2I0SA

Crystal structure of aromatic amine dehydrogenase ttq-phenylacetaldehyde adduct
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
360
structure length
360
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
total genus 99
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i0sA01
3I2NA 1PI6A 5AJAA 5EALA 2YMUA 2GC4A 4ERZA 1Q47A 4EWRA 4E5ZA 3FGBA 3FRXA 1N6DA 2B5MA 4NSXA 4GQ1A 5HE1B 4A11B 4PXWA 3SFZA 1B9XA 3IKOA 2PM6B 3EI2A 3OL2A 2OIZA 2P9IC 3PXSD 4ES0A 1N6EA 1MDAH 4LG9A 3OKWA 2G99A 2H13A 2HJ4A 4BUJC 5FA5B 3I7PA 4BL0A 3RN0D 3OKYB 2W18A 3ODTA 3I8EA 1MG3A 2J55H 4JT5C 4X61B 4A0AB 4ZOVA 2CE8A 3CIKB 2CNXA 5IJ7E 2H6KA 1B9YA 4E54A 2H9PA 4GM9A 4J87A 5B4WA 5EAMA 3C9CA 4A11A 4FA1D 2XL3A 3UVOA 5EM2A 4QRJA 2IUVA 3L4OD 5TDHB 3EI4B 5HQGA 3EI1B 2IAAA 3JRPA 2GNQA 5FLXg 1JMXB 2H9MA 4FWWA 2I0TA 4FA9D 3AFCA 3IIWA 2TRCB 3RN1D 1N6FA 3JROA 2CO0C 4CY3A 4BH6A 3AL9A 3RSEC 4O3TB 5HYNB 4A0BA 5TF2A 5H1MA 4FA4D 2BCJB 4XYIA 2IWFA 4JT6C 2XYIA 3I7HA 5H17A 1XHMA 4J0XA 4GM3A 5KDOB 3V9FA 2I0SA 3DXKC 3EI4A 5IGOA 1GXRA 4J79A 3F3PA 1A0RB 2GC7A 5GXHA 3SN6B 4H5JA 3VGZA 4CI8A 4O45A 4L9OA 4J81A 3SMRA 3K27A 5EMKB 2J57G 3PE7A 3AL8A 4AOWA 5AFU3 1L0QA 4E5ZB 2H6NA 3SBPA 3KRWB 2YNOA 1OLZA 4JSNC 4X60B 3VA6A 4PC0A 3EI2B 3OL2B 2I0RA 3UKRC 4ERYA 3C5MA 1GOTB 4X63B 5IJ8E 2H6QA 3ZWLB 4GZ8A 3BG0A 3C99A 4L3HD 1PEVA 2HKRA 4PBYA 5IGQA 3N0EA 4J82A 1QNIA 4PSXB 3P4FA 3L4MD 4FAVD 2OVQB 5FKSA 1P22A 4AEZA 3SWSD 3BWSA 4E54B 2IWKA 3C75H 4ZN4A 4Y5RD 5EM2B 2Z2OA 1FWXA 3B7FA 2I3SA 3FM0A 3DM0A 4JSXC 3GREA 2QC5A 2HJBA 1TBGA 2J56H 4J84A 4QQEA 3UKUC 3I7NA 4A2MA 4UI9R 1SHYB 4A0BB 5I5MA 4FHLA 5IT9g 1K8KC 3I8CA 4FAND 1XKSA 5GXIA 2OJYA 1NR0A 4H5IA 5GMKn 2B4EA 4J78A 4GGDA 2OVPB 1NEXB 4IA9A 3DWLC 2H68A 2CN3A 1JOFA 3DSMA 5CXCA 5EMMB 3EI3B 5TEFA 5C2VB 4PBZA 2HKMA 4A09A 5HE0B 4CZVA 4R7AB 3UVLA 4J8BA 3I7LA 2PM9A 3AL8B 3NVXA 2HYEA 4O1QD 3UVMA 4L1QD 3J80g 1S4UX 2P9SC 4CY5A 1PBYB 2P9KC 2H9NA 3NVNA 5EMJB 5C2WB 2PM7B 4LGNA 4CY1A 3RLMD 4J73A 1R5MA 4XYHA 2HXCA 3EI3A 3RMZD 3DXMC 2IUQA 4J0WA 3SHFA 1JJUB 2AGZA 3MZKA 1SQ9A 4FB1D 4FA5D 3E0CA 3KRXB 5JWZA 4OWRA 1K32A 3SJLD 4CI2A 3PVWB 5FKQA 5EAPA 4CZXA 4CI3A 2AH1A 4CY2A 4GGAA 3HFQA 4JSPC 5EARA 4O9DA 5CYKA 3SLED 3A0FA 4YVDA 4GGCA 2UZYB 5K19A 4CZYA 4A2LA 2P9UC 5CXBA 5FKTA 1U2VC 4LG8A 4A7JA 3JPXA 5IC7A 4ERQA 5FKRA 5H14A 1U4CA 2CE9A 4ZOXA 2YNPA 4Z8LA 2Z2PA 4GQ2P 5FXYA 3J81g 3EWEA 3I7KA 4D6VA 1PGUA 4I79A 4K3ID 4JD2C 4G56B 4K3JB 4D0KA 3NVQA 4A08A 4PNKB 4U1EI 2AGXA 3U4YA 4TZ4A 3RRMC 2XL2A 4JSVC 5TEEA 5I5JA 5GSAA 5CXCB 1VYHC 3K26A 4J8GA 1GG2B 4A09B 3V7DB 4KFMB 2XU7A 1ERJA 1SQJA 1YFQA 3EG6A 4CI1A 2PM9B 4GMBA 3OKTA 3IIYA 3SVWD 2P9NC 3I7OA 3V5WB 5C9ZB 3IJ0A 2QXVA 3MMYA 3EMHA 2G9AA 4XEIC 3UR4A 3JZGA 2AH0A 5FQDA 1RI6A 3MKQA 3UVNA 4MK0B 3SBQA 2AGWA 5K1CC 3RFHA 1MG2A 2Z2NA 1GP2B 3OTTA 5HE3B 2AQ5A 3PSLA 3MZLA 2B5NA 4HDJA 2I3TA 1TYQC 2CO0A 3OKYA 3IJCA 3I89A 4X3EA 2HESX 2OK4A 2PBIB 5SXMA 3SXTD 3PVUB 3ORVD 4A0AA 2B5LA 2IURA 4GQBB 5CYKB 2H47A 4Y7RA 2EBSA 4J77A 2P9LC 4N14A 4ZOYA 3PXTD 4PSWB 4ESGA 5CXBB 2YB8B 5AMSA 4CC9A 3SBRA 4JXMA 2H9LA 2P9PC 3EI1A 2OVRB 3F3GA 3CFSB 2UZXB 3GFCA 3MXXA 2AGYA 3N0DA 4L3GD 4U7AA 2O9KA 3AH8B 4ZOZA 2IUPA 3JAMg 1XIPA 2BBKH 3PSCB 4A08B 4OZUA 5I5IA 2CN2A 3MKSB 5THAA 3IJ1A 2AGLA 4QT8A 3UVKA 4O3UB 3BG1A 2OK6A 5EMLB 5A2Qg 3OW8A 2H14A 1OMWB 4IMMA 4QL1A 3F3FA 3JZNA 3PXWD 3W15A 3RFGA 3VH0A 5HE2B 2YBAA 4GM8A 1JMZB 2YNNA 3SCYA 3JB9L 2MTAH 2Q7QA 3EU7A 3ULEC 3JZHA 2H3XA 3CFVA 4J86A
chains in the Genus database with same CATH superfamily
4Z7OA 1C9IA 3I2NA 1PI6A 2VDNA 5AJAA 5EALA 4AMZA 2YMUA 2GC4A 4ERZA 5C92A 1Q47A 4EWRA 1L5GA 4E5ZA 3FGBA 3FRXA 2VDMA 1N6DA 2B5MA 1VE7A 3DDUA 4NBMA 4NSXA 3IUMA 4GQ1A 4MMYA 5HE1B 4A11B 4PXWA 3SFZA 1B9XA 3IKOA 2PM6B 3EI2A 3OL2A 2OIZA 2P9IC 3PXSD 4ES0A 1N6EA 1MDAH 4LG9A 3OKWA 2G99A 2H13A 2HJ4A 3QI0A 5FA5B 4BUJC 3I7PA 3ZDYA 4BL0A 3RN0D 4DNUA 3OKYB 2W18A 3ODTA 3I8EA 1MG3A 2J55H 4JT5C 4X61B 4A0AB 4G55A 4MMZA 4ZOVA 4AN0A 4AN1A 2CE8A 3CIKB 2CNXA 5IJ7E 2H6KA 1B9YA 4E54A 2H9PA 4GM9A 4J87A 5M61A 5B4WA 1K3IA 3C9CA 4MMXA 5EAMA 4A11A 4FA1D 2XL3A 3UVOA 5EM2A 4QRJA 2IUVA 3L4OD 3QHYB 5TDHB 4G1EA 3EI4B 5HQGA 3EI1B 2IAAA 3JRPA 2GNQA 5FLXg 2JKXA 1JMXB 2H9MA 4FWWA 2I0TA 4FA9D 3AFCA 3ZDZA 3IIWA 2TRCB 3RN1D 1N6FA 3FCSA 3JROA 2CO0C 2VDLA 4CY3A 4BH6A 1UOPA 3AL9A 3RSEC 4O3TB 5HYNB 4A0BA 5TF2A 5H1MA 4FA4D 2BCJB 4WJKA 4XYIA 3EQ8A 2IWFA 4JT6C 2XYIA 3I7HA 4JHNA 1GOHA 5H17A 3K71A 1XHMA 4J0XA 4GM3A 5KDOB 3V9FA 2I0SA 3DXKC 3EI4A 5IGOA 1GXRA 4J79A 3F3PA 1A0RB 2GC7A 5GXHA 3O4IA 5M5RA 3SN6B 2HU5A 4H5JA 3VGZA 4CI8A 4O45A 4L9OA 4J81A 4NAAA 5C86A 3SMRA 3K27A 5EMKB 2J57G 3PE7A 3AL8A 4AOWA 5AFU3 1L0QA 1YR2A 4G1MA 4E5ZB 2H6NA 3SBPA 3KRWB 5FFOA 2YNOA 4BP8A 1H2ZA 1OLZA 4JSNC 4QAMA 4DNWA 4X60B 3ZE0A 3VA6A 4PC0A 3EI2B 3OL2B 2I0RA 3UKRC 4ERYA 3C5MA 1GOTB 2BKLA 4X63B 1VZ3A 3FCUA 4NC4A 5IJ8E 2H6QA 3ZWLB 4GZ8A 3O4HA 3EQ9A 3BG0A 3C99A 4L3HD 1PEVA 2HKRA 4PBYA 5IGQA 3N0EA 4J82A 1QNIA 4PSXB 3P4FA 3L4MD 3NIDA 3T3PA 4FAVD 2OVQB 5FKSA 1P22A 3NIFA 3VI4A 3SWSD 3BWSA 4AEZA 4E54B 2IWKA 3C75H 3O4GA 1JTDB 3GC3B 4Y5RD 4ZN4A 5EM2B 2Z2OA 1VE6A 1FWXA 3B7FA 2I3SA 3FM0A 3IULA 2QR5A 1GOGA 3DM0A 3GD1I 1E8MA 4JSXC 3GREA 2QC5A 2HU8A 4BCBA 2QZPA 1GOFA 2HJBA 2VDKA 1TBGA 2J56H 4J84A 4QQEA 2EICA 3UKUC 1QFSA 3I7NA 4A2MA 4UI9R 1SHYB 4A0BB 5I5MA 4FHLA 5IT9g 1K8KC 1QFMA 5E6UA 3I8CA 2WQ8A 4FAND 1XKSA 5GXIA 2OJYA 2XE4A 1NR0A 3IJEA 4H5IA 5GMKn 2B4EA 4J78A 4GGDA 2OVPB 1NEXB 4IA9A 4UM9A 3DWLC 2H68A 2CN3A 1JOFA 3DSMA 5CXCA 5EMMB 3EI3B 5TEFA 4IRZA 5C2VB 4PBZA 2HKMA 4UM8A 4A09A 5HE0B 1E8NA 4CZVA 4R7AB 3UVLA 4J8BA 3I7LA 2PM9A 3AL8B 3NVXA 2HYEA 3O4JA 4O1QD 3UVMA 4L1QD 3J80g 1O6FA 1S4UX 2P9SC 4CY5A 1PBYB 2P9KC 2H9NA 3MUOA 3NVNA 5EMJB 4RE6A 5C2WB 2PM7B 4Z7NA 3V4PA 4LGNA 4CY1A 3MVDK 3RLMD 1VZ2A 2VC2A 4J73A 1R5MA 4XYHA 1H2YA 2HXCA 3EI3A 3RMZD 3DXMC 2IUQA 4J0WA 3SHFA 3VI3A 2VZ3A 1JJUB 2AGZA 3MZKA 1SQ9A 4BCDA 4FB1D 4FA5D 3E0CA 3KRXB 1BPOA 5JWZA 4OWRA 1K32A 3SJLD 4CI2A 3PVWB 4DNVA 5FKQA 5EAPA 4CZXA 4CI3A 5M5TA 2AH1A 4CY2A 2VDPA 4GGAA 3HFQA 4JSPC 1TYEA 5EARA 4O9DA 5CYKA 3SLED 3A0FA 4YVDA 4WK4A 4GGCA 1H2WA 2UZYB 4WK0A 5K19A 4CZYA 4A2LA 2P9UC 5CXBA 5FKTA 1U2VC 4LG8A 4A7JA 1UOOA 3JPXA 5IC7A 3IUJA 2EIEA 3IUNA 5FKRA 5H14A 4ERQA 1U4CA 2CE9A 1UOQA 2VZ1A 4ZOXA 2YNPA 4O02A 4Z8LA 2Z2PA 4GQ2P 5FXYA 3J81g 3EWEA 2XDWA 3I7KA 4D6VA 1PGUA 4I79A 4K3ID 4JD2C 4G56B 4K3JB 4D0KA 3NVQA 4A08A 4PNKB 4U1EI 2AGXA 3U4YA 4L1MA 4TZ4A 3RRMC 2XL2A 4JSVC 5TEEA 5I5JA 5GSAA 2EIBA 5E6RA 5CXCB 1VYHC 3K26A 4J8GA 4BP9A 1GG2B 4A09B 3V7DB 4KFMB 3KCIA 2XU7A 4JHPC 1ERJA 1H2XA 1SQJA 1YFQA 3EG6A 4CI1A 1M1XA 2EIDA 2PM9B 4GMBA 5M5UA 3OKTA 3NIGA 4O2WA 2XZGA 4WK2A 1O6GA 3IIYA 3SVWD 3ZDXA 2P9NC 3I7OA 5M5VA 4AX4A 3V5WB 5C9ZB 3IJ0A 2QXVA 3MMYA 3EMHA 2G9AA 4XEIC 3UR4A 3EQ7A 3JZGA 2AH0A 5FQDA 1RI6A 3IVMA 3MKQA 4RE5A 1UTCA 3UVNA 4MK0B 3SBQA 2AGWA 5K1CC 3RFHA 1MG2A 1T2XA 2Z2NA 2VDRA 1GP2B 3OTTA 5HE3B 2AQ5A 3PSLA 3MZLA 2B5NA 4HDJA 2I3TA 1U8CA 1TYQC 2CO0A 5HDBA 2HU7A 3OKYA 3IJCA 1I2MB 3I89A 4X3EA 2HESX 2OK4A 1JV2A 2PBIB 5SXMA 3SXTD 3T3MA 3PVUB 3ORVD 4A0AA 3V4VA 2B5LA 2IURA 4GQBB 5CYKB 2H47A 5FFGA 3MUNA 4Y7RA 2EBSA 4J77A 2P9LC 4N14A 4Z7QA 4ZOYA 4NENA 3PXTD 4PSWB 4ESGA 5M5SA 5CXBB 2YB8B 5AMSA 3OF7A 4CC9A 3SBRA 4JXMA 2H9LA 2P9PC 2VDOA 2OVRB 3EI1A 5E6SA 3F3GA 3CFSB 2UZXB 3K72A 3GFCA 3MXXA 2AGYA 3N0DA 4L3GD 4U7AA 2O9KA 3AH8B 3K6SA 4ZOZA 2IUPA 3JAMg 1XIPA 2BBKH 3PSCB 4A08B 4OZUA 5I5IA 3IURA 2CN2A 3MKSB 5THAA 3IJ1A 3ZE2A 2AGLA 4QT8A 3UVKA 4O3UB 3BG1A 4D9SA 2OK6A 5EMLB 5A2Qg 3OW8A 2H14A 1OMWB 4IMMA 4QL1A 4AMYA 3F3FA 3JZNA 3PXWD 3IUQA 3ZE1A 3W15A 3RFGA 3VH0A 5HE2B 2YBAA 4GM8A 2VDQA 1C9LA 1JMZB 2YNNA 3SCYA 3JB9L 2MTAH 2Q7QA 3EU7A 3ULEC 1A12A 3JZHA 1E5TA 4BCCA 2H3XA 3CFVA 4J86A
chains in the Genus database with same CATH topology
3I2NA 1PI6A 5AJAA 5EALA 2YMUA 2GC4A 4ERZA 1Q47A 4EWRA 4E5ZA 3FGBA 3FRXA 1N6DA 2B5MA 4NSXA 4GQ1A 5HE1B 4A11B 4PXWA 3SFZA 1B9XA 3IKOA 2PM6B 3EI2A 3OL2A 2OIZA 2P9IC 3PXSD 4ES0A 1N6EA 1MDAH 4LG9A 3OKWA 2G99A 2H13A 2HJ4A 4BUJC 5FA5B 3I7PA 4BL0A 3RN0D 3OKYB 2W18A 3ODTA 3I8EA 1MG3A 2J55H 4JT5C 4X61B 4A0AB 4ZOVA 2CE8A 3CIKB 2CNXA 5IJ7E 2H6KA 1B9YA 4E54A 2H9PA 4GM9A 4J87A 5B4WA 5EAMA 3C9CA 4A11A 4FA1D 2XL3A 3UVOA 5EM2A 4QRJA 2IUVA 3L4OD 5TDHB 3EI4B 5HQGA 3EI1B 2IAAA 3JRPA 2GNQA 5FLXg 1JMXB 2H9MA 4FWWA 2I0TA 4FA9D 3AFCA 3IIWA 2TRCB 3RN1D 1N6FA 3JROA 2CO0C 4CY3A 4BH6A 3AL9A 3RSEC 4O3TB 5HYNB 4A0BA 5TF2A 5H1MA 4FA4D 2BCJB 4XYIA 2IWFA 4JT6C 2XYIA 3I7HA 5H17A 1XHMA 4J0XA 4GM3A 5KDOB 3V9FA 2I0SA 3DXKC 3EI4A 5IGOA 1GXRA 4J79A 3F3PA 1A0RB 2GC7A 5GXHA 3SN6B 4H5JA 3VGZA 4CI8A 4O45A 4L9OA 4J81A 3SMRA 3K27A 5EMKB 2J57G 3PE7A 3AL8A 4AOWA 5AFU3 1L0QA 4E5ZB 2H6NA 3SBPA 3KRWB 2YNOA 1OLZA 4JSNC 4X60B 3VA6A 4PC0A 3EI2B 3OL2B 2I0RA 3UKRC 4ERYA 3C5MA 1GOTB 4X63B 5IJ8E 2H6QA 3ZWLB 4GZ8A 3BG0A 3C99A 4L3HD 1PEVA 2HKRA 4PBYA 5IGQA 3N0EA 4J82A 1QNIA 4PSXB 3P4FA 3L4MD 4FAVD 2OVQB 5FKSA 1P22A 4AEZA 3SWSD 3BWSA 4E54B 2IWKA 3C75H 4ZN4A 4Y5RD 5EM2B 2Z2OA 1FWXA 3B7FA 2I3SA 3FM0A 3DM0A 4JSXC 3GREA 2QC5A 2HJBA 1TBGA 2J56H 4J84A 4QQEA 3UKUC 3I7NA 4A2MA 4UI9R 1SHYB 4A0BB 5I5MA 4FHLA 5IT9g 1K8KC 3I8CA 4FAND 1XKSA 5GXIA 2OJYA 1NR0A 4H5IA 5GMKn 2B4EA 4J78A 4GGDA 2OVPB 1NEXB 4IA9A 3DWLC 2H68A 2CN3A 1JOFA 3DSMA 5CXCA 5EMMB 3EI3B 5TEFA 5C2VB 4PBZA 2HKMA 4A09A 5HE0B 4CZVA 4R7AB 3UVLA 4J8BA 3I7LA 2PM9A 3AL8B 3NVXA 2HYEA 4O1QD 3UVMA 4L1QD 3J80g 1S4UX 2P9SC 4CY5A 1PBYB 2P9KC 2H9NA 3NVNA 5EMJB 5C2WB 2PM7B 4LGNA 4CY1A 3RLMD 4J73A 1R5MA 4XYHA 2HXCA 3EI3A 3RMZD 3DXMC 2IUQA 4J0WA 3SHFA 1JJUB 2AGZA 3MZKA 1SQ9A 4FB1D 4FA5D 3E0CA 3KRXB 5JWZA 4OWRA 1K32A 3SJLD 4CI2A 3PVWB 5FKQA 5EAPA 4CZXA 4CI3A 2AH1A 4CY2A 4GGAA 3HFQA 4JSPC 5EARA 4O9DA 5CYKA 3SLED 3A0FA 4YVDA 4GGCA 2UZYB 5K19A 4CZYA 4A2LA 2P9UC 5CXBA 5FKTA 1U2VC 4LG8A 4A7JA 3JPXA 5IC7A 4ERQA 5FKRA 5H14A 1U4CA 2CE9A 4ZOXA 2YNPA 4Z8LA 2Z2PA 4GQ2P 5FXYA 3J81g 3EWEA 3I7KA 4D6VA 1PGUA 4I79A 4K3ID 4JD2C 4G56B 4K3JB 4D0KA 3NVQA 4A08A 4PNKB 4U1EI 2AGXA 3U4YA 4TZ4A 3RRMC 2XL2A 4JSVC 5TEEA 5I5JA 5GSAA 5CXCB 1VYHC 3K26A 4J8GA 1GG2B 4A09B 3V7DB 4KFMB 2XU7A 1ERJA 1SQJA 1YFQA 3EG6A 4CI1A 2PM9B 4GMBA 3OKTA 3IIYA 3SVWD 2P9NC 3I7OA 3V5WB 5C9ZB 3IJ0A 2QXVA 3MMYA 3EMHA 2G9AA 4XEIC 3UR4A 3JZGA 2AH0A 5FQDA 1RI6A 3MKQA 3UVNA 4MK0B 3SBQA 2AGWA 5K1CC 3RFHA 1MG2A 2Z2NA 1GP2B 3OTTA 5HE3B 2AQ5A 3PSLA 3MZLA 2B5NA 4HDJA 2I3TA 1TYQC 2CO0A 3OKYA 3IJCA 3I89A 4X3EA 2HESX 2OK4A 2PBIB 5SXMA 3SXTD 3PVUB 3ORVD 4A0AA 2B5LA 2IURA 4GQBB 5CYKB 2H47A 4Y7RA 2EBSA 4J77A 2P9LC 4N14A 4ZOYA 3PXTD 4PSWB 4ESGA 5CXBB 2YB8B 5AMSA 4CC9A 3SBRA 4JXMA 2H9LA 2P9PC 3EI1A 2OVRB 3F3GA 3CFSB 2UZXB 3GFCA 3MXXA 2AGYA 3N0DA 4L3GD 4U7AA 2O9KA 3AH8B 4ZOZA 2IUPA 3JAMg 1XIPA 2BBKH 3PSCB 4A08B 4OZUA 5I5IA 2CN2A 3MKSB 5THAA 3IJ1A 2AGLA 4QT8A 3UVKA 4O3UB 3BG1A 2OK6A 5EMLB 5A2Qg 3OW8A 2H14A 1OMWB 4IMMA 4QL1A 3F3FA 3JZNA 3PXWD 3W15A 3RFGA 3VH0A 5HE2B 2YBAA 4GM8A 1JMZB 2YNNA 3SCYA 3JB9L 2MTAH 2Q7QA 3EU7A 3ULEC 3JZHA 2H3XA 3CFVA 4J86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I2N A;  1PI6 A;  5AJA A;  5EAL A;  2YMU A;  2GC4 A;  4ERZ A;  1Q47 A;  4EWR A;  4E5Z A;  3FGB A;  3FRX A;  1N6D A;  2B5M A;  4NSX A;  4GQ1 A;  5HE1 B;  4A11 B;  4PXW A;  3SFZ A;  1B9X A;  3IKO A;  2PM6 B;  3EI2 A;  3OL2 A;  2OIZ A;  2P9I C;  3PXS D;  4ES0 A;  1N6E A;  1MDA H;  4LG9 A;  3OKW A;  2G99 A;  2H13 A;  2HJ4 A;  4BUJ C;  5FA5 B;  3I7P A;  4BL0 A;  3RN0 D;  3OKY B;  2W18 A;  3ODT A;  3I8E A;  1MG3 A;  2J55 H;  4JT5 C;  4X61 B;  4A0A B;  4ZOV A;  2CE8 A;  3CIK B;  2CNX A;  5IJ7 E;  2H6K A;  1B9Y A;  4E54 A;  2H9P A;  4GM9 A;  4J87 A;  5B4W A;  5EAM A;  3C9C A;  4A11 A;  4FA1 D;  2XL3 A;  3UVO A;  5EM2 A;  4QRJ A;  2IUV A;  3L4O D;  5TDH B;  3EI4 B;  5HQG A;  3EI1 B;  2IAA A;  3JRP A;  2GNQ A;  5FLX g;  1JMX B;  2H9M A;  4FWW A;  2I0T A;  4FA9 D;  3AFC A;  3IIW A;  2TRC B;  3RN1 D;  1N6F A;  3JRO A;  2CO0 C;  4CY3 A;  4BH6 A;  3AL9 A;  3RSE C;  4O3T B;  5HYN B;  4A0B A;  5TF2 A;  5H1M A;  4FA4 D;  2BCJ B;  4XYI A;  2IWF A;  4JT6 C;  2XYI A;  3I7H A;  5H17 A;  1XHM A;  4J0X A;  4GM3 A;  5KDO B;  3V9F A;  2I0S A;  3DXK C;  3EI4 A;  5IGO A;  1GXR A;  4J79 A;  3F3P A;  1A0R B;  2GC7 A;  5GXH A;  3SN6 B;  4H5J A;  3VGZ A;  4CI8 A;  4O45 A;  4L9O A;  4J81 A;  3SMR A;  3K27 A;  5EMK B;  2J57 G;  3PE7 A;  3AL8 A;  4AOW A;  5AFU 3;  1L0Q A;  4E5Z B;  2H6N A;  3SBP A;  3KRW B;  2YNO A;  1OLZ A;  4JSN C;  4X60 B;  3VA6 A;  4PC0 A;  3EI2 B;  3OL2 B;  2I0R A;  3UKR C;  4ERY A;  3C5M A;  1GOT B;  4X63 B;  5IJ8 E;  2H6Q A;  3ZWL B;  4GZ8 A;  3BG0 A;  3C99 A;  4L3H D;  1PEV A;  2HKR A;  4PBY A;  5IGQ A;  3N0E A;  4J82 A;  1QNI A;  4PSX B;  3P4F A;  3L4M D;  4FAV D;  2OVQ B;  5FKS A;  1P22 A;  4AEZ A;  3SWS D;  3BWS A;  4E54 B;  2IWK A;  3C75 H;  4ZN4 A;  4Y5R D;  5EM2 B;  2Z2O A;  1FWX A;  3B7F A;  2I3S A;  3FM0 A;  3DM0 A;  4JSX C;  3GRE A;  2QC5 A;  2HJB A;  1TBG A;  2J56 H;  4J84 A;  4QQE A;  3UKU C;  3I7N A;  4A2M A;  4UI9 R;  1SHY B;  4A0B B;  5I5M A;  4FHL A;  5IT9 g;  1K8K C;  3I8C A;  4FAN D;  1XKS A;  5GXI A;  2OJY A;  1NR0 A;  4H5I A;  5GMK n;  2B4E A;  4J78 A;  4GGD A;  2OVP B;  1NEX B;  4IA9 A;  3DWL C;  2H68 A;  2CN3 A;  1JOF A;  3DSM A;  5CXC A;  5EMM B;  3EI3 B;  5TEF A;  5C2V B;  4PBZ A;  2HKM A;  4A09 A;  5HE0 B;  4CZV A;  4R7A B;  3UVL A;  4J8B A;  3I7L A;  2PM9 A;  3AL8 B;  3NVX A;  2HYE A;  4O1Q D;  3UVM A;  4L1Q D;  3J80 g;  1S4U X;  2P9S C;  4CY5 A;  1PBY B;  2P9K C;  2H9N A;  3NVN A;  5EMJ B;  5C2W B;  2PM7 B;  4LGN A;  4CY1 A;  3RLM D;  4J73 A;  1R5M A;  4XYH A;  2HXC A;  3EI3 A;  3RMZ D;  3DXM C;  2IUQ A;  4J0W A;  3SHF A;  1JJU B;  2AGZ A;  3MZK A;  1SQ9 A;  4FB1 D;  4FA5 D;  3E0C A;  3KRX B;  5JWZ A;  4OWR A;  1K32 A;  3SJL D;  4CI2 A;  3PVW B;  5FKQ A;  5EAP A;  4CZX A;  4CI3 A;  2AH1 A;  4CY2 A;  4GGA A;  3HFQ A;  4JSP C;  5EAR A;  4O9D A;  5CYK A;  3SLE D;  3A0F A;  4YVD A;  4GGC A;  2UZY B;  5K19 A;  4CZY A;  4A2L A;  2P9U C;  5CXB A;  5FKT A;  1U2V C;  4LG8 A;  4A7J A;  3JPX A;  5IC7 A;  4ERQ A;  5FKR A;  5H14 A;  1U4C A;  2CE9 A;  4ZOX A;  2YNP A;  4Z8L A;  2Z2P A;  4GQ2 P;  5FXY A;  3J81 g;  3EWE A;  3I7K A;  4D6V A;  1PGU A;  4I79 A;  4K3I D;  4JD2 C;  4G56 B;  4K3J B;  4D0K A;  3NVQ A;  4A08 A;  4PNK B;  4U1E I;  2AGX A;  3U4Y A;  4TZ4 A;  3RRM C;  2XL2 A;  4JSV C;  5TEE A;  5I5J A;  5GSA A;  5CXC B;  1VYH C;  3K26 A;  4J8G A;  1GG2 B;  4A09 B;  3V7D B;  4KFM B;  2XU7 A;  1ERJ A;  1SQJ A;  1YFQ A;  3EG6 A;  4CI1 A;  2PM9 B;  4GMB A;  3OKT A;  3IIY A;  3SVW D;  2P9N C;  3I7O A;  3V5W B;  5C9Z B;  3IJ0 A;  2QXV A;  3MMY A;  3EMH A;  2G9A A;  4XEI C;  3UR4 A;  3JZG A;  2AH0 A;  5FQD A;  1RI6 A;  3MKQ A;  3UVN A;  4MK0 B;  3SBQ A;  2AGW A;  5K1C C;  3RFH A;  1MG2 A;  2Z2N A;  1GP2 B;  3OTT A;  5HE3 B;  2AQ5 A;  3PSL A;  3MZL A;  2B5N A;  4HDJ A;  2I3T A;  1TYQ C;  2CO0 A;  3OKY A;  3IJC A;  3I89 A;  4X3E A;  2HES X;  2OK4 A;  2PBI B;  5SXM A;  3SXT D;  3PVU B;  3ORV D;  4A0A A;  2B5L A;  2IUR A;  4GQB B;  5CYK B;  2H47 A;  4Y7R A;  2EBS A;  4J77 A;  2P9L C;  4N14 A;  4ZOY A;  3PXT D;  4PSW B;  4ESG A;  5CXB B;  2YB8 B;  5AMS A;  4CC9 A;  3SBR A;  4JXM A;  2H9L A;  2P9P C;  3EI1 A;  2OVR B;  3F3G A;  3CFS B;  2UZX B;  3GFC A;  3MXX A;  2AGY A;  3N0D A;  4L3G D;  4U7A A;  2O9K A;  3AH8 B;  4ZOZ A;  2IUP A;  3JAM g;  1XIP A;  2BBK H;  3PSC B;  4A08 B;  4OZU A;  5I5I A;  2CN2 A;  3MKS B;  5THA A;  3IJ1 A;  2AGL A;  4QT8 A;  3UVK A;  4O3U B;  3BG1 A;  2OK6 A;  5EML B;  5A2Q g;  3OW8 A;  2H14 A;  1OMW B;  4IMM A;  4QL1 A;  3F3F A;  3JZN A;  3PXW D;  3W15 A;  3RFG A;  3VH0 A;  5HE2 B;  2YBA A;  4GM8 A;  1JMZ B;  2YNN A;  3SCY A;  3JB9 L;  2MTA H;  2Q7Q A;  3EU7 A;  3ULE C;  3JZH A;  2H3X A;  3CFV A;  4J86 A; 
#chains in the Genus database with same CATH topology
 4Z7O A;  1C9I A;  3I2N A;  1PI6 A;  2VDN A;  5AJA A;  5EAL A;  4AMZ A;  2YMU A;  2GC4 A;  4ERZ A;  5C92 A;  1Q47 A;  4EWR A;  1L5G A;  4E5Z A;  3FGB A;  3FRX A;  2VDM A;  1N6D A;  2B5M A;  1VE7 A;  3DDU A;  4NBM A;  4NSX A;  3IUM A;  4GQ1 A;  4MMY A;  5HE1 B;  4A11 B;  4PXW A;  3SFZ A;  1B9X A;  3IKO A;  2PM6 B;  3EI2 A;  3OL2 A;  2OIZ A;  2P9I C;  3PXS D;  4ES0 A;  1N6E A;  1MDA H;  4LG9 A;  3OKW A;  2G99 A;  2H13 A;  2HJ4 A;  3QI0 A;  5FA5 B;  4BUJ C;  3I7P A;  3ZDY A;  4BL0 A;  3RN0 D;  4DNU A;  3OKY B;  2W18 A;  3ODT A;  3I8E A;  1MG3 A;  2J55 H;  4JT5 C;  4X61 B;  4A0A B;  4G55 A;  4MMZ A;  4ZOV A;  4AN0 A;  4AN1 A;  2CE8 A;  3CIK B;  2CNX A;  5IJ7 E;  2H6K A;  1B9Y A;  4E54 A;  2H9P A;  4GM9 A;  4J87 A;  5M61 A;  5B4W A;  1K3I A;  3C9C A;  4MMX A;  5EAM A;  4A11 A;  4FA1 D;  2XL3 A;  3UVO A;  5EM2 A;  4QRJ A;  2IUV A;  3L4O D;  3QHY B;  5TDH B;  4G1E A;  3EI4 B;  5HQG A;  3EI1 B;  2IAA A;  3JRP A;  2GNQ A;  5FLX g;  2JKX A;  1JMX B;  2H9M A;  4FWW A;  2I0T A;  4FA9 D;  3AFC A;  3ZDZ A;  3IIW A;  2TRC B;  3RN1 D;  1N6F A;  3FCS A;  3JRO A;  2CO0 C;  2VDL A;  4CY3 A;  4BH6 A;  1UOP A;  3AL9 A;  3RSE C;  4O3T B;  5HYN B;  4A0B A;  5TF2 A;  5H1M A;  4FA4 D;  2BCJ B;  4WJK A;  4XYI A;  3EQ8 A;  2IWF A;  4JT6 C;  2XYI A;  3I7H A;  4JHN A;  1GOH A;  5H17 A;  3K71 A;  1XHM A;  4J0X A;  4GM3 A;  5KDO B;  3V9F A;  2I0S A;  3DXK C;  3EI4 A;  5IGO A;  1GXR A;  4J79 A;  3F3P A;  1A0R B;  2GC7 A;  5GXH A;  3O4I A;  5M5R A;  3SN6 B;  2HU5 A;  4H5J A;  3VGZ A;  4CI8 A;  4O45 A;  4L9O A;  4J81 A;  4NAA A;  5C86 A;  3SMR A;  3K27 A;  5EMK B;  2J57 G;  3PE7 A;  3AL8 A;  4AOW A;  5AFU 3;  1L0Q A;  1YR2 A;  4G1M A;  4E5Z B;  2H6N A;  3SBP A;  3KRW B;  5FFO A;  2YNO A;  4BP8 A;  1H2Z A;  1OLZ A;  4JSN C;  4QAM A;  4DNW A;  4X60 B;  3ZE0 A;  3VA6 A;  4PC0 A;  3EI2 B;  3OL2 B;  2I0R A;  3UKR C;  4ERY A;  3C5M A;  1GOT B;  2BKL A;  4X63 B;  1VZ3 A;  3FCU A;  4NC4 A;  5IJ8 E;  2H6Q A;  3ZWL B;  4GZ8 A;  3O4H A;  3EQ9 A;  3BG0 A;  3C99 A;  4L3H D;  1PEV A;  2HKR A;  4PBY A;  5IGQ A;  3N0E A;  4J82 A;  1QNI A;  4PSX B;  3P4F A;  3L4M D;  3NID A;  3T3P A;  4FAV D;  2OVQ B;  5FKS A;  1P22 A;  3NIF A;  3VI4 A;  3SWS D;  3BWS A;  4AEZ A;  4E54 B;  2IWK A;  3C75 H;  3O4G A;  1JTD B;  3GC3 B;  4Y5R D;  4ZN4 A;  5EM2 B;  2Z2O A;  1VE6 A;  1FWX A;  3B7F A;  2I3S A;  3FM0 A;  3IUL A;  2QR5 A;  1GOG A;  3DM0 A;  3GD1 I;  1E8M A;  4JSX C;  3GRE A;  2QC5 A;  2HU8 A;  4BCB A;  2QZP A;  1GOF A;  2HJB A;  2VDK A;  1TBG A;  2J56 H;  4J84 A;  4QQE A;  2EIC A;  3UKU C;  1QFS A;  3I7N A;  4A2M A;  4UI9 R;  1SHY B;  4A0B B;  5I5M A;  4FHL A;  5IT9 g;  1K8K C;  1QFM A;  5E6U A;  3I8C A;  2WQ8 A;  4FAN D;  1XKS A;  5GXI A;  2OJY A;  2XE4 A;  1NR0 A;  3IJE A;  4H5I A;  5GMK n;  2B4E A;  4J78 A;  4GGD A;  2OVP B;  1NEX B;  4IA9 A;  4UM9 A;  3DWL C;  2H68 A;  2CN3 A;  1JOF A;  3DSM A;  5CXC A;  5EMM B;  3EI3 B;  5TEF A;  4IRZ A;  5C2V B;  4PBZ A;  2HKM A;  4UM8 A;  4A09 A;  5HE0 B;  1E8N A;  4CZV A;  4R7A B;  3UVL A;  4J8B A;  3I7L A;  2PM9 A;  3AL8 B;  3NVX A;  2HYE A;  3O4J A;  4O1Q D;  3UVM A;  4L1Q D;  3J80 g;  1O6F A;  1S4U X;  2P9S C;  4CY5 A;  1PBY B;  2P9K C;  2H9N A;  3MUO A;  3NVN A;  5EMJ B;  4RE6 A;  5C2W B;  2PM7 B;  4Z7N A;  3V4P A;  4LGN A;  4CY1 A;  3MVD K;  3RLM D;  1VZ2 A;  2VC2 A;  4J73 A;  1R5M A;  4XYH A;  1H2Y A;  2HXC A;  3EI3 A;  3RMZ D;  3DXM C;  2IUQ A;  4J0W A;  3SHF A;  3VI3 A;  2VZ3 A;  1JJU B;  2AGZ A;  3MZK A;  1SQ9 A;  4BCD A;  4FB1 D;  4FA5 D;  3E0C A;  3KRX B;  1BPO A;  5JWZ A;  4OWR A;  1K32 A;  3SJL D;  4CI2 A;  3PVW B;  4DNV A;  5FKQ A;  5EAP A;  4CZX A;  4CI3 A;  5M5T A;  2AH1 A;  4CY2 A;  2VDP A;  4GGA A;  3HFQ A;  4JSP C;  1TYE A;  5EAR A;  4O9D A;  5CYK A;  3SLE D;  3A0F A;  4YVD A;  4WK4 A;  4GGC A;  1H2W A;  2UZY B;  4WK0 A;  5K19 A;  4CZY A;  4A2L A;  2P9U C;  5CXB A;  5FKT A;  1U2V C;  4LG8 A;  4A7J A;  1UOO A;  3JPX A;  5IC7 A;  3IUJ A;  2EIE A;  3IUN A;  5FKR A;  5H14 A;  4ERQ A;  1U4C A;  2CE9 A;  1UOQ A;  2VZ1 A;  4ZOX A;  2YNP A;  4O02 A;  4Z8L A;  2Z2P A;  4GQ2 P;  5FXY A;  3J81 g;  3EWE A;  2XDW A;  3I7K A;  4D6V A;  1PGU A;  4I79 A;  4K3I D;  4JD2 C;  4G56 B;  4K3J B;  4D0K A;  3NVQ A;  4A08 A;  4PNK B;  4U1E I;  2AGX A;  3U4Y A;  4L1M A;  4TZ4 A;  3RRM C;  2XL2 A;  4JSV C;  5TEE A;  5I5J A;  5GSA A;  2EIB A;  5E6R A;  5CXC B;  1VYH C;  3K26 A;  4J8G A;  4BP9 A;  1GG2 B;  4A09 B;  3V7D B;  4KFM B;  3KCI A;  2XU7 A;  4JHP C;  1ERJ A;  1H2X A;  1SQJ A;  1YFQ A;  3EG6 A;  4CI1 A;  1M1X A;  2EID A;  2PM9 B;  4GMB A;  5M5U A;  3OKT A;  3NIG A;  4O2W A;  2XZG A;  4WK2 A;  1O6G A;  3IIY A;  3SVW D;  3ZDX A;  2P9N C;  3I7O A;  5M5V A;  4AX4 A;  3V5W B;  5C9Z B;  3IJ0 A;  2QXV A;  3MMY A;  3EMH A;  2G9A A;  4XEI C;  3UR4 A;  3EQ7 A;  3JZG A;  2AH0 A;  5FQD A;  1RI6 A;  3IVM A;  3MKQ A;  4RE5 A;  1UTC A;  3UVN A;  4MK0 B;  3SBQ A;  2AGW A;  5K1C C;  3RFH A;  1MG2 A;  1T2X A;  2Z2N A;  2VDR A;  1GP2 B;  3OTT A;  5HE3 B;  2AQ5 A;  3PSL A;  3MZL A;  2B5N A;  4HDJ A;  2I3T A;  1U8C A;  1TYQ C;  2CO0 A;  5HDB A;  2HU7 A;  3OKY A;  3IJC A;  1I2M B;  3I89 A;  4X3E A;  2HES X;  2OK4 A;  1JV2 A;  2PBI B;  5SXM A;  3SXT D;  3T3M A;  3PVU B;  3ORV D;  4A0A A;  3V4V A;  2B5L A;  2IUR A;  4GQB B;  5CYK B;  2H47 A;  5FFG A;  3MUN A;  4Y7R A;  2EBS A;  4J77 A;  2P9L C;  4N14 A;  4Z7Q A;  4ZOY A;  4NEN A;  3PXT D;  4PSW B;  4ESG A;  5M5S A;  5CXB B;  2YB8 B;  5AMS A;  3OF7 A;  4CC9 A;  3SBR A;  4JXM A;  2H9L A;  2P9P C;  2VDO A;  2OVR B;  3EI1 A;  5E6S A;  3F3G A;  3CFS B;  2UZX B;  3K72 A;  3GFC A;  3MXX A;  2AGY A;  3N0D A;  4L3G D;  4U7A A;  2O9K A;  3AH8 B;  3K6S A;  4ZOZ A;  2IUP A;  3JAM g;  1XIP A;  2BBK H;  3PSC B;  4A08 B;  4OZU A;  5I5I A;  3IUR A;  2CN2 A;  3MKS B;  5THA A;  3IJ1 A;  3ZE2 A;  2AGL A;  4QT8 A;  3UVK A;  4O3U B;  3BG1 A;  4D9S A;  2OK6 A;  5EML B;  5A2Q g;  3OW8 A;  2H14 A;  1OMW B;  4IMM A;  4QL1 A;  4AMY A;  3F3F A;  3JZN A;  3PXW D;  3IUQ A;  3ZE1 A;  3W15 A;  3RFG A;  3VH0 A;  5HE2 B;  2YBA A;  4GM8 A;  2VDQ A;  1C9L A;  1JMZ B;  2YNN A;  3SCY A;  3JB9 L;  2MTA H;  2Q7Q A;  3EU7 A;  3ULE C;  1A12 A;  3JZH A;  1E5T A;  4BCC A;  2H3X A;  3CFV A;  4J86 A; 
#chains in the Genus database with same CATH homology
 3I2N A;  1PI6 A;  5AJA A;  5EAL A;  2YMU A;  2GC4 A;  4ERZ A;  1Q47 A;  4EWR A;  4E5Z A;  3FGB A;  3FRX A;  1N6D A;  2B5M A;  4NSX A;  4GQ1 A;  5HE1 B;  4A11 B;  4PXW A;  3SFZ A;  1B9X A;  3IKO A;  2PM6 B;  3EI2 A;  3OL2 A;  2OIZ A;  2P9I C;  3PXS D;  4ES0 A;  1N6E A;  1MDA H;  4LG9 A;  3OKW A;  2G99 A;  2H13 A;  2HJ4 A;  4BUJ C;  5FA5 B;  3I7P A;  4BL0 A;  3RN0 D;  3OKY B;  2W18 A;  3ODT A;  3I8E A;  1MG3 A;  2J55 H;  4JT5 C;  4X61 B;  4A0A B;  4ZOV A;  2CE8 A;  3CIK B;  2CNX A;  5IJ7 E;  2H6K A;  1B9Y A;  4E54 A;  2H9P A;  4GM9 A;  4J87 A;  5B4W A;  5EAM A;  3C9C A;  4A11 A;  4FA1 D;  2XL3 A;  3UVO A;  5EM2 A;  4QRJ A;  2IUV A;  3L4O D;  5TDH B;  3EI4 B;  5HQG A;  3EI1 B;  2IAA A;  3JRP A;  2GNQ A;  5FLX g;  1JMX B;  2H9M A;  4FWW A;  2I0T A;  4FA9 D;  3AFC A;  3IIW A;  2TRC B;  3RN1 D;  1N6F A;  3JRO A;  2CO0 C;  4CY3 A;  4BH6 A;  3AL9 A;  3RSE C;  4O3T B;  5HYN B;  4A0B A;  5TF2 A;  5H1M A;  4FA4 D;  2BCJ B;  4XYI A;  2IWF A;  4JT6 C;  2XYI A;  3I7H A;  5H17 A;  1XHM A;  4J0X A;  4GM3 A;  5KDO B;  3V9F A;  2I0S A;  3DXK C;  3EI4 A;  5IGO A;  1GXR A;  4J79 A;  3F3P A;  1A0R B;  2GC7 A;  5GXH A;  3SN6 B;  4H5J A;  3VGZ A;  4CI8 A;  4O45 A;  4L9O A;  4J81 A;  3SMR A;  3K27 A;  5EMK B;  2J57 G;  3PE7 A;  3AL8 A;  4AOW A;  5AFU 3;  1L0Q A;  4E5Z B;  2H6N A;  3SBP A;  3KRW B;  2YNO A;  1OLZ A;  4JSN C;  4X60 B;  3VA6 A;  4PC0 A;  3EI2 B;  3OL2 B;  2I0R A;  3UKR C;  4ERY A;  3C5M A;  1GOT B;  4X63 B;  5IJ8 E;  2H6Q A;  3ZWL B;  4GZ8 A;  3BG0 A;  3C99 A;  4L3H D;  1PEV A;  2HKR A;  4PBY A;  5IGQ A;  3N0E A;  4J82 A;  1QNI A;  4PSX B;  3P4F A;  3L4M D;  4FAV D;  2OVQ B;  5FKS A;  1P22 A;  4AEZ A;  3SWS D;  3BWS A;  4E54 B;  2IWK A;  3C75 H;  4ZN4 A;  4Y5R D;  5EM2 B;  2Z2O A;  1FWX A;  3B7F A;  2I3S A;  3FM0 A;  3DM0 A;  4JSX C;  3GRE A;  2QC5 A;  2HJB A;  1TBG A;  2J56 H;  4J84 A;  4QQE A;  3UKU C;  3I7N A;  4A2M A;  4UI9 R;  1SHY B;  4A0B B;  5I5M A;  4FHL A;  5IT9 g;  1K8K C;  3I8C A;  4FAN D;  1XKS A;  5GXI A;  2OJY A;  1NR0 A;  4H5I A;  5GMK n;  2B4E A;  4J78 A;  4GGD A;  2OVP B;  1NEX B;  4IA9 A;  3DWL C;  2H68 A;  2CN3 A;  1JOF A;  3DSM A;  5CXC A;  5EMM B;  3EI3 B;  5TEF A;  5C2V B;  4PBZ A;  2HKM A;  4A09 A;  5HE0 B;  4CZV A;  4R7A B;  3UVL A;  4J8B A;  3I7L A;  2PM9 A;  3AL8 B;  3NVX A;  2HYE A;  4O1Q D;  3UVM A;  4L1Q D;  3J80 g;  1S4U X;  2P9S C;  4CY5 A;  1PBY B;  2P9K C;  2H9N A;  3NVN A;  5EMJ B;  5C2W B;  2PM7 B;  4LGN A;  4CY1 A;  3RLM D;  4J73 A;  1R5M A;  4XYH A;  2HXC A;  3EI3 A;  3RMZ D;  3DXM C;  2IUQ A;  4J0W A;  3SHF A;  1JJU B;  2AGZ A;  3MZK A;  1SQ9 A;  4FB1 D;  4FA5 D;  3E0C A;  3KRX B;  5JWZ A;  4OWR A;  1K32 A;  3SJL D;  4CI2 A;  3PVW B;  5FKQ A;  5EAP A;  4CZX A;  4CI3 A;  2AH1 A;  4CY2 A;  4GGA A;  3HFQ A;  4JSP C;  5EAR A;  4O9D A;  5CYK A;  3SLE D;  3A0F A;  4YVD A;  4GGC A;  2UZY B;  5K19 A;  4CZY A;  4A2L A;  2P9U C;  5CXB A;  5FKT A;  1U2V C;  4LG8 A;  4A7J A;  3JPX A;  5IC7 A;  4ERQ A;  5FKR A;  5H14 A;  1U4C A;  2CE9 A;  4ZOX A;  2YNP A;  4Z8L A;  2Z2P A;  4GQ2 P;  5FXY A;  3J81 g;  3EWE A;  3I7K A;  4D6V A;  1PGU A;  4I79 A;  4K3I D;  4JD2 C;  4G56 B;  4K3J B;  4D0K A;  3NVQ A;  4A08 A;  4PNK B;  4U1E I;  2AGX A;  3U4Y A;  4TZ4 A;  3RRM C;  2XL2 A;  4JSV C;  5TEE A;  5I5J A;  5GSA A;  5CXC B;  1VYH C;  3K26 A;  4J8G A;  1GG2 B;  4A09 B;  3V7D B;  4KFM B;  2XU7 A;  1ERJ A;  1SQJ A;  1YFQ A;  3EG6 A;  4CI1 A;  2PM9 B;  4GMB A;  3OKT A;  3IIY A;  3SVW D;  2P9N C;  3I7O A;  3V5W B;  5C9Z B;  3IJ0 A;  2QXV A;  3MMY A;  3EMH A;  2G9A A;  4XEI C;  3UR4 A;  3JZG A;  2AH0 A;  5FQD A;  1RI6 A;  3MKQ A;  3UVN A;  4MK0 B;  3SBQ A;  2AGW A;  5K1C C;  3RFH A;  1MG2 A;  2Z2N A;  1GP2 B;  3OTT A;  5HE3 B;  2AQ5 A;  3PSL A;  3MZL A;  2B5N A;  4HDJ A;  2I3T A;  1TYQ C;  2CO0 A;  3OKY A;  3IJC A;  3I89 A;  4X3E A;  2HES X;  2OK4 A;  2PBI B;  5SXM A;  3SXT D;  3PVU B;  3ORV D;  4A0A A;  2B5L A;  2IUR A;  4GQB B;  5CYK B;  2H47 A;  4Y7R A;  2EBS A;  4J77 A;  2P9L C;  4N14 A;  4ZOY A;  3PXT D;  4PSW B;  4ESG A;  5CXB B;  2YB8 B;  5AMS A;  4CC9 A;  3SBR A;  4JXM A;  2H9L A;  2P9P C;  3EI1 A;  2OVR B;  3F3G A;  3CFS B;  2UZX B;  3GFC A;  3MXX A;  2AGY A;  3N0D A;  4L3G D;  4U7A A;  2O9K A;  3AH8 B;  4ZOZ A;  2IUP A;  3JAM g;  1XIP A;  2BBK H;  3PSC B;  4A08 B;  4OZU A;  5I5I A;  2CN2 A;  3MKS B;  5THA A;  3IJ1 A;  2AGL A;  4QT8 A;  3UVK A;  4O3U B;  3BG1 A;  2OK6 A;  5EML B;  5A2Q g;  3OW8 A;  2H14 A;  1OMW B;  4IMM A;  4QL1 A;  3F3F A;  3JZN A;  3PXW D;  3W15 A;  3RFG A;  3VH0 A;  5HE2 B;  2YBA A;  4GM8 A;  1JMZ B;  2YNN A;  3SCY A;  3JB9 L;  2MTA H;  2Q7Q A;  3EU7 A;  3ULE C;  3JZH A;  2H3X A;  3CFV A;  4J86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...