B;  1C9I A;  4A0B B;  2EID A;  3DDU A;  4Y5R D;  1QFS A;  3F3G A;  4FA1 D;  3EI4 A;  4QT8 A;  4BCC A;  4J79 A;  4OWR A;  3PVW B;  3I8C A;  4FHL A;  3FCU A;  4CI1 A;  4JSV C;  3SMR A;  5GXI A;  3UKU C;  3GC3 B;  5IGQ A;  4MMY A;  1H2Z A;  3C9C A;  3I8E A;  2IUR A;  3OKY B;  2OVP B;  4WK2 A;  2QR5 A;  3RFG A;  2VZ1 A;  2VDP A;  3T3M A;  2CO0 C;  3EI2 B;  2H9L A;  4CI3 A;  2VDO A;  4O2W A;  5FKT A;  5HYN B;  2VDL A;  1UOQ A;  3SN6 B;  3O4H A;  4X63 B;  3EMH A;  4G1E A;  4QRJ A;  1JTD B;  3PE7 A;  2B4E A;  1GG2 B;  4DNW A;  4ES0 A;  5C2W B;  4AMZ A;  5M5S A;  1GOT B;  3ULE C;  3EI3 B;  4O9D A;  5TEE A;  4A0B A;  1MG3 A;  3QHY B;  3FCS A;  4AN1 A;  3SBR A;  3UVM A;  4CI2 A;  4Z7Q A;  4GQB B;  2H13 A;  5FKR A;  3RN0 D;  4U1E I;  1GOH A;  3OKW A;  3OKY A;  4D6V A;  1SQJ A;  2H6K A;  2IAA A;  2PM9 B;  3CFS B;  1GOG A;  1QNI A;  1H2W A;  2P9I C;  4UM9 A;  4AEZ A;  4TZ4 A;  3K27 A;  2OK4 A;  5H1M A;  2IWF A;  3UVO A;  4ESG A;  5K19 A;  4J84 A;  4ZOZ A;  1H2X A;  2XU7 A;  4ZOY A;  2PM6 B;  4BUJ C;  5EMM B;  5C92 A;  3K71 A;  3K6S A;  5IJ8 E;  3SVW D;  3JZN A;  5EAP A;  3AFC A;  3EI3 A;  2VDQ A;  3JAM g;  2H9M A;  3IJE A;  3UVN A;  4XEI C;  2AH1 A;  3L4M D;  4LG9 A;  2EIB A;  4GM9 A;  4A7J A;  2BBK H;  3ZDZ A;  3IUQ A;  3I2N A;  3I7N A;  5HE3 B;  2XL2 A;  1SQ9 A;  3I89 A;  4OZU A;  2PM9 A;  2O9K A;  3O4J A;  2XYI A;  3FM0 A;  3NVN A;  2HES X;  4FAN D;  2BCJ B;  4H5J A;  4A2L A;  3EU7 A;  4PBZ A;  1TYQ C;  1U4C A;  4ZN4 A;  2AGY A;  2QC5 A;  5AMS A;  4NAA A;  3EWE A;  4J0W A;  1PEV A;  3SBQ A;  1TYE A;  2HKR A;  3CIK B;  4O45 A;  3RN1 D;  2I0T A;  3BG1 A;  3GD1 I;  3MKS B;  2AGL A;  1ERJ A;  2HJ4 A;  3I7H A;  5FA5 B;  3IUL A;  1OMW B;  1VZ3 A;  4Z7N A;  1OLZ A;  4JSP C; 
#chains in the Genus database with same CATH homology
 2I0R A;  4O3T B;  3AH8 B;  3ZWL B;  1MG2 A;  2YNO A;  1B9Y A;  2H14 A;  2YB8 B;  3ODT A;  2Q7Q A;  3AL8 B;  3FRX A;  3N0D A;  5GSA A;  5I5M A;  2CN2 A;  4JD2 C;  4A09 B;  3SLE D;  5AFU 3;  2I3S A;  4PBY A;  2I0S A;  3K26 A;  1GP2 B;  4CC9 A;  5EMK B;  3V7D B;  1VYH C;  3UR4 A;  3DWL C;  3MZK A;  2CN3 A;  2XL3 A;  3B7F A;  4O3U B;  3I7P A;  5FQD A;  5H14 A;  4CY5 A;  2J56 H;  3SBP A;  3AL8 A;  2P9P C;  2H47 A;  3DSM A;  2IUP A;  4G56 B;  4H5I A;  2UZY B;  3P4F A;  2EBS A;  4J86 A;  5TDH B;  2Z2O A;  4A09 A;  2GC4 A;  3UVL A;  3JPX A;  3BWS A;  4GM3 A;  3E0C A;  5FLX g;  4IMM A;  1TBG A;  1YFQ A;  3SHF A;  2IUV A;  2HXC A;  3DXM C;  2Z2P A;  3BG0 A;  2I3T A;  1JJU B;  4J8B A;  2HYE A;  3IJ1 A;  4CI8 A;  4A08 B;  2B5M A;  1R5M A;  3L4O D;  3SXT D;  4X60 B;  3V5W B;  2G9A A;  2H9P A;  5FXY A;  4J87 A;  2YBA A;  5EM2 B;  4J82 A;  1PI6 A;  4J8G A;  3C99 A;  3KRX B;  4R7A B;  4O1Q D;  5K1C C;  4JSN C;  4E5Z B;  3IIY A;  4L3H D;  4X61 B;  1RI6 A;  5KDO B;  3C5M A;  2PM7 B;  1N6F A;  3I7K A;  3EG6 A;  4KFM B;  3PXT D;  4ERQ A;  4FA5 D;  5HE2 B;  2OVQ B;  3RFH A;  4J77 A;  4D0K A;  1PBY B;  4A08 A;  2GNQ A;  3OW8 A;  3SJL D;  1XIP A;  4CZX A;  4Z8L A;  5B4W A;  3OKT A;  3PXS D;  5I5I A;  1GXR A;  1N6D A;  5EM2 A;  3ORV D;  4I79 A;  5IC7 A;  4FAV D;  4QQE A;  2AQ5 A;  2HJB A;  4EWR A;  5TEF A;  2AGW A;  4A11 B;  4GQ1 A;  4E5Z A;  2CE8 A;  4L3G D;  3U4Y A;  3IKO A;  3MXX A;  4K3J B;  2Z2N A;  5CXB A;  4AOW A;  3JRO A;  4GQ2 P;  1K8K C;  5TF2 A;  5C9Z B;  4E54 B;  3CFV A;  1L0Q A;  4BH6 A;  3FGB A;  5EMJ B;  2P9N C;  4JT6 C;  3A0F A;  4XYH A;  2J57 G;  4CZV A;  3J81 g;  3OL2 B;  5IGO A;  3V9F A;  1P22 A;  1MDA H;  3KRW B;  1SHY B;  1XKS A;  4GMB A;  2PBI B;  4XYI A;  5EAM A;  2MTA H;  1NEX B;  3PSL A;  4A11 A;  2OK6 A;  4IA9 A;  1N6E A;  5I5J A;  3OTT A;  4ERZ A;  4J0X A;  5H17 A;  5FKS A;  4MK0 B;  2H9N A;  3DM0 A;  4E54 A;  5EML B;  5AJA A;  3MMY A;  1NR0 A;  2H6N A;  2IUQ A;  4NSX A;  5GXH A;  1FWX A;  3F3P A;  2H6Q A;  3SWS D;  4Y7R A;  4CZY A;  3C75 H;  2W18 A;  3RSE C;  3JRP A;  4FA4 D;  5GMK n;  3OL2 A;  5CXC A;  1Q47 A;  2AH0 A;  4UI9 R;  3VGZ A;  4ZOX A;  3EI1 B;  3RMZ D;  3GFC A;  3IJ0 A;  2UZX B;  1A0R B;  5FKQ A;  4FB1 D;  4K3I D;  4GGA A;  3EI2 A;  2B5N A;  5HE1 B;  1K32 A;  3MZL A;  4PXW A;  4HDJ A;  5SXM A;  3JZG A;  4CY2 A;  3JB9 L;  3SFZ A;  5CYK B;  3DXK C;  5EAL A;  3AL9 A;  1XHM A;  5IT9 g;  4A2M A;  4PNK B;  5A2Q g;  1S4U X;  4PSX B;  3EI1 A;  4FWW A;  3F3F A;  1U2V C;  4U7A A;  4ERY A;  4GZ8 A;  2P9U C;  3W15 A;  3VH0 A;  3PVU B;  3GRE A;  3RLM D;  2QXV A;  3IIW A;  5THA A;  5CXB B;  4N14 A;  1JMZ B;  2YNN A;  3I7O A;  3PSC B;  2AGZ A;  3I7L A;  2H3X A;  3RRM C;  4A0A B;  3NVX A;  4LG8 A;  2AGX A;  3SCY A;  4CY3 A;  3PXW D;  3IJC A;  2OJY A;  4L9O A;  4GGC A;  2H68 A;  4L1Q D;  2J55 H;  4J73 A;  3UKR C;  4JT5 C;  2P9S C;  2GC7 A;  2IWK A;  2CNX A;  1PGU A;  2P9K C;  2OIZ A;  5CYK A;  3NVQ A;  5IJ7 E;  3MKQ A;  5HQG A;  3N0E A;  4YVD A;  1B9X A;  4FA9 D;  4GGD A;  2YMU A;  1JOF A;  3EI4 B;  4BL0 A;  3HFQ A;  2YNP A;  5EAR A;  3JZH A;  4GM8 A;  2CE9 A;  4PC0 A;  3J80 g;  5C2V B;  2P9L C;  4J81 A;  4J78 A;  3UVK A;  2HKM A;  3VA6 A;  4A0A A;  5JWZ A;  4ZOV A;  5HE0 B;  2G99 A;  4JSX C;  2CO0 A;  4PSW B;  2OVR B;  2TRC B;  4LGN A;  4X3E A;  4QL1 A;  2B5L A;  5CXC B;  4JXM A;  4CY1 A;  1JMX B;  4A0B B;  4Y5R D;  3F3G A;  4FA1 D;  3EI4 A;  4QT8 A;  4J79 A;  4OWR A;  3PVW B;  3I8C A;  4FHL A;  4CI1 A;  4JSV C;  3SMR A;  5GXI A;  3UKU C;  5IGQ A;  3C9C A;  3I8E A;  2IUR A;  3OKY B;  2OVP B;  3RFG A;  3EI2 B;  2CO0 C;  2H9L A;  4CI3 A;  5FKT A;  5HYN B;  3SN6 B;  4X63 B;  3EMH A;  4QRJ A;  3PE7 A;  2B4E A;  1GG2 B;  4ES0 A;  5C2W B;  1GOT B;  3ULE C;  3EI3 B;  4O9D A;  5TEE A;  4A0B A;  1MG3 A;  3SBR A;  3UVM A;  4CI2 A;  4GQB B;  2H13 A;  5FKR A;  3RN0 D;  4U1E I;  3OKW A;  3OKY A;  4D6V A;  1SQJ A;  2H6K A;  2IAA A;  2PM9 B;  3CFS B;  1QNI A;  2P9I C;  4AEZ A;  4TZ4 A;  3K27 A;  2OK4 A;  5H1M A;  2IWF A;  3UVO A;  4ESG A;  5K19 A;  4J84 A;  4ZOZ A;  2XU7 A;  4ZOY A;  2PM6 B;  4BUJ C;  5EMM B;  5IJ8 E;  3SVW D;  3JZN A;  5EAP A;  3AFC A;  3EI3 A;  3JAM g;  2H9M A;  3UVN A;  4XEI C;  2AH1 A;  3L4M D;  4LG9 A;  4GM9 A;  4A7J A;  2BBK H;  3I2N A;  3I7N A;  5HE3 B;  2XL2 A;  1SQ9 A;  3I89 A;  4OZU A;  2PM9 A;  2O9K A;  2XYI A;  3FM0 A;  3NVN A;  2HES X;  4FAN D;  2BCJ B;  4H5J A;  4A2L A;  3EU7 A;  4PBZ A;  1TYQ C;  1U4C A;  4ZN4 A;  2AGY A;  2QC5 A;  5AMS A;  3EWE A;  4J0W A;  1PEV A;  3SBQ A;  2HKR A;  3CIK B;  4O45 A;  3RN1 D;  2I0T A;  3BG1 A;  3MKS B;  2AGL A;  1ERJ A;  2HJ4 A;  3I7H A;  5FA5 B;  1OMW B;  1OLZ A;  4JSP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...