2I0SA

Crystal structure of aromatic amine dehydrogenase ttq-phenylacetaldehyde adduct
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
360
structure length
360
Chain Sequence
b'EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 99
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i0sA01
2J56H 3RFGA 4O1QD 4CZYA 5IJ8E 5A2Qg 2I0RA 1N6DA 5FKSA 3EI1B 2P9LC 3P4FA 3RN0D 4A0AB 3RSEC 5EALA 2Z2PA 2H14A 2G9AA 4GGAA 3SJLD 3VA6A 2AQ5A 5CYKA 4Z8LA 5IGOA 2OVPB 4YVDA 4FHLA 2XL3A 1N6FA 4ERZA 4K3ID 2TRCB 1U2VC 3PSLA 3EI2A 2UZYB 4Y5RD 3RFHA 3PE7A 2P9PC 3B7FA 2OJYA 3K26A 1SHYB 5EAPA 1ERJA 5FKQA 1PEVA 3EG6A 4A09A 4A08B 5GXHA 1YFQA 3NVXA 4PXWA 4JT6C 3SCYA 1P22A 3MKQA 1SQ9A 1B9YA 3JROA 2XU7A 5THAA 5K19A 5EARA 3OKYA 3NVNA 2P9IC 4E54A 3GREA 2YMUA 2GNQA 3C99A 2OVRB 4QL1A 4L3GD 1TBGA 4R7AB 4J77A 2YBAA 3KRWB 4J84A 3OL2B 2Z2OA 1TYQC 3PXWD 5HE3B 2H13A 5I5JA 4A0AA 1U4CA 1GG2B 3MZKA 2BBKH 1JJUB 2PM9A 3PXSD 3F3GA 4FB1D 2W18A 5HE1B 3J81g 1XKSA 3C5MA 3MXXA 5EAMA 4ZOVA 2CN3A 2B5MA 2B5LA 3IJ1A 1XHMA 5FLXg 3OW8A 2H9MA 1MG3A 3I7OA 4CI8A 4J86A 4GM3A 3U4YA 5CYKB 4O3UB 4LG8A 3W15A 3AL9A 2BCJB 4O9DA 4ESGA 4GQBB 2IAAA 4KFMB 3EI2B 2P9NC 2CNXA 2IWKA 2H9LA 4EWRA 3CIKB 2YNOA 3I7NA 5FXYA 4D6VA 4PC0A 2OVQB 4X61B 3IIWA 4IA9A 3I89A 2H68A 2UZXB 4ZOXA 3JB9L 3HFQA 3UVKA 2IUQA 3OKYB 5C2WB 5HE2B 4E54B 2IURA 4J78A 1VYHC 3DWLC 4MK0B 3UKUC 5I5IA 5GMKn 3I7LA 5SXMA 3GFCA 4X60B 5FA5B 3RRMC 2GC7A 3SFZA 1N6EA 1PBYB 2HXCA 4JSNC 4A2MA 4ERQA 1OLZA 3AH8B 2PM9B 2O9KA 4I79A 5HYNB 4GQ2P 5IGQA 4JT5C 4CZVA 4U1EI 1OMWB 2H6QA 4JSVC 4K3JB 2AH0A 4QQEA 2G99A 2P9SC 3FGBA 3SBPA 3I7PA 1NR0A 4LG9A 4GZ8A 5C9ZB 4XEIC 3UKRC 2H9PA 2CO0A 5H17A 2OK6A 2HKRA 3C9CA 5TF2A 3IKOA 3JPXA 2IUPA 3OKTA 1SQJA 5TEFA 4TZ4A 5EM2A 3L4MD 5TDHB 3DXKC 2P9UC 4CI1A 4ES0A 5TEEA 5I5MA 3SBRA 3MZLA 3ORVD 4CC9A 4GGCA 4FAND 1GOTB 3L4OD 4PBYA 3UR4A 3BWSA 3UVOA 1R5MA 5FKRA 2EBSA 1MG2A 5AJAA 3I8EA 2B5NA 4PSWB 3NVQA 4CI2A 4QRJA 4PBZA 4L9OA 2B4EA 3MMYA 3EI4A 4CY3A 1S4UX 2HESX 2H3XA 2CN2A 5FKTA 5EMMB 2OIZA 2H6KA 3ODTA 3RN1D 3SHFA 4ERYA 4A2LA 2PBIB 3OTTA 2CO0C 1A0RB 4GQ1A 4FWWA 2CE8A 2XYIA 2I0TA 5JWZA 3FRXA 4AEZA 4J82A 3CFVA 2HJBA 3PVWB 3SWSD 4PSXB 5B4WA 1JMZB 4CY1A 3C75H 2YNPA 5EMKB 3AFCA 4BUJC 4A0BA 4FA5D 5AMSA 5EM2B 5IC7A 3I7KA 2HJ4A 4J81A 3J80g 2IWFA 2QXVA 4J8GA 3UVMA 2CE9A 4E5ZB 3V5WB 4D0KA 3IIYA 1MDAH 4GMBA 3DM0A 2OK4A 4J8BA 3AL8A 3K27A 4HDJA 5IT9g 3V7DB 3PSCB 3EMHA 5H1MA 3N0EA 3RMZD 4J0WA 2J55H 1Q47A 1FWXA 4FA4D 4FA9D 2I0SA 3EI3A 4H5IA 5IJ7E 3I2NA 3VGZA 3BG0A 4Y7RA 3DXMC 1L0QA 4XYIA 2H47A 4ZOYA 3I7HA 3EI4B 4O3TB 5CXCA 2YNNA 3EU7A 3UVNA 4XYHA 1K8KC 4L3HD 4N14A 4CY2A 4CY5A 5CXBB 4CI3A 4A7JA 5K1CC 3SMRA 2I3TA 5AFU3 2P9KC 3PVUB 4GM8A 1B9XA 5GSAA 3ULEC 2Z2NA 3A0FA 4GGDA 2PM6B 4E5ZA 5EMLB 5HE0B 3F3PA 3SN6B 5H14A 4J73A 2J57G 3E0CA 2YB8B 3V9FA 4A0BB 4BH6A 4FAVD 4O45A 2AH1A 3I8CA 4A11A 3JZGA 5FQDA 4U7AA 1RI6A 3CFSB 4GM9A 1K32A 2AGXA 3AL8B 3FM0A 4BL0A 4LGNA 3EI1A 3BG1A 3SLED 1QNIA 4OWRA 2AGZA 3N0DA 4L1QD 3ZWLB 3JAMg 4JXMA 4J79A 4ZOZA 3SVWD 2AGLA 4OZUA 5C2VB 3EI3B 1JMXB 5GXIA 2H6NA 4H5JA 3JRPA 5CXBA 3KRXB 2MTAH 3JZHA 2H9NA 3F3FA 4G56B 4X3EA 5HQGA 4CZXA 1GXRA 5CXCB 1PGUA 2PM7B 2Q7QA 5EMJB 2QC5A 3EWEA 2I3SA 4A08A 4FA1D 4IMMA 4JD2C 3JZNA 4X63B 3IJ0A 4J87A 2HYEA 4NSXA 4A09B 1PI6A 5KDOB 2IUVA 3OKWA 1NEXB 1XIPA 4JSPC 3VH0A 4ZN4A 3DSMA 4PNKB 1GP2B 2XL2A 4AOWA 3PXTD 4JSXC 2AGWA 4QT8A 3UVLA 2GC4A 3OL2A 4J0XA 3SXTD 2HKMA 4A11B 2AGYA 3MKSB 3SBQA 1JOFA 3IJCA 4UI9R 3RLMD
chains in the Genus database with same CATH superfamily
2J56H 3RFGA 4O1QD 4CZYA 5IJ8E 4RE5A 4MMYA 2I0RA 5A2Qg 1GOFA 4IRZA 1N6DA 5FKSA 3EI1B 2P9LC 1VE7A 3K71A 3P4FA 3RN0D 4A0AB 3RSEC 5EALA 3EQ9A 3KCIA 2QR5A 2Z2PA 2H14A 2G9AA 3EQ7A 4GGAA 3SJLD 3VA6A 2AQ5A 5CYKA 4Z8LA 5IGOA 2OVPB 1K3IA 4YVDA 4FHLA 2XL3A 1N6FA 3QHYB 3IUJA 4ERZA 4K3ID 2TRCB 1U2VC 3PSLA 3EI2A 2UZYB 2XE4A 4Y5RD 3RFHA 3PE7A 2P9PC 3B7FA 2OJYA 3K26A 1SHYB 5EAPA 1ERJA 1VZ3A 5FKQA 1PEVA 3EG6A 4A09A 4A08B 5GXHA 1YFQA 3NVXA 4PXWA 4JT6C 3SCYA 1P22A 3MKQA 1SQ9A 1B9YA 3JROA 2XU7A 5THAA 5K19A 1UTCA 4MMZA 5EARA 3OKYA 3NVNA 2P9IC 3GD1I 4E54A 3GREA 2YMUA 2GNQA 3C99A 2BKLA 2OVRB 5M5RA 4QL1A 4L3GD 1TBGA 4R7AB 4J77A 2YBAA 3KRWB 3O4JA 4J84A 3OL2B 3O4IA 2Z2OA 1TYQC 4Z7QA 3PXWD 4WK0A 5E6RA 2H13A 5HE3B 5I5JA 4Z7OA 4A0AA 1U4CA 1C9LA 1GG2B 3MZKA 2BBKH 4DNUA 1JJUB 2PM9A 3PXSD 3F3GA 4O02A 1UOQA 4O2WA 4FB1D 2W18A 5HE1B 3J81g 1XKSA 3C5MA 3MXXA 5EAMA 4ZOVA 2CN3A 2B5MA 3NIDA 2B5LA 1H2ZA 3IJ1A 1XHMA 2EIBA 5FLXg 3OW8A 4AN1A 2H9MA 2XDWA 1H2XA 1H2YA 1MG3A 3I7OA 4CI8A 4J86A 4GM3A 3U4YA 5CYKB 4O3UB 4LG8A 4WK4A 3W15A 3AL9A 2BCJB 4O9DA 3ZE1A 4ESGA 4GQBB 2IAAA 2HU7A 4KFMB 3EI2B 2P9NC 2CNXA 1T2XA 2IWKA 2H9LA 4EWRA 3CIKB 1E8NA 2YNOA 3I7NA 5FXYA 4D6VA 4PC0A 2OVQB 4X61B 3V4PA 3IIWA 4BCBA 4IA9A 1JTDB 3I89A 5M5SA 2H68A 2UZXB 2QZPA 4ZOXA 3JB9L 3HFQA 3UVKA 2IUQA 3OKYB 5C2WB 5HE2B 4E54B 2IURA 4J78A 4QAMA 1VYHC 3DWLC 4MK0B 3UKUC 5I5IA 5GMKn 3I7LA 5SXMA 3GFCA 4X60B 3IURA 1TYEA 5FA5B 3RRMC 3ZE0A 2GC7A 4WJKA 3SFZA 4G55A 1N6EA 5M5TA 1PBYB 2HXCA 4JSNC 4A2MA 1M1XA 4ERQA 1OLZA 3AH8B 2PM9B 2O9KA 4I79A 5HYNB 4GQ2P 4MMXA 5IGQA 4JT5C 4JHPC 4CZVA 4U1EI 1OMWB 4BP9A 2VDRA 1U8CA 2H6QA 4JSVC 3MVDK 4K3JB 2AH0A 4QQEA 2G99A 2P9SC 3FGBA 4AMZA 1E5TA 3SBPA 3I7PA 1NR0A 3IVMA 4LG9A 3QI0A 4GZ8A 5C9ZB 5M5UA 4XEIC 3UKRC 2H9PA 2CO0A 4NBMA 5H17A 2OK6A 2HKRA 3C9CA 5TF2A 3IKOA 2VDKA 3JPXA 1VZ2A 2IUPA 3OKTA 1SQJA 3FCSA 4BCDA 5TEFA 4TZ4A 5EM2A 3T3PA 5M5VA 3L4MD 5TDHB 5FFOA 4NAAA 3DXKC 2P9UC 3GC3B 4CI1A 4ES0A 5TEEA 5I5MA 3SBRA 3MZLA 3ORVD 5M61A 4GGCA 4CC9A 4FAND 1GOTB 3L4OD 4PBYA 3UR4A 3BWSA 3UVOA 1R5MA 5FKRA 2EBSA 1MG2A 3MUOA 5AJAA 4AN0A 3I8EA 2B5NA 4PSWB 3NVQA 4CI2A 1QFSA 4QRJA 3IUQA 4PBZA 4L9OA 2B4EA 3MMYA 4D9SA 3EI4A 4CY3A 3NIGA 4BCCA 1S4UX 2HESX 2H3XA 2CN2A 5FKTA 5EMMB 2OIZA 2H6KA 3ODTA 3RN1D 3SHFA 1O6GA 4ERYA 4A2LA 2EIDA 2PBIB 3OTTA 2CO0C 1UOPA 1A0RB 1YR2A 4GQ1A 4FWWA 2CE8A 2XYIA 2VDLA 2I0TA 5JWZA 3FRXA 4AEZA 4J82A 3CFVA 3T3MA 2HJBA 3PVWB 3SWSD 4PSXB 5FFGA 5B4WA 1JMZB 4NC4A 4CY1A 3C75H 2YNPA 2HU5A 5EMKB 3AFCA 4BUJC 4A0BA 5HDBA 4FA5D 1VE6A 5AMSA 2WQ8A 5EM2B 5IC7A 3I7KA 2HJ4A 4J81A 3J80g 2IWFA 2QXVA 4J8GA 3UVMA 3ZE2A 2CE9A 4E5ZB 2VDMA 2XZGA 3V5WB 4D0KA 3IIYA 1MDAH 3FCUA 4GMBA 3DM0A 2OK4A 4J8BA 5C92A 3AL8A 3K27A 3OF7A 4HDJA 5IT9g 3V7DB 2VDQA 3PSCB 3EMHA 5H1MA 3N0EA 3RMZD 4J0WA 1BPOA 2J55H 1Q47A 1FWXA 4FA4D 1C9IA 4FA9D 4NENA 2I0SA 4DNWA 3EI3A 4H5IA 2VDNA 3I2NA 5IJ7E 3VGZA 3BG0A 4Y7RA 4BP8A 3DXMC 1L0QA 4XYIA 2H47A 4ZOYA 3I7HA 3ZDZA 3EI4B 4G1MA 4O3TB 5CXCA 3VI4A 3IUNA 2YNNA 3EU7A 3UVNA 4XYHA 4Z7NA 2EICA 1K8KC 3O4GA 4L3HD 4N14A 4CY2A 4G1EA 3MUNA 4CY5A 5CXBB 3IULA 3IUMA 4AX4A 4CI3A 4A7JA 5K1CC 3SMRA 2I3TA 5AFU3 1O6FA 2P9KC 3PVUB 4GM8A 1B9XA 5GSAA 1L5GA 3ULEC 2Z2NA 3V4VA 3A0FA 4GGDA 2EIEA 2PM6B 4E5ZA 4RE6A 4UM9A 5EMLB 3NIFA 5HE0B 3F3PA 3SN6B 5H14A 2VC2A 2J57G 3E0CA 2YB8B 4J73A 3V9FA 4A0BB 2VDOA 1I2MB 4BH6A 4FAVD 4O45A 2AH1A 3I8CA 4A11A 3EQ8A 3JZGA 5FQDA 3ZDYA 4L1MA 4U7AA 1RI6A 3CFSB 4GM9A 1GOGA 1K32A 2AGXA 3AL8B 3FM0A 2VZ1A 4BL0A 4LGNA 3EI1A 3BG1A 3SLED 1QNIA 4OWRA 2AGZA 3N0DA 2VDPA 4L1QD 3ZWLB 3K6SA 3JAMg 4JXMA 4UM8A 1GOHA 4J79A 4ZOZA 3SVWD 2AGLA 4OZUA 5C2VB 1E8MA 3EI3B 3IJEA 1JMXB 5GXIA 4WK2A 2H6NA 1QFMA 4H5JA 3JRPA 5CXBA 3KRXB 2MTAH 3JZHA 3ZDXA 2H9NA 3F3FA 4G56B 4X3EA 5HQGA 4CZXA 1GXRA 2HU8A 3VI3A 5CXCB 5E6UA 5E6SA 1PGUA 2PM7B 2Q7QA 1JV2A 5EMJB 2QC5A 3EWEA 3K72A 1H2WA 2I3SA 4A08A 4FA1D 4IMMA 4JD2C 1A12A 3JZNA 4JHNA 4X63B 3IJ0A 4DNVA 4J87A 1UOOA 2HYEA 2JKXA 4NSXA 5C86A 4A09B 1PI6A 5KDOB 2IUVA 3OKWA 1NEXB 1XIPA 4JSPC 3VH0A 4ZN4A 3DSMA 4PNKB 1GP2B 2XL2A 4AOWA 3PXTD 2VZ3A 4JSXC 2AGWA 4QT8A 3UVLA 2GC4A 3OL2A 3O4HA 4J0XA 3SXTD 2HKMA 4A11B 2AGYA 3MKSB 3SBQA 3DDUA 1JOFA 3IJCA 4UI9R 3RLMD 4AMYA
chains in the Genus database with same CATH topology
2J56H 3RFGA 4O1QD 4CZYA 5IJ8E 5A2Qg 2I0RA 1N6DA 5FKSA 3EI1B 2P9LC 3P4FA 3RN0D 4A0AB 3RSEC 5EALA 2Z2PA 2H14A 2G9AA 4GGAA 3SJLD 3VA6A 2AQ5A 5CYKA 4Z8LA 5IGOA 2OVPB 4YVDA 4FHLA 2XL3A 1N6FA 4ERZA 4K3ID 2TRCB 1U2VC 3PSLA 3EI2A 2UZYB 4Y5RD 3RFHA 3PE7A 2P9PC 3B7FA 2OJYA 3K26A 1SHYB 5EAPA 1ERJA 5FKQA 1PEVA 3EG6A 4A09A 4A08B 5GXHA 1YFQA 3NVXA 4PXWA 4JT6C 3SCYA 1P22A 3MKQA 1SQ9A 1B9YA 3JROA 2XU7A 5THAA 5K19A 5EARA 3OKYA 3NVNA 2P9IC 4E54A 3GREA 2YMUA 2GNQA 3C99A 2OVRB 4QL1A 4L3GD 1TBGA 4R7AB 4J77A 2YBAA 3KRWB 4J84A 3OL2B 2Z2OA 1TYQC 3PXWD 5HE3B 2H13A 5I5JA 4A0AA 1U4CA 1GG2B 3MZKA 2BBKH 1JJUB 2PM9A 3PXSD 3F3GA 4FB1D 2W18A 5HE1B 3J81g 1XKSA 3C5MA 3MXXA 5EAMA 4ZOVA 2CN3A 2B5MA 2B5LA 3IJ1A 1XHMA 5FLXg 3OW8A 2H9MA 1MG3A 3I7OA 4CI8A 4J86A 4GM3A 3U4YA 5CYKB 4O3UB 4LG8A 3W15A 3AL9A 2BCJB 4O9DA 4ESGA 4GQBB 2IAAA 4KFMB 3EI2B 2P9NC 2CNXA 2IWKA 2H9LA 4EWRA 3CIKB 2YNOA 3I7NA 5FXYA 4D6VA 4PC0A 2OVQB 4X61B 3IIWA 4IA9A 3I89A 2H68A 2UZXB 4ZOXA 3JB9L 3HFQA 3UVKA 2IUQA 3OKYB 5C2WB 5HE2B 4E54B 2IURA 4J78A 1VYHC 3DWLC 4MK0B 3UKUC 5I5IA 5GMKn 3I7LA 5SXMA 3GFCA 4X60B 5FA5B 3RRMC 2GC7A 3SFZA 1N6EA 1PBYB 2HXCA 4JSNC 4A2MA 4ERQA 1OLZA 3AH8B 2PM9B 2O9KA 4I79A 5HYNB 4GQ2P 5IGQA 4JT5C 4CZVA 4U1EI 1OMWB 2H6QA 4JSVC 4K3JB 2AH0A 4QQEA 2G99A 2P9SC 3FGBA 3SBPA 3I7PA 1NR0A 4LG9A 4GZ8A 5C9ZB 4XEIC 3UKRC 2H9PA 2CO0A 5H17A 2OK6A 2HKRA 3C9CA 5TF2A 3IKOA 3JPXA 2IUPA 3OKTA 1SQJA 5TEFA 4TZ4A 5EM2A 3L4MD 5TDHB 3DXKC 2P9UC 4CI1A 4ES0A 5TEEA 5I5MA 3SBRA 3MZLA 3ORVD 4CC9A 4GGCA 4FAND 1GOTB 3L4OD 4PBYA 3UR4A 3BWSA 3UVOA 1R5MA 5FKRA 2EBSA 1MG2A 5AJAA 3I8EA 2B5NA 4PSWB 3NVQA 4CI2A 4QRJA 4PBZA 4L9OA 2B4EA 3MMYA 3EI4A 4CY3A 1S4UX 2HESX 2H3XA 2CN2A 5FKTA 5EMMB 2OIZA 2H6KA 3ODTA 3RN1D 3SHFA 4ERYA 4A2LA 2PBIB 3OTTA 2CO0C 1A0RB 4GQ1A 4FWWA 2CE8A 2XYIA 2I0TA 5JWZA 3FRXA 4AEZA 4J82A 3CFVA 2HJBA 3PVWB 3SWSD 4PSXB 5B4WA 1JMZB 4CY1A 3C75H 2YNPA 5EMKB 3AFCA 4BUJC 4A0BA 4FA5D 5AMSA 5EM2B 5IC7A 3I7KA 2HJ4A 4J81A 3J80g 2IWFA 2QXVA 4J8GA 3UVMA 2CE9A 4E5ZB 3V5WB 4D0KA 3IIYA 1MDAH 4GMBA 3DM0A 2OK4A 4J8BA 3AL8A 3K27A 4HDJA 5IT9g 3V7DB 3PSCB 3EMHA 5H1MA 3N0EA 3RMZD 4J0WA 2J55H 1Q47A 1FWXA 4FA4D 4FA9D 2I0SA 3EI3A 4H5IA 5IJ7E 3I2NA 3VGZA 3BG0A 4Y7RA 3DXMC 1L0QA 4XYIA 2H47A 4ZOYA 3I7HA 3EI4B 4O3TB 5CXCA 2YNNA 3EU7A 3UVNA 4XYHA 1K8KC 4L3HD 4N14A 4CY2A 4CY5A 5CXBB 4CI3A 4A7JA 5K1CC 3SMRA 2I3TA 5AFU3 2P9KC 3PVUB 4GM8A 1B9XA 5GSAA 3ULEC 2Z2NA 3A0FA 4GGDA 2PM6B 4E5ZA 5EMLB 5HE0B 3F3PA 3SN6B 5H14A 4J73A 2J57G 3E0CA 2YB8B 3V9FA 4A0BB 4BH6A 4FAVD 4O45A 2AH1A 3I8CA 4A11A 3JZGA 5FQDA 4U7AA 1RI6A 3CFSB 4GM9A 1K32A 2AGXA 3AL8B 3FM0A 4BL0A 4LGNA 3EI1A 3BG1A 3SLED 1QNIA 4OWRA 2AGZA 3N0DA 4L1QD 3ZWLB 3JAMg 4JXMA 4J79A 4ZOZA 3SVWD 2AGLA 4OZUA 5C2VB 3EI3B 1JMXB 5GXIA 2H6NA 4H5JA 3JRPA 5CXBA 3KRXB 2MTAH 3JZHA 2H9NA 3F3FA 4G56B 4X3EA 5HQGA 4CZXA 1GXRA 5CXCB 1PGUA 2PM7B 2Q7QA 5EMJB 2QC5A 3EWEA 2I3SA 4A08A 4FA1D 4IMMA 4JD2C 3JZNA 4X63B 3IJ0A 4J87A 2HYEA 4NSXA 4A09B 1PI6A 5KDOB 2IUVA 3OKWA 1NEXB 1XIPA 4JSPC 3VH0A 4ZN4A 3DSMA 4PNKB 1GP2B 2XL2A 4AOWA 3PXTD 4JSXC 2AGWA 4QT8A 3UVLA 2GC4A 3OL2A 4J0XA 3SXTD 2HKMA 4A11B 2AGYA 3MKSB 3SBQA 1JOFA 3IJCA 4UI9R 3RLMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J56 H;  3RFG A;  4O1Q D;  4CZY A;  5IJ8 E;  5A2Q g;  2I0R A;  1N6D A;  5FKS A;  3EI1 B;  2P9L C;  3P4F A;  3RN0 D;  4A0A B;  3RSE C;  5EAL A;  2Z2P A;  2H14 A;  2G9A A;  4GGA A;  3SJL D;  3VA6 A;  2AQ5 A;  5CYK A;  4Z8L A;  5IGO A;  2OVP B;  4YVD A;  4FHL A;  2XL3 A;  1N6F A;  4ERZ A;  4K3I D;  2TRC B;  1U2V C;  3PSL A;  3EI2 A;  2UZY B;  4Y5R D;  3RFH A;  3PE7 A;  2P9P C;  3B7F A;  2OJY A;  3K26 A;  1SHY B;  5EAP A;  1ERJ A;  5FKQ A;  1PEV A;  3EG6 A;  4A09 A;  4A08 B;  5GXH A;  1YFQ A;  3NVX A;  4PXW A;  4JT6 C;  3SCY A;  1P22 A;  3MKQ A;  1SQ9 A;  1B9Y A;  3JRO A;  2XU7 A;  5THA A;  5K19 A;  5EAR A;  3OKY A;  3NVN A;  2P9I C;  4E54 A;  3GRE A;  2YMU A;  2GNQ A;  3C99 A;  2OVR B;  4QL1 A;  4L3G D;  1TBG A;  4R7A B;  4J77 A;  2YBA A;  3KRW B;  4J84 A;  3OL2 B;  2Z2O A;  1TYQ C;  3PXW D;  5HE3 B;  2H13 A;  5I5J A;  4A0A A;  1U4C A;  1GG2 B;  3MZK A;  2BBK H;  1JJU B;  2PM9 A;  3PXS D;  3F3G A;  4FB1 D;  2W18 A;  5HE1 B;  3J81 g;  1XKS A;  3C5M A;  3MXX A;  5EAM A;  4ZOV A;  2CN3 A;  2B5M A;  2B5L A;  3IJ1 A;  1XHM A;  5FLX g;  3OW8 A;  2H9M A;  1MG3 A;  3I7O A;  4CI8 A;  4J86 A;  4GM3 A;  3U4Y A;  5CYK B;  4O3U B;  4LG8 A;  3W15 A;  3AL9 A;  2BCJ B;  4O9D A;  4ESG A;  4GQB B;  2IAA A;  4KFM B;  3EI2 B;  2P9N C;  2CNX A;  2IWK A;  2H9L A;  4EWR A;  3CIK B;  2YNO A;  3I7N A;  5FXY A;  4D6V A;  4PC0 A;  2OVQ B;  4X61 B;  3IIW A;  4IA9 A;  3I89 A;  2H68 A;  2UZX B;  4ZOX A;  3JB9 L;  3HFQ A;  3UVK A;  2IUQ A;  3OKY B;  5C2W B;  5HE2 B;  4E54 B;  2IUR A;  4J78 A;  1VYH C;  3DWL C;  4MK0 B;  3UKU C;  5I5I A;  5GMK n;  3I7L A;  5SXM A;  3GFC A;  4X60 B;  5FA5 B;  3RRM C;  2GC7 A;  3SFZ A;  1N6E A;  1PBY B;  2HXC A;  4JSN C;  4A2M A;  4ERQ A;  1OLZ A;  3AH8 B;  2PM9 B;  2O9K A;  4I79 A;  5HYN B;  4GQ2 P;  5IGQ A;  4JT5 C;  4CZV A;  4U1E I;  1OMW B;  2H6Q A;  4JSV C;  4K3J B;  2AH0 A;  4QQE A;  2G99 A;  2P9S C;  3FGB A;  3SBP A;  3I7P A;  1NR0 A;  4LG9 A;  4GZ8 A;  5C9Z B;  4XEI C;  3UKR C;  2H9P A;  2CO0 A;  5H17 A;  2OK6 A;  2HKR A;  3C9C A;  5TF2 A;  3IKO A;  3JPX A;  2IUP A;  3OKT A;  1SQJ A;  5TEF A;  4TZ4 A;  5EM2 A;  3L4M D;  5TDH B;  3DXK C;  2P9U C;  4CI1 A;  4ES0 A;  5TEE A;  5I5M A;  3SBR A;  3MZL A;  3ORV D;  4CC9 A;  4GGC A;  4FAN D;  1GOT B;  3L4O D;  4PBY A;  3UR4 A;  3BWS A;  3UVO A;  1R5M A;  5FKR A;  2EBS A;  1MG2 A;  5AJA A;  3I8E A;  2B5N A;  4PSW B;  3NVQ A;  4CI2 A;  4QRJ A;  4PBZ A;  4L9O A;  2B4E A;  3MMY A;  3EI4 A;  4CY3 A;  1S4U X;  2HES X;  2H3X A;  2CN2 A;  5FKT A;  5EMM B;  2OIZ A;  2H6K A;  3ODT A;  3RN1 D;  3SHF A;  4ERY A;  4A2L A;  2PBI B;  3OTT A;  2CO0 C;  1A0R B;  4GQ1 A;  4FWW A;  2CE8 A;  2XYI A;  2I0T A;  5JWZ A;  3FRX A;  4AEZ A;  4J82 A;  3CFV A;  2HJB A;  3PVW B;  3SWS D;  4PSX B;  5B4W A;  1JMZ B;  4CY1 A;  3C75 H;  2YNP A;  5EMK B;  3AFC A;  4BUJ C;  4A0B A;  4FA5 D;  5AMS A;  5EM2 B;  5IC7 A;  3I7K A;  2HJ4 A;  4J81 A;  3J80 g;  2IWF A;  2QXV A;  4J8G A;  3UVM A;  2CE9 A;  4E5Z B;  3V5W B;  4D0K A;  3IIY A;  1MDA H;  4GMB A;  3DM0 A;  2OK4 A;  4J8B A;  3AL8 A;  3K27 A;  4HDJ A;  5IT9 g;  3V7D B;  3PSC B;  3EMH A;  5H1M A;  3N0E A;  3RMZ D;  4J0W A;  2J55 H;  1Q47 A;  1FWX A;  4FA4 D;  4FA9 D;  2I0S A;  3EI3 A;  4H5I A;  5IJ7 E;  3I2N A;  3VGZ A;  3BG0 A;  4Y7R A;  3DXM C;  1L0Q A;  4XYI A;  2H47 A;  4ZOY A;  3I7H A;  3EI4 B;  4O3T B;  5CXC A;  2YNN A;  3EU7 A;  3UVN A;  4XYH A;  1K8K C;  4L3H D;  4N14 A;  4CY2 A;  4CY5 A;  5CXB B;  4CI3 A;  4A7J A;  5K1C C;  3SMR A;  2I3T A;  5AFU 3;  2P9K C;  3PVU B;  4GM8 A;  1B9X A;  5GSA A;  3ULE C;  2Z2N A;  3A0F A;  4GGD A;  2PM6 B;  4E5Z A;  5EML B;  5HE0 B;  3F3P A;  3SN6 B;  5H14 A;  4J73 A;  2J57 G;  3E0C A;  2YB8 B;  3V9F A;  4A0B B;  4BH6 A;  4FAV D;  4O45 A;  2AH1 A;  3I8C A;  4A11 A;  3JZG A;  5FQD A;  4U7A A;  1RI6 A;  3CFS B;  4GM9 A;  1K32 A;  2AGX A;  3AL8 B;  3FM0 A;  4BL0 A;  4LGN A;  3EI1 A;  3BG1 A;  3SLE D;  1QNI A;  4OWR A;  2AGZ A;  3N0D A;  4L1Q D;  3ZWL B;  3JAM g;  4JXM A;  4J79 A;  4ZOZ A;  3SVW D;  2AGL A;  4OZU A;  5C2V B;  3EI3 B;  1JMX B;  5GXI A;  2H6N A;  4H5J A;  3JRP A;  5CXB A;  3KRX B;  2MTA H;  3JZH A;  2H9N A;  3F3F A;  4G56 B;  4X3E A;  5HQG A;  4CZX A;  1GXR A;  5CXC B;  1PGU A;  2PM7 B;  2Q7Q A;  5EMJ B;  2QC5 A;  3EWE A;  2I3S A;  4A08 A;  4FA1 D;  4IMM A;  4JD2 C;  3JZN A;  4X63 B;  3IJ0 A;  4J87 A;  2HYE A;  4NSX A;  4A09 B;  1PI6 A;  5KDO B;  2IUV A;  3OKW A;  1NEX B;  1XIP A;  4JSP C;  3VH0 A;  4ZN4 A;  3DSM A;  4PNK B;  1GP2 B;  2XL2 A;  4AOW A;  3PXT D;  4JSX C;  2AGW A;  4QT8 A;  3UVL A;  2GC4 A;  3OL2 A;  4J0X A;  3SXT D;  2HKM A;  4A11 B;  2AGY A;  3MKS B;  3SBQ A;  1JOF A;  3IJC A;  4UI9 R;  3RLM D; 
#chains in the Genus database with same CATH topology
 2J56 H;  3RFG A;  4O1Q D;  4CZY A;  5IJ8 E;  4RE5 A;  4MMY A;  2I0R A;  5A2Q g;  1GOF A;  4IRZ A;  1N6D A;  5FKS A;  3EI1 B;  2P9L C;  1VE7 A;  3K71 A;  3P4F A;  3RN0 D;  4A0A B;  3RSE C;  5EAL A;  3EQ9 A;  3KCI A;  2QR5 A;  2Z2P A;  2H14 A;  2G9A A;  3EQ7 A;  4GGA A;  3SJL D;  3VA6 A;  2AQ5 A;  5CYK A;  4Z8L A;  5IGO A;  2OVP B;  1K3I A;  4YVD A;  4FHL A;  2XL3 A;  1N6F A;  3QHY B;  3IUJ A;  4ERZ A;  4K3I D;  2TRC B;  1U2V C;  3PSL A;  3EI2 A;  2UZY B;  2XE4 A;  4Y5R D;  3RFH A;  3PE7 A;  2P9P C;  3B7F A;  2OJY A;  3K26 A;  1SHY B;  5EAP A;  1ERJ A;  1VZ3 A;  5FKQ A;  1PEV A;  3EG6 A;  4A09 A;  4A08 B;  5GXH A;  1YFQ A;  3NVX A;  4PXW A;  4JT6 C;  3SCY A;  1P22 A;  3MKQ A;  1SQ9 A;  1B9Y A;  3JRO A;  2XU7 A;  5THA A;  5K19 A;  1UTC A;  4MMZ A;  5EAR A;  3OKY A;  3NVN A;  2P9I C;  3GD1 I;  4E54 A;  3GRE A;  2YMU A;  2GNQ A;  3C99 A;  2BKL A;  2OVR B;  5M5R A;  4QL1 A;  4L3G D;  1TBG A;  4R7A B;  4J77 A;  2YBA A;  3KRW B;  3O4J A;  4J84 A;  3OL2 B;  3O4I A;  2Z2O A;  1TYQ C;  4Z7Q A;  3PXW D;  4WK0 A;  5E6R A;  2H13 A;  5HE3 B;  5I5J A;  4Z7O A;  4A0A A;  1U4C A;  1C9L A;  1GG2 B;  3MZK A;  2BBK H;  4DNU A;  1JJU B;  2PM9 A;  3PXS D;  3F3G A;  4O02 A;  1UOQ A;  4O2W A;  4FB1 D;  2W18 A;  5HE1 B;  3J81 g;  1XKS A;  3C5M A;  3MXX A;  5EAM A;  4ZOV A;  2CN3 A;  2B5M A;  3NID A;  2B5L A;  1H2Z A;  3IJ1 A;  1XHM A;  2EIB A;  5FLX g;  3OW8 A;  4AN1 A;  2H9M A;  2XDW A;  1H2X A;  1H2Y A;  1MG3 A;  3I7O A;  4CI8 A;  4J86 A;  4GM3 A;  3U4Y A;  5CYK B;  4O3U B;  4LG8 A;  4WK4 A;  3W15 A;  3AL9 A;  2BCJ B;  4O9D A;  3ZE1 A;  4ESG A;  4GQB B;  2IAA A;  2HU7 A;  4KFM B;  3EI2 B;  2P9N C;  2CNX A;  1T2X A;  2IWK A;  2H9L A;  4EWR A;  3CIK B;  1E8N A;  2YNO A;  3I7N A;  5FXY A;  4D6V A;  4PC0 A;  2OVQ B;  4X61 B;  3V4P A;  3IIW A;  4BCB A;  4IA9 A;  1JTD B;  3I89 A;  5M5S A;  2H68 A;  2UZX B;  2QZP A;  4ZOX A;  3JB9 L;  3HFQ A;  3UVK A;  2IUQ A;  3OKY B;  5C2W B;  5HE2 B;  4E54 B;  2IUR A;  4J78 A;  4QAM A;  1VYH C;  3DWL C;  4MK0 B;  3UKU C;  5I5I A;  5GMK n;  3I7L A;  5SXM A;  3GFC A;  4X60 B;  3IUR A;  1TYE A;  5FA5 B;  3RRM C;  3ZE0 A;  2GC7 A;  4WJK A;  3SFZ A;  4G55 A;  1N6E A;  5M5T A;  1PBY B;  2HXC A;  4JSN C;  4A2M A;  1M1X A;  4ERQ A;  1OLZ A;  3AH8 B;  2PM9 B;  2O9K A;  4I79 A;  5HYN B;  4GQ2 P;  4MMX A;  5IGQ A;  4JT5 C;  4JHP C;  4CZV A;  4U1E I;  1OMW B;  4BP9 A;  2VDR A;  1U8C A;  2H6Q A;  4JSV C;  3MVD K;  4K3J B;  2AH0 A;  4QQE A;  2G99 A;  2P9S C;  3FGB A;  4AMZ A;  1E5T A;  3SBP A;  3I7P A;  1NR0 A;  3IVM A;  4LG9 A;  3QI0 A;  4GZ8 A;  5C9Z B;  5M5U A;  4XEI C;  3UKR C;  2H9P A;  2CO0 A;  4NBM A;  5H17 A;  2OK6 A;  2HKR A;  3C9C A;  5TF2 A;  3IKO A;  2VDK A;  3JPX A;  1VZ2 A;  2IUP A;  3OKT A;  1SQJ A;  3FCS A;  4BCD A;  5TEF A;  4TZ4 A;  5EM2 A;  3T3P A;  5M5V A;  3L4M D;  5TDH B;  5FFO A;  4NAA A;  3DXK C;  2P9U C;  3GC3 B;  4CI1 A;  4ES0 A;  5TEE A;  5I5M A;  3SBR A;  3MZL A;  3ORV D;  5M61 A;  4GGC A;  4CC9 A;  4FAN D;  1GOT B;  3L4O D;  4PBY A;  3UR4 A;  3BWS A;  3UVO A;  1R5M A;  5FKR A;  2EBS A;  1MG2 A;  3MUO A;  5AJA A;  4AN0 A;  3I8E A;  2B5N A;  4PSW B;  3NVQ A;  4CI2 A;  1QFS A;  4QRJ A;  3IUQ A;  4PBZ A;  4L9O A;  2B4E A;  3MMY A;  4D9S A;  3EI4 A;  4CY3 A;  3NIG A;  4BCC A;  1S4U X;  2HES X;  2H3X A;  2CN2 A;  5FKT A;  5EMM B;  2OIZ A;  2H6K A;  3ODT A;  3RN1 D;  3SHF A;  1O6G A;  4ERY A;  4A2L A;  2EID A;  2PBI B;  3OTT A;  2CO0 C;  1UOP A;  1A0R B;  1YR2 A;  4GQ1 A;  4FWW A;  2CE8 A;  2XYI A;  2VDL A;  2I0T A;  5JWZ A;  3FRX A;  4AEZ A;  4J82 A;  3CFV A;  3T3M A;  2HJB A;  3PVW B;  3SWS D;  4PSX B;  5FFG A;  5B4W A;  1JMZ B;  4NC4 A;  4CY1 A;  3C75 H;  2YNP A;  2HU5 A;  5EMK B;  3AFC A;  4BUJ C;  4A0B A;  5HDB A;  4FA5 D;  1VE6 A;  5AMS A;  2WQ8 A;  5EM2 B;  5IC7 A;  3I7K A;  2HJ4 A;  4J81 A;  3J80 g;  2IWF A;  2QXV A;  4J8G A;  3UVM A;  3ZE2 A;  2CE9 A;  4E5Z B;  2VDM A;  2XZG A;  3V5W B;  4D0K A;  3IIY A;  1MDA H;  3FCU A;  4GMB A;  3DM0 A;  2OK4 A;  4J8B A;  5C92 A;  3AL8 A;  3K27 A;  3OF7 A;  4HDJ A;  5IT9 g;  3V7D B;  2VDQ A;  3PSC B;  3EMH A;  5H1M A;  3N0E A;  3RMZ D;  4J0W A;  1BPO A;  2J55 H;  1Q47 A;  1FWX A;  4FA4 D;  1C9I A;  4FA9 D;  4NEN A;  2I0S A;  4DNW A;  3EI3 A;  4H5I A;  2VDN A;  3I2N A;  5IJ7 E;  3VGZ A;  3BG0 A;  4Y7R A;  4BP8 A;  3DXM C;  1L0Q A;  4XYI A;  2H47 A;  4ZOY A;  3I7H A;  3ZDZ A;  3EI4 B;  4G1M A;  4O3T B;  5CXC A;  3VI4 A;  3IUN A;  2YNN A;  3EU7 A;  3UVN A;  4XYH A;  4Z7N A;  2EIC A;  1K8K C;  3O4G A;  4L3H D;  4N14 A;  4CY2 A;  4G1E A;  3MUN A;  4CY5 A;  5CXB B;  3IUL A;  3IUM A;  4AX4 A;  4CI3 A;  4A7J A;  5K1C C;  3SMR A;  2I3T A;  5AFU 3;  1O6F A;  2P9K C;  3PVU B;  4GM8 A;  1B9X A;  5GSA A;  1L5G A;  3ULE C;  2Z2N A;  3V4V A;  3A0F A;  4GGD A;  2EIE A;  2PM6 B;  4E5Z A;  4RE6 A;  4UM9 A;  5EML B;  3NIF A;  5HE0 B;  3F3P A;  3SN6 B;  5H14 A;  2VC2 A;  2J57 G;  3E0C A;  2YB8 B;  4J73 A;  3V9F A;  4A0B B;  2VDO A;  1I2M B;  4BH6 A;  4FAV D;  4O45 A;  2AH1 A;  3I8C A;  4A11 A;  3EQ8 A;  3JZG A;  5FQD A;  3ZDY A;  4L1M A;  4U7A A;  1RI6 A;  3CFS B;  4GM9 A;  1GOG A;  1K32 A;  2AGX A;  3AL8 B;  3FM0 A;  2VZ1 A;  4BL0 A;  4LGN A;  3EI1 A;  3BG1 A;  3SLE D;  1QNI A;  4OWR A;  2AGZ A;  3N0D A;  2VDP A;  4L1Q D;  3ZWL B;  3K6S A;  3JAM g;  4JXM A;  4UM8 A;  1GOH A;  4J79 A;  4ZOZ A;  3SVW D;  2AGL A;  4OZU A;  5C2V B;  1E8M A;  3EI3 B;  3IJE A;  1JMX B;  5GXI A;  4WK2 A;  2H6N A;  1QFM A;  4H5J A;  3JRP A;  5CXB A;  3KRX B;  2MTA H;  3JZH A;  3ZDX A;  2H9N A;  3F3F A;  4G56 B;  4X3E A;  5HQG A;  4CZX A;  1GXR A;  2HU8 A;  3VI3 A;  5CXC B;  5E6U A;  5E6S A;  1PGU A;  2PM7 B;  2Q7Q A;  1JV2 A;  5EMJ B;  2QC5 A;  3EWE A;  3K72 A;  1H2W A;  2I3S A;  4A08 A;  4FA1 D;  4IMM A;  4JD2 C;  1A12 A;  3JZN A;  4JHN A;  4X63 B;  3IJ0 A;  4DNV A;  4J87 A;  1UOO A;  2HYE A;  2JKX A;  4NSX A;  5C86 A;  4A09 B;  1PI6 A;  5KDO B;  2IUV A;  3OKW A;  1NEX B;  1XIP A;  4JSP C;  3VH0 A;  4ZN4 A;  3DSM A;  4PNK B;  1GP2 B;  2XL2 A;  4AOW A;  3PXT D;  2VZ3 A;  4JSX C;  2AGW A;  4QT8 A;  3UVL A;  2GC4 A;  3OL2 A;  3O4H A;  4J0X A;  3SXT D;  2HKM A;  4A11 B;  2AGY A;  3MKS B;  3SBQ A;  3DDU A;  1JOF A;  3IJC A;  4UI9 R;  3RLM D;  4AMY A; 
#chains in the Genus database with same CATH homology
 2J56 H;  3RFG A;  4O1Q D;  4CZY A;  5IJ8 E;  5A2Q g;  2I0R A;  1N6D A;  5FKS A;  3EI1 B;  2P9L C;  3P4F A;  3RN0 D;  4A0A B;  3RSE C;  5EAL A;  2Z2P A;  2H14 A;  2G9A A;  4GGA A;  3SJL D;  3VA6 A;  2AQ5 A;  5CYK A;  4Z8L A;  5IGO A;  2OVP B;  4YVD A;  4FHL A;  2XL3 A;  1N6F A;  4ERZ A;  4K3I D;  2TRC B;  1U2V C;  3PSL A;  3EI2 A;  2UZY B;  4Y5R D;  3RFH A;  3PE7 A;  2P9P C;  3B7F A;  2OJY A;  3K26 A;  1SHY B;  5EAP A;  1ERJ A;  5FKQ A;  1PEV A;  3EG6 A;  4A09 A;  4A08 B;  5GXH A;  1YFQ A;  3NVX A;  4PXW A;  4JT6 C;  3SCY A;  1P22 A;  3MKQ A;  1SQ9 A;  1B9Y A;  3JRO A;  2XU7 A;  5THA A;  5K19 A;  5EAR A;  3OKY A;  3NVN A;  2P9I C;  4E54 A;  3GRE A;  2YMU A;  2GNQ A;  3C99 A;  2OVR B;  4QL1 A;  4L3G D;  1TBG A;  4R7A B;  4J77 A;  2YBA A;  3KRW B;  4J84 A;  3OL2 B;  2Z2O A;  1TYQ C;  3PXW D;  5HE3 B;  2H13 A;  5I5J A;  4A0A A;  1U4C A;  1GG2 B;  3MZK A;  2BBK H;  1JJU B;  2PM9 A;  3PXS D;  3F3G A;  4FB1 D;  2W18 A;  5HE1 B;  3J81 g;  1XKS A;  3C5M A;  3MXX A;  5EAM A;  4ZOV A;  2CN3 A;  2B5M A;  2B5L A;  3IJ1 A;  1XHM A;  5FLX g;  3OW8 A;  2H9M A;  1MG3 A;  3I7O A;  4CI8 A;  4J86 A;  4GM3 A;  3U4Y A;  5CYK B;  4O3U B;  4LG8 A;  3W15 A;  3AL9 A;  2BCJ B;  4O9D A;  4ESG A;  4GQB B;  2IAA A;  4KFM B;  3EI2 B;  2P9N C;  2CNX A;  2IWK A;  2H9L A;  4EWR A;  3CIK B;  2YNO A;  3I7N A;  5FXY A;  4D6V A;  4PC0 A;  2OVQ B;  4X61 B;  3IIW A;  4IA9 A;  3I89 A;  2H68 A;  2UZX B;  4ZOX A;  3JB9 L;  3HFQ A;  3UVK A;  2IUQ A;  3OKY B;  5C2W B;  5HE2 B;  4E54 B;  2IUR A;  4J78 A;  1VYH C;  3DWL C;  4MK0 B;  3UKU C;  5I5I A;  5GMK n;  3I7L A;  5SXM A;  3GFC A;  4X60 B;  5FA5 B;  3RRM C;  2GC7 A;  3SFZ A;  1N6E A;  1PBY B;  2HXC A;  4JSN C;  4A2M A;  4ERQ A;  1OLZ A;  3AH8 B;  2PM9 B;  2O9K A;  4I79 A;  5HYN B;  4GQ2 P;  5IGQ A;  4JT5 C;  4CZV A;  4U1E I;  1OMW B;  2H6Q A;  4JSV C;  4K3J B;  2AH0 A;  4QQE A;  2G99 A;  2P9S C;  3FGB A;  3SBP A;  3I7P A;  1NR0 A;  4LG9 A;  4GZ8 A;  5C9Z B;  4XEI C;  3UKR C;  2H9P A;  2CO0 A;  5H17 A;  2OK6 A;  2HKR A;  3C9C A;  5TF2 A;  3IKO A;  3JPX A;  2IUP A;  3OKT A;  1SQJ A;  5TEF A;  4TZ4 A;  5EM2 A;  3L4M D;  5TDH B;  3DXK C;  2P9U C;  4CI1 A;  4ES0 A;  5TEE A;  5I5M A;  3SBR A;  3MZL A;  3ORV D;  4CC9 A;  4GGC A;  4FAN D;  1GOT B;  3L4O D;  4PBY A;  3UR4 A;  3BWS A;  3UVO A;  1R5M A;  5FKR A;  2EBS A;  1MG2 A;  5AJA A;  3I8E A;  2B5N A;  4PSW B;  3NVQ A;  4CI2 A;  4QRJ A;  4PBZ A;  4L9O A;  2B4E A;  3MMY A;  3EI4 A;  4CY3 A;  1S4U X;  2HES X;  2H3X A;  2CN2 A;  5FKT A;  5EMM B;  2OIZ A;  2H6K A;  3ODT A;  3RN1 D;  3SHF A;  4ERY A;  4A2L A;  2PBI B;  3OTT A;  2CO0 C;  1A0R B;  4GQ1 A;  4FWW A;  2CE8 A;  2XYI A;  2I0T A;  5JWZ A;  3FRX A;  4AEZ A;  4J82 A;  3CFV A;  2HJB A;  3PVW B;  3SWS D;  4PSX B;  5B4W A;  1JMZ B;  4CY1 A;  3C75 H;  2YNP A;  5EMK B;  3AFC A;  4BUJ C;  4A0B A;  4FA5 D;  5AMS A;  5EM2 B;  5IC7 A;  3I7K A;  2HJ4 A;  4J81 A;  3J80 g;  2IWF A;  2QXV A;  4J8G A;  3UVM A;  2CE9 A;  4E5Z B;  3V5W B;  4D0K A;  3IIY A;  1MDA H;  4GMB A;  3DM0 A;  2OK4 A;  4J8B A;  3AL8 A;  3K27 A;  4HDJ A;  5IT9 g;  3V7D B;  3PSC B;  3EMH A;  5H1M A;  3N0E A;  3RMZ D;  4J0W A;  2J55 H;  1Q47 A;  1FWX A;  4FA4 D;  4FA9 D;  2I0S A;  3EI3 A;  4H5I A;  5IJ7 E;  3I2N A;  3VGZ A;  3BG0 A;  4Y7R A;  3DXM C;  1L0Q A;  4XYI A;  2H47 A;  4ZOY A;  3I7H A;  3EI4 B;  4O3T B;  5CXC A;  2YNN A;  3EU7 A;  3UVN A;  4XYH A;  1K8K C;  4L3H D;  4N14 A;  4CY2 A;  4CY5 A;  5CXB B;  4CI3 A;  4A7J A;  5K1C C;  3SMR A;  2I3T A;  5AFU 3;  2P9K C;  3PVU B;  4GM8 A;  1B9X A;  5GSA A;  3ULE C;  2Z2N A;  3A0F A;  4GGD A;  2PM6 B;  4E5Z A;  5EML B;  5HE0 B;  3F3P A;  3SN6 B;  5H14 A;  4J73 A;  2J57 G;  3E0C A;  2YB8 B;  3V9F A;  4A0B B;  4BH6 A;  4FAV D;  4O45 A;  2AH1 A;  3I8C A;  4A11 A;  3JZG A;  5FQD A;  4U7A A;  1RI6 A;  3CFS B;  4GM9 A;  1K32 A;  2AGX A;  3AL8 B;  3FM0 A;  4BL0 A;  4LGN A;  3EI1 A;  3BG1 A;  3SLE D;  1QNI A;  4OWR A;  2AGZ A;  3N0D A;  4L1Q D;  3ZWL B;  3JAM g;  4JXM A;  4J79 A;  4ZOZ A;  3SVW D;  2AGL A;  4OZU A;  5C2V B;  3EI3 B;  1JMX B;  5GXI A;  2H6N A;  4H5J A;  3JRP A;  5CXB A;  3KRX B;  2MTA H;  3JZH A;  2H9N A;  3F3F A;  4G56 B;  4X3E A;  5HQG A;  4CZX A;  1GXR A;  5CXC B;  1PGU A;  2PM7 B;  2Q7Q A;  5EMJ B;  2QC5 A;  3EWE A;  2I3S A;  4A08 A;  4FA1 D;  4IMM A;  4JD2 C;  3JZN A;  4X63 B;  3IJ0 A;  4J87 A;  2HYE A;  4NSX A;  4A09 B;  1PI6 A;  5KDO B;  2IUV A;  3OKW A;  1NEX B;  1XIP A;  4JSP C;  3VH0 A;  4ZN4 A;  3DSM A;  4PNK B;  1GP2 B;  2XL2 A;  4AOW A;  3PXT D;  4JSX C;  2AGW A;  4QT8 A;  3UVL A;  2GC4 A;  3OL2 A;  4J0X A;  3SXT D;  2HKM A;  4A11 B;  2AGY A;  3MKS B;  3SBQ A;  1JOF A;  3IJC A;  4UI9 R;  3RLM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...