5IGQA

Wd40 domain of human e3 ubiquitin ligase cop1 (rfwd2) bound to peptide from trib1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
341
structure length
324
Chain Sequence
EFQECLSKFTRYNSVRPLATLSYALYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Substrate Selectivity of the E3 Ligase COP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
molecule keywords E3 ubiquitin-protein ligase RFWD2
total genus 74
structure length 324
sequence length 341
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5igqA00
4BUJC 4U7AA 5AJAA 2OJYA 4L9OA 4ZN4A 3B7FA 1U2VC 3EI2A 5EMLB 4AEZA 3HFQA 2AGZA 4CC9A 3CFSB 3RFHA 5HQGA 1N6FA 5IGOA 5EALA 3AH8B 4K3JB 3F3GA 1TYQC 4ESGA 2OK6A 1XKSA 1GG2B 3SN6B 4A09A 4EWRA 2I0SA 4A08A 2J56H 4ZOZA 5EAPA 2IUVA 5HE0B 5SXMA 1B9XA 2CE8A 3JB9L 1JMXB 4IMMA 4QQEA 1MDAH 4GQ2P 4AOWA 3C5MA 3I7HA 4GQ1A 3OTTA 1VYHC 2XU7A 4PSXB 2IURA 3PVWB 4CI3A 1MG2A 2CE9A 4LG9A 2GC4A 2B4EA 2IUQA 1N6EA 4H5IA 4JSPC 5IC7A 4XEIC 3UVOA 5I5IA 5EMMB 5C9ZB 5TEEA 3UR4A 1PGUA 1S4UX 2P9KC 3IIYA 3JZGA 3P4FA 4KFMB 4A0AA 3K26A 3OKWA 3PVUB 3OW8A 1YFQA 2H68A 4ERQA 3I8EA 3I7NA 4J79A 5CXBB 3J81g 2J57G 2O9KA 5K1CC 3EWEA 3L4MD 4Z8LA 5EMKB 2HKMA 5C2VB 2P9UC 3DM0A 3JZHA 3OL2B 5JWZA 4PBZA 2I3TA 4PNKB 4OWRA 2QC5A 1P22A 2IWFA 5CYKA 4FAVD 4GM9A 3SVWD 4X61B 2Z2NA 3JRPA 4J8BA 4JT6C 3I8CA 2AH1A 4JXMA 3NVXA 1NR0A 4GGDA 4A0BA 3N0DA 3EI3B 3F3PA 3AFCA 5EMJB 5EM2B 3I7KA 5IT9g 4CY1A 2YMUA 3I2NA 3BG0A 3FGBA 2YB8B 2AGYA 2H9MA 3PXTD 4MK0B 3KRWB 5FKSA 4J86A 5I5MA 2UZYB 2PM9B 2I0TA 3F3FA 3SMRA 4A2MA 1OMWB 4E5ZA 5EAMA 1U4CA 2P9NC 4FHLA 5IGQA 3IJCA 3ORVD 3EU7A 5EARA 1QNIA 2IUPA 3FM0A 2YNPA 3EI2B 2H6NA 3NVQA 4U1EI 4PXWA 5TDHB 2AH0A 4FA9D 4CZVA 3VA6A 3C75H 3EI4A 4NSXA 4A09B 5CXCB 1PI6A 2I0RA 4QL1A 4L1QD 4A0AB 1GXRA 1XIPA 4J77A 5H17A 4G56B 1FWXA 2OVQB 4LGNA 3UKUC 2AGLA 3JROA 3OKTA 2P9PC 5HE1B 1GP2B 5C2WB 3VGZA 3SBPA 2AQ5A 4O45A 4A0BB 3V5WB 2H13A 3U4YA 1MG3A 2OVRB 1B9YA 4O1QD 3RN0D 4CY2A 4J0XA 4JSXC 4E54B 4O9DA 3UVMA 3KRXB 2PBIB 4YVDA 3RRMC 5FXYA 3PE7A 2XL2A 3UVLA 4BH6A 4J78A 2AGWA 2CN2A 4XYHA 5FQDA 2CO0A 2PM9A 4X3EA 2W18A 4ERYA 4J82A 3OL2A 2HESX 4FA4D 4ZOYA 4J73A 3UVKA 1ERJA 3SBRA 3MKSB 4R7AB 3PXWD 1SQJA 3J80g 4CI2A 4HDJA 1JMZB 2HYEA 2TRCB 3IJ0A 4X60B 5H14A 2BBKH 4CI1A 3CFVA 3SBQA 4PSWB 3I7OA 4FA5D 3SFZA 5AFU3 4OZUA 4FB1D 5HE3B 4CY3A 3OKYB 4CZXA 5IJ8E 4XYIA 3SWSD 1SHYB 3N0EA 3UKRC 3VH0A 4E5ZB 3GREA 4J0WA 2EBSA 1NEXB 3EG6A 2HKRA 3RLMD 2H6KA 5I5JA 3W15A 2P9IC 3I89A 3ULEC 5CYKB 4FAND 3C99A 3PXSD 5CXCA 4CY5A 1OLZA 3IIWA 2H3XA 4JT5C 3V9FA 2PM7B 4FWWA 3E0CA 5AMSA 2YNNA 4A11B 5HYNB 4JSVC 4A7JA 3I7LA 1SQ9A 3JZNA 3SCYA 5EM2A 3DWLC 1A0RB 2IWKA 3EI4B 1RI6A 2G9AA 2OIZA 4N14A 3EI1A 5GMKn 2QXVA 3NVNA 3UVNA 1Q47A 1XHMA 4O3TB 1N6DA 1JOFA 4GGCA 5B4WA 4ZOXA 4J87A 1K8KC 3PSCB 4A08B 4UI9R 3L4OD 4H5JA 2B5MA 3RFGA 3MXXA 4GZ8A 4J8GA 2Z2OA 2PM6B 3BG1A 5GXIA 3DSMA 4K3ID 4GM8A 4GQBB 5FKTA 2HXCA 1PEVA 2Q7QA 3MZKA 3RSEC 1PBYB 4JSNC 3OKYA 5GXHA 5TEFA 3RN1D 3DXKC 3JAMg 5THAA 2HJ4A 5IJ7E 2B5LA 3PSLA 4A11A 3V7DB 3BWSA 4E54A 5FKQA 4GGAA 3EI1B 2G99A 2H9PA 3DXMC 5FLXg 4IA9A 5TF2A 1TBGA 4L3HD 4I79A 3AL8B 2YBAA 3A0FA 4J84A 4PC0A 2J55H 5KDOB 3I7PA 4PBYA 1JJUB 3MZLA 3MMYA 2H6QA 5FA5B 2CO0C 3CIKB 3SXTD 4Y7RA 3SJLD 4FA1D 2IAAA 4ERZA 5CXBA 4Y5RD 4O3UB 1GOTB 2YNOA 4A2LA 4GM3A 2XYIA 4L3GD 2OK4A 3C9CA 3AL9A 3MKQA 1K32A 5A2Qg 2GNQA 2BCJB 5FKRA 4D6VA 2P9SC 5H1MA 4ES0A 2HJBA 2CN3A 4D0KA 2XL3A 4ZOVA 4CZYA 2H47A 3FRXA 3GFCA 4QT8A 3AL8A 2Z2PA 3SHFA 2P9LC 4GMBA 4LG8A 5K19A 4JD2C 1R5MA 2GC7A 4QRJA 3RMZD 3ZWLB 2H9NA 2MTAH 2CNXA 2I3SA 3IKOA 2H14A 2UZXB 4BL0A 4TZ4A 2H9LA 4J81A 3SLED 5GSAA 3IJ1A 4X63B 1L0QA 3JPXA 3K27A 2B5NA 5HE2B 4CI8A 2AGXA 3ODTA 3EI3A 3EMHA 2OVPB
chains in the Genus database with same CATH superfamily
4BUJC 4U7AA 4MMXA 5AJAA 2OJYA 4L9OA 1T2XA 4ZN4A 3B7FA 3DDUA 1U2VC 3EI2A 3FCSA 5EMLB 4AEZA 3HFQA 2AGZA 4CC9A 3CFSB 3RFHA 5HQGA 4AN0A 2VC2A 1N6FA 5IGOA 5EALA 3AH8B 4K3JB 3F3GA 1TYQC 4ESGA 2OK6A 1XKSA 4AX4A 1GG2B 3SN6B 4A09A 5E6SA 2I0SA 4EWRA 4A08A 2J56H 1C9LA 4ZOZA 5EAPA 2IUVA 5HE0B 5SXMA 1E8NA 1B9XA 2CE8A 3JB9L 1JMXB 3IUQA 4IMMA 4QQEA 1MDAH 1UOOA 4GQ2P 4AOWA 3C5MA 3I7HA 4GQ1A 1A12A 3OTTA 1VYHC 2XU7A 4PSXB 2IURA 3PVWB 4CI3A 1MG2A 2CE9A 4Z7OA 4LG9A 3IVMA 3NIGA 2GC4A 2B4EA 2IUQA 1N6EA 4H5IA 1TYEA 4JSPC 4XEIC 5IC7A 3UVOA 5I5IA 5EMMB 5C9ZB 5TEEA 3VI3A 3UR4A 1PGUA 1S4UX 2P9KC 3IIYA 3JZGA 3P4FA 1QFSA 4G1EA 3ZDZA 2VDKA 4KFMB 4A0AA 2VZ1A 3K26A 3OKWA 3PVUB 3OW8A 5M5SA 1YFQA 2H68A 4ERQA 3I8EA 3I7NA 4D9SA 4J79A 4DNUA 1U8CA 5CXBB 3J81g 2J57G 2O9KA 5K1CC 3IUMA 3EWEA 3L4MD 2QR5A 4Z8LA 5EMKB 2HKMA 5C2VB 2P9UC 3DM0A 3JZHA 3OL2B 5JWZA 4PBZA 3QHYB 2I3TA 3IURA 4PNKB 4OWRA 3ZE0A 2QC5A 4Z7QA 1P22A 2IWFA 5CYKA 4FAVD 5C86A 4GM9A 1GOFA 4WJKA 3SVWD 1H2ZA 4X61B 2Z2NA 3JRPA 4J8BA 4JT6C 3I8CA 2AH1A 1YR2A 4JXMA 3NVXA 1NR0A 4GGDA 4A0BA 3N0DA 3EI3B 3F3PA 5M5TA 3AFCA 5EMJB 1GOHA 5EM2B 3EQ8A 3I7KA 5IT9g 2EIEA 4NC4A 4CY1A 2VDOA 2YMUA 3I2NA 3BG0A 3FGBA 2YB8B 2AGYA 2H9MA 3PXTD 4MK0B 3KRWB 5FKSA 3NIDA 4J86A 5I5MA 2UZYB 2PM9B 2I0TA 5FFOA 3F3FA 3KCIA 3SMRA 4A2MA 3ZDYA 1OMWB 4E5ZA 5EAMA 1U4CA 2P9NC 4FHLA 2JKXA 3ZDXA 1H2XA 5IGQA 3IJCA 3ORVD 3EU7A 5EARA 1QNIA 4AN1A 2VDRA 2IUPA 3FM0A 2YNPA 3EI2B 2H6NA 3NIFA 3NVQA 4U1EI 4PXWA 5TDHB 1VZ2A 2AH0A 4FA9D 4CZVA 3VA6A 1BPOA 3C75H 3EI4A 4NSXA 4A09B 5CXCB 4NENA 1PI6A 2I0RA 4O02A 4QL1A 2EIDA 4L1QD 4A0AB 1GXRA 2VDQA 1XIPA 4J77A 5H17A 4G56B 1FWXA 2OVQB 4L1MA 4LGNA 3UKUC 2AGLA 3OKTA 3JROA 2P9PC 5HE1B 3O4GA 1GP2B 1M1XA 5C2WB 3VGZA 3SBPA 2AQ5A 2VZ3A 4O45A 4A0BB 1UOQA 3V5WB 2H13A 3U4YA 1MG3A 2OVRB 1B9YA 4O1QD 3RN0D 1O6GA 4J0XA 4JSXC 4CY2A 4E54B 3V4PA 4O9DA 3UVMA 3KRXB 2PBIB 4YVDA 3RRMC 1JTDB 3O4JA 5FXYA 3ZE1A 2WQ8A 3PE7A 2XL2A 3UVLA 4BH6A 3ZE2A 4J78A 2AGWA 2CN2A 4XYHA 5FQDA 2CO0A 2PM9A 4X3EA 2W18A 1I2MB 3VI4A 4QAMA 4ERYA 5C92A 4J82A 3OL2A 2HESX 4FA4D 4ZOYA 4J73A 3UVKA 1E8MA 3IJEA 1ERJA 4BP8A 5M61A 3SBRA 3MKSB 4R7AB 5E6RA 3PXWD 2XZGA 1SQJA 3K72A 4CI2A 3J80g 4HDJA 1JMZB 2EIBA 4NAAA 2HYEA 2TRCB 3IJ0A 4X60B 5H14A 3O4HA 2BBKH 4CI1A 3CFVA 3SBQA 4PSWB 1VE6A 3FCUA 3I7OA 4FA5D 3SFZA 4RE5A 5AFU3 2HU8A 4OZUA 4FB1D 5HE3B 4CY3A 3OKYB 4CZXA 5IJ8E 4G1MA 4XYIA 2VDNA 3SWSD 1SHYB 1H2YA 3N0EA 3UKRC 3VH0A 4E5ZB 3IUNA 3GREA 4J0WA 3MVDK 2EBSA 4MMYA 1NEXB 3EG6A 2HKRA 3RLMD 4AMZA 2H6KA 5I5JA 3W15A 2P9IC 3I89A 3ULEC 5CYKB 4FAND 3C99A 3PXSD 5CXCA 4CY5A 1OLZA 3IIWA 2H3XA 4JT5C 3QI0A 3V9FA 2PM7B 4FWWA 4DNWA 2XE4A 4BP9A 1JV2A 3E0CA 4AMYA 5AMSA 2YNNA 4A11B 5HYNB 4JSVC 4A7JA 3I7LA 1UOPA 5M5RA 1SQ9A 3JZNA 5M5VA 3SCYA 5EM2A 3DWLC 1A0RB 3K71A 2IWKA 3EI4B 1RI6A 2G9AA 2OIZA 3IUJA 4N14A 5GMKn 3EI1A 2QXVA 3NVNA 3UVNA 2VDPA 1Q47A 1XHMA 4O3TB 1N6DA 1JOFA 4GGCA 5B4WA 4ZOXA 4J87A 3PSCB 1K8KC 4A08B 3L4OD 4H5JA 4UI9R 2B5MA 3RFGA 3MXXA 4GZ8A 3T3MA 4J8GA 5HDBA 2Z2OA 2PM6B 3BG1A 5GXIA 4BCDA 3DSMA 4GM8A 4K3ID 4GQBB 5FKTA 4WK0A 4G55A 3MUOA 2HXCA 1PEVA 1VZ3A 2Q7QA 3MZKA 3RSEC 5M5UA 1PBYB 4JSNC 1VE7A 1E5TA 3OKYA 4JHNA 5GXHA 5TEFA 3GD1I 3RN1D 3DXKC 3O4IA 3JAMg 5THAA 2HJ4A 5IJ7E 2B5LA 3EQ9A 3PSLA 4A11A 3V7DB 3BWSA 4WK2A 3K6SA 4E54A 5FKQA 4GGAA 1H2WA 4MMZA 3EI1B 2G99A 2H9PA 3DXMC 5FLXg 2VDMA 4IA9A 3MUNA 4RE6A 5TF2A 1TBGA 4JHPC 4L3HD 4I79A 3AL8B 2YBAA 3A0FA 4J84A 4PC0A 2J55H 5KDOB 3I7PA 4PBYA 1JJUB 3MZLA 3MMYA 2H6QA 1K3IA 5FA5B 4BCBA 2CO0C 3CIKB 3SXTD 4Y7RA 3SJLD 4FA1D 3OF7A 4WK4A 1C9IA 2IAAA 4ERZA 5CXBA 4Y5RD 4O3UB 1GOTB 2YNOA 4A2LA 4GM3A 2XYIA 4L3GD 2XDWA 4O2WA 4UM9A 2OK4A 3V4VA 3C9CA 3AL9A 3MKQA 1K32A 2HU7A 2GNQA 5A2Qg 2BCJB 5FKRA 4D6VA 1UTCA 2P9SC 5H1MA 4ES0A 2HJBA 1QFMA 2CN3A 2BKLA 4IRZA 4D0KA 2XL3A 2EICA 4ZOVA 4CZYA 2H47A 3FRXA 3GC3B 3GFCA 4QT8A 3AL8A 2Z2PA 3SHFA 4UM8A 2P9LC 2QZPA 4GMBA 4Z7NA 4LG8A 5K19A 4JD2C 1R5MA 1O6FA 2GC7A 4QRJA 3RMZD 2H9NA 3T3PA 2MTAH 3ZWLB 2CNXA 2HU5A 5FFGA 2I3SA 3IKOA 2H14A 4BCCA 3EQ7A 2UZXB 4BL0A 1L5GA 3IULA 4TZ4A 2H9LA 4J81A 1GOGA 5E6UA 3SLED 5GSAA 3IJ1A 4X63B 1L0QA 2VDLA 3JPXA 4NBMA 3K27A 2B5NA 5HE2B 4CI8A 2AGXA 3ODTA 3EI3A 4DNVA 3EMHA 2OVPB
chains in the Genus database with same CATH topology
4BUJC 4U7AA 5AJAA 2OJYA 4L9OA 4ZN4A 3B7FA 1U2VC 3EI2A 5EMLB 4AEZA 3HFQA 2AGZA 4CC9A 3CFSB 3RFHA 5HQGA 1N6FA 5IGOA 5EALA 3AH8B 4K3JB 3F3GA 1TYQC 4ESGA 2OK6A 1XKSA 1GG2B 3SN6B 4A09A 4EWRA 2I0SA 4A08A 2J56H 4ZOZA 5EAPA 2IUVA 5HE0B 5SXMA 1B9XA 2CE8A 3JB9L 1JMXB 4IMMA 4QQEA 1MDAH 4GQ2P 4AOWA 3C5MA 3I7HA 4GQ1A 3OTTA 1VYHC 2XU7A 4PSXB 2IURA 3PVWB 4CI3A 1MG2A 2CE9A 4LG9A 2GC4A 2B4EA 2IUQA 1N6EA 4H5IA 4JSPC 5IC7A 4XEIC 3UVOA 5I5IA 5EMMB 5C9ZB 5TEEA 3UR4A 1PGUA 1S4UX 2P9KC 3IIYA 3JZGA 3P4FA 4KFMB 4A0AA 3K26A 3OKWA 3PVUB 3OW8A 1YFQA 2H68A 4ERQA 3I8EA 3I7NA 4J79A 5CXBB 3J81g 2J57G 2O9KA 5K1CC 3EWEA 3L4MD 4Z8LA 5EMKB 2HKMA 5C2VB 2P9UC 3DM0A 3JZHA 3OL2B 5JWZA 4PBZA 2I3TA 4PNKB 4OWRA 2QC5A 1P22A 2IWFA 5CYKA 4FAVD 4GM9A 3SVWD 4X61B 2Z2NA 3JRPA 4J8BA 4JT6C 3I8CA 2AH1A 4JXMA 3NVXA 1NR0A 4GGDA 4A0BA 3N0DA 3EI3B 3F3PA 3AFCA 5EMJB 5EM2B 3I7KA 5IT9g 4CY1A 2YMUA 3I2NA 3BG0A 3FGBA 2YB8B 2AGYA 2H9MA 3PXTD 4MK0B 3KRWB 5FKSA 4J86A 5I5MA 2UZYB 2PM9B 2I0TA 3F3FA 3SMRA 4A2MA 1OMWB 4E5ZA 5EAMA 1U4CA 2P9NC 4FHLA 5IGQA 3IJCA 3ORVD 3EU7A 5EARA 1QNIA 2IUPA 3FM0A 2YNPA 3EI2B 2H6NA 3NVQA 4U1EI 4PXWA 5TDHB 2AH0A 4FA9D 4CZVA 3VA6A 3C75H 3EI4A 4NSXA 4A09B 5CXCB 1PI6A 2I0RA 4QL1A 4L1QD 4A0AB 1GXRA 1XIPA 4J77A 5H17A 4G56B 1FWXA 2OVQB 4LGNA 3UKUC 2AGLA 3JROA 3OKTA 2P9PC 5HE1B 1GP2B 5C2WB 3VGZA 3SBPA 2AQ5A 4O45A 4A0BB 3V5WB 2H13A 3U4YA 1MG3A 2OVRB 1B9YA 4O1QD 3RN0D 4CY2A 4J0XA 4JSXC 4E54B 4O9DA 3UVMA 3KRXB 2PBIB 4YVDA 3RRMC 5FXYA 3PE7A 2XL2A 3UVLA 4BH6A 4J78A 2AGWA 2CN2A 4XYHA 5FQDA 2CO0A 2PM9A 4X3EA 2W18A 4ERYA 4J82A 3OL2A 2HESX 4FA4D 4ZOYA 4J73A 3UVKA 1ERJA 3SBRA 3MKSB 4R7AB 3PXWD 1SQJA 3J80g 4CI2A 4HDJA 1JMZB 2HYEA 2TRCB 3IJ0A 4X60B 5H14A 2BBKH 4CI1A 3CFVA 3SBQA 4PSWB 3I7OA 4FA5D 3SFZA 5AFU3 4OZUA 4FB1D 5HE3B 4CY3A 3OKYB 4CZXA 5IJ8E 4XYIA 3SWSD 1SHYB 3N0EA 3UKRC 3VH0A 4E5ZB 3GREA 4J0WA 2EBSA 1NEXB 3EG6A 2HKRA 3RLMD 2H6KA 5I5JA 3W15A 2P9IC 3I89A 3ULEC 5CYKB 4FAND 3C99A 3PXSD 5CXCA 4CY5A 1OLZA 3IIWA 2H3XA 4JT5C 3V9FA 2PM7B 4FWWA 3E0CA 5AMSA 2YNNA 4A11B 5HYNB 4JSVC 4A7JA 3I7LA 1SQ9A 3JZNA 3SCYA 5EM2A 3DWLC 1A0RB 2IWKA 3EI4B 1RI6A 2G9AA 2OIZA 4N14A 3EI1A 5GMKn 2QXVA 3NVNA 3UVNA 1Q47A 1XHMA 4O3TB 1N6DA 1JOFA 4GGCA 5B4WA 4ZOXA 4J87A 1K8KC 3PSCB 4A08B 4UI9R 3L4OD 4H5JA 2B5MA 3RFGA 3MXXA 4GZ8A 4J8GA 2Z2OA 2PM6B 3BG1A 5GXIA 3DSMA 4K3ID 4GM8A 4GQBB 5FKTA 2HXCA 1PEVA 2Q7QA 3MZKA 3RSEC 1PBYB 4JSNC 3OKYA 5GXHA 5TEFA 3RN1D 3DXKC 3JAMg 5THAA 2HJ4A 5IJ7E 2B5LA 3PSLA 4A11A 3V7DB 3BWSA 4E54A 5FKQA 4GGAA 3EI1B 2G99A 2H9PA 3DXMC 5FLXg 4IA9A 5TF2A 1TBGA 4L3HD 4I79A 3AL8B 2YBAA 3A0FA 4J84A 4PC0A 2J55H 5KDOB 3I7PA 4PBYA 1JJUB 3MZLA 3MMYA 2H6QA 5FA5B 2CO0C 3CIKB 3SXTD 4Y7RA 3SJLD 4FA1D 2IAAA 4ERZA 5CXBA 4Y5RD 4O3UB 1GOTB 2YNOA 4A2LA 4GM3A 2XYIA 4L3GD 2OK4A 3C9CA 3AL9A 3MKQA 1K32A 5A2Qg 2GNQA 2BCJB 5FKRA 4D6VA 2P9SC 5H1MA 4ES0A 2HJBA 2CN3A 4D0KA 2XL3A 4ZOVA 4CZYA 2H47A 3FRXA 3GFCA 4QT8A 3AL8A 2Z2PA 3SHFA 2P9LC 4GMBA 4LG8A 5K19A 4JD2C 1R5MA 2GC7A 4QRJA 3RMZD 3ZWLB 2H9NA 2MTAH 2CNXA 2I3SA 3IKOA 2H14A 2UZXB 4BL0A 4TZ4A 2H9LA 4J81A 3SLED 5GSAA 3IJ1A 4X63B 1L0QA 3JPXA 3K27A 2B5NA 5HE2B 4CI8A 2AGXA 3ODTA 3EI3A 3EMHA 2OVPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUJ C;  4U7A A;  5AJA A;  2OJY A;  4L9O A;  4ZN4 A;  3B7F A;  1U2V C;  3EI2 A;  5EML B;  4AEZ A;  3HFQ A;  2AGZ A;  4CC9 A;  3CFS B;  3RFH A;  5HQG A;  1N6F A;  5IGO A;  5EAL A;  3AH8 B;  4K3J B;  3F3G A;  1TYQ C;  4ESG A;  2OK6 A;  1XKS A;  1GG2 B;  3SN6 B;  4A09 A;  4EWR A;  2I0S A;  4A08 A;  2J56 H;  4ZOZ A;  5EAP A;  2IUV A;  5HE0 B;  5SXM A;  1B9X A;  2CE8 A;  3JB9 L;  1JMX B;  4IMM A;  4QQE A;  1MDA H;  4GQ2 P;  4AOW A;  3C5M A;  3I7H A;  4GQ1 A;  3OTT A;  1VYH C;  2XU7 A;  4PSX B;  2IUR A;  3PVW B;  4CI3 A;  1MG2 A;  2CE9 A;  4LG9 A;  2GC4 A;  2B4E A;  2IUQ A;  1N6E A;  4H5I A;  4JSP C;  5IC7 A;  4XEI C;  3UVO A;  5I5I A;  5EMM B;  5C9Z B;  5TEE A;  3UR4 A;  1PGU A;  1S4U X;  2P9K C;  3IIY A;  3JZG A;  3P4F A;  4KFM B;  4A0A A;  3K26 A;  3OKW A;  3PVU B;  3OW8 A;  1YFQ A;  2H68 A;  4ERQ A;  3I8E A;  3I7N A;  4J79 A;  5CXB B;  3J81 g;  2J57 G;  2O9K A;  5K1C C;  3EWE A;  3L4M D;  4Z8L A;  5EMK B;  2HKM A;  5C2V B;  2P9U C;  3DM0 A;  3JZH A;  3OL2 B;  5JWZ A;  4PBZ A;  2I3T A;  4PNK B;  4OWR A;  2QC5 A;  1P22 A;  2IWF A;  5CYK A;  4FAV D;  4GM9 A;  3SVW D;  4X61 B;  2Z2N A;  3JRP A;  4J8B A;  4JT6 C;  3I8C A;  2AH1 A;  4JXM A;  3NVX A;  1NR0 A;  4GGD A;  4A0B A;  3N0D A;  3EI3 B;  3F3P A;  3AFC A;  5EMJ B;  5EM2 B;  3I7K A;  5IT9 g;  4CY1 A;  2YMU A;  3I2N A;  3BG0 A;  3FGB A;  2YB8 B;  2AGY A;  2H9M A;  3PXT D;  4MK0 B;  3KRW B;  5FKS A;  4J86 A;  5I5M A;  2UZY B;  2PM9 B;  2I0T A;  3F3F A;  3SMR A;  4A2M A;  1OMW B;  4E5Z A;  5EAM A;  1U4C A;  2P9N C;  4FHL A;  5IGQ A;  3IJC A;  3ORV D;  3EU7 A;  5EAR A;  1QNI A;  2IUP A;  3FM0 A;  2YNP A;  3EI2 B;  2H6N A;  3NVQ A;  4U1E I;  4PXW A;  5TDH B;  2AH0 A;  4FA9 D;  4CZV A;  3VA6 A;  3C75 H;  3EI4 A;  4NSX A;  4A09 B;  5CXC B;  1PI6 A;  2I0R A;  4QL1 A;  4L1Q D;  4A0A B;  1GXR A;  1XIP A;  4J77 A;  5H17 A;  4G56 B;  1FWX A;  2OVQ B;  4LGN A;  3UKU C;  2AGL A;  3JRO A;  3OKT A;  2P9P C;  5HE1 B;  1GP2 B;  5C2W B;  3VGZ A;  3SBP A;  2AQ5 A;  4O45 A;  4A0B B;  3V5W B;  2H13 A;  3U4Y A;  1MG3 A;  2OVR B;  1B9Y A;  4O1Q D;  3RN0 D;  4CY2 A;  4J0X A;  4JSX C;  4E54 B;  4O9D A;  3UVM A;  3KRX B;  2PBI B;  4YVD A;  3RRM C;  5FXY A;  3PE7 A;  2XL2 A;  3UVL A;  4BH6 A;  4J78 A;  2AGW A;  2CN2 A;  4XYH A;  5FQD A;  2CO0 A;  2PM9 A;  4X3E A;  2W18 A;  4ERY A;  4J82 A;  3OL2 A;  2HES X;  4FA4 D;  4ZOY A;  4J73 A;  3UVK A;  1ERJ A;  3SBR A;  3MKS B;  4R7A B;  3PXW D;  1SQJ A;  3J80 g;  4CI2 A;  4HDJ A;  1JMZ B;  2HYE A;  2TRC B;  3IJ0 A;  4X60 B;  5H14 A;  2BBK H;  4CI1 A;  3CFV A;  3SBQ A;  4PSW B;  3I7O A;  4FA5 D;  3SFZ A;  5AFU 3;  4OZU A;  4FB1 D;  5HE3 B;  4CY3 A;  3OKY B;  4CZX A;  5IJ8 E;  4XYI A;  3SWS D;  1SHY B;  3N0E A;  3UKR C;  3VH0 A;  4E5Z B;  3GRE A;  4J0W A;  2EBS A;  1NEX B;  3EG6 A;  2HKR A;  3RLM D;  2H6K A;  5I5J A;  3W15 A;  2P9I C;  3I89 A;  3ULE C;  5CYK B;  4FAN D;  3C99 A;  3PXS D;  5CXC A;  4CY5 A;  1OLZ A;  3IIW A;  2H3X A;  4JT5 C;  3V9F A;  2PM7 B;  4FWW A;  3E0C A;  5AMS A;  2YNN A;  4A11 B;  5HYN B;  4JSV C;  4A7J A;  3I7L A;  1SQ9 A;  3JZN A;  3SCY A;  5EM2 A;  3DWL C;  1A0R B;  2IWK A;  3EI4 B;  1RI6 A;  2G9A A;  2OIZ A;  4N14 A;  3EI1 A;  5GMK n;  2QXV A;  3NVN A;  3UVN A;  1Q47 A;  1XHM A;  4O3T B;  1N6D A;  1JOF A;  4GGC A;  5B4W A;  4ZOX A;  4J87 A;  1K8K C;  3PSC B;  4A08 B;  4UI9 R;  3L4O D;  4H5J A;  2B5M A;  3RFG A;  3MXX A;  4GZ8 A;  4J8G A;  2Z2O A;  2PM6 B;  3BG1 A;  5GXI A;  3DSM A;  4K3I D;  4GM8 A;  4GQB B;  5FKT A;  2HXC A;  1PEV A;  2Q7Q A;  3MZK A;  3RSE C;  1PBY B;  4JSN C;  3OKY A;  5GXH A;  5TEF A;  3RN1 D;  3DXK C;  3JAM g;  5THA A;  2HJ4 A;  5IJ7 E;  2B5L A;  3PSL A;  4A11 A;  3V7D B;  3BWS A;  4E54 A;  5FKQ A;  4GGA A;  3EI1 B;  2G99 A;  2H9P A;  3DXM C;  5FLX g;  4IA9 A;  5TF2 A;  1TBG A;  4L3H D;  4I79 A;  3AL8 B;  2YBA A;  3A0F A;  4J84 A;  4PC0 A;  2J55 H;  5KDO B;  3I7P A;  4PBY A;  1JJU B;  3MZL A;  3MMY A;  2H6Q A;  5FA5 B;  2CO0 C;  3CIK B;  3SXT D;  4Y7R A;  3SJL D;  4FA1 D;  2IAA A;  4ERZ A;  5CXB A;  4Y5R D;  4O3U B;  1GOT B;  2YNO A;  4A2L A;  4GM3 A;  2XYI A;  4L3G D;  2OK4 A;  3C9C A;  3AL9 A;  3MKQ A;  1K32 A;  5A2Q g;  2GNQ A;  2BCJ B;  5FKR A;  4D6V A;  2P9S C;  5H1M A;  4ES0 A;  2HJB A;  2CN3 A;  4D0K A;  2XL3 A;  4ZOV A;  4CZY A;  2H47 A;  3FRX A;  3GFC A;  4QT8 A;  3AL8 A;  2Z2P A;  3SHF A;  2P9L C;  4GMB A;  4LG8 A;  5K19 A;  4JD2 C;  1R5M A;  2GC7 A;  4QRJ A;  3RMZ D;  3ZWL B;  2H9N A;  2MTA H;  2CNX A;  2I3S A;  3IKO A;  2H14 A;  2UZX B;  4BL0 A;  4TZ4 A;  2H9L A;  4J81 A;  3SLE D;  5GSA A;  3IJ1 A;  4X63 B;  1L0Q A;  3JPX A;  3K27 A;  2B5N A;  5HE2 B;  4CI8 A;  2AGX A;  3ODT A;  3EI3 A;  3EMH A;  2OVP B; 
#chains in the Genus database with same CATH topology
 4BUJ C;  4U7A A;  4MMX A;  5AJA A;  2OJY A;  4L9O A;  1T2X A;  4ZN4 A;  3B7F A;  3DDU A;  1U2V C;  3EI2 A;  3FCS A;  5EML B;  4AEZ A;  3HFQ A;  2AGZ A;  4CC9 A;  3CFS B;  3RFH A;  5HQG A;  4AN0 A;  2VC2 A;  1N6F A;  5IGO A;  5EAL A;  3AH8 B;  4K3J B;  3F3G A;  1TYQ C;  4ESG A;  2OK6 A;  1XKS A;  4AX4 A;  1GG2 B;  3SN6 B;  4A09 A;  5E6S A;  2I0S A;  4EWR A;  4A08 A;  2J56 H;  1C9L A;  4ZOZ A;  5EAP A;  2IUV A;  5HE0 B;  5SXM A;  1E8N A;  1B9X A;  2CE8 A;  3JB9 L;  1JMX B;  3IUQ A;  4IMM A;  4QQE A;  1MDA H;  1UOO A;  4GQ2 P;  4AOW A;  3C5M A;  3I7H A;  4GQ1 A;  1A12 A;  3OTT A;  1VYH C;  2XU7 A;  4PSX B;  2IUR A;  3PVW B;  4CI3 A;  1MG2 A;  2CE9 A;  4Z7O A;  4LG9 A;  3IVM A;  3NIG A;  2GC4 A;  2B4E A;  2IUQ A;  1N6E A;  4H5I A;  1TYE A;  4JSP C;  4XEI C;  5IC7 A;  3UVO A;  5I5I A;  5EMM B;  5C9Z B;  5TEE A;  3VI3 A;  3UR4 A;  1PGU A;  1S4U X;  2P9K C;  3IIY A;  3JZG A;  3P4F A;  1QFS A;  4G1E A;  3ZDZ A;  2VDK A;  4KFM B;  4A0A A;  2VZ1 A;  3K26 A;  3OKW A;  3PVU B;  3OW8 A;  5M5S A;  1YFQ A;  2H68 A;  4ERQ A;  3I8E A;  3I7N A;  4D9S A;  4J79 A;  4DNU A;  1U8C A;  5CXB B;  3J81 g;  2J57 G;  2O9K A;  5K1C C;  3IUM A;  3EWE A;  3L4M D;  2QR5 A;  4Z8L A;  5EMK B;  2HKM A;  5C2V B;  2P9U C;  3DM0 A;  3JZH A;  3OL2 B;  5JWZ A;  4PBZ A;  3QHY B;  2I3T A;  3IUR A;  4PNK B;  4OWR A;  3ZE0 A;  2QC5 A;  4Z7Q A;  1P22 A;  2IWF A;  5CYK A;  4FAV D;  5C86 A;  4GM9 A;  1GOF A;  4WJK A;  3SVW D;  1H2Z A;  4X61 B;  2Z2N A;  3JRP A;  4J8B A;  4JT6 C;  3I8C A;  2AH1 A;  1YR2 A;  4JXM A;  3NVX A;  1NR0 A;  4GGD A;  4A0B A;  3N0D A;  3EI3 B;  3F3P A;  5M5T A;  3AFC A;  5EMJ B;  1GOH A;  5EM2 B;  3EQ8 A;  3I7K A;  5IT9 g;  2EIE A;  4NC4 A;  4CY1 A;  2VDO A;  2YMU A;  3I2N A;  3BG0 A;  3FGB A;  2YB8 B;  2AGY A;  2H9M A;  3PXT D;  4MK0 B;  3KRW B;  5FKS A;  3NID A;  4J86 A;  5I5M A;  2UZY B;  2PM9 B;  2I0T A;  5FFO A;  3F3F A;  3KCI A;  3SMR A;  4A2M A;  3ZDY A;  1OMW B;  4E5Z A;  5EAM A;  1U4C A;  2P9N C;  4FHL A;  2JKX A;  3ZDX A;  1H2X A;  5IGQ A;  3IJC A;  3ORV D;  3EU7 A;  5EAR A;  1QNI A;  4AN1 A;  2VDR A;  2IUP A;  3FM0 A;  2YNP A;  3EI2 B;  2H6N A;  3NIF A;  3NVQ A;  4U1E I;  4PXW A;  5TDH B;  1VZ2 A;  2AH0 A;  4FA9 D;  4CZV A;  3VA6 A;  1BPO A;  3C75 H;  3EI4 A;  4NSX A;  4A09 B;  5CXC B;  4NEN A;  1PI6 A;  2I0R A;  4O02 A;  4QL1 A;  2EID A;  4L1Q D;  4A0A B;  1GXR A;  2VDQ A;  1XIP A;  4J77 A;  5H17 A;  4G56 B;  1FWX A;  2OVQ B;  4L1M A;  4LGN A;  3UKU C;  2AGL A;  3OKT A;  3JRO A;  2P9P C;  5HE1 B;  3O4G A;  1GP2 B;  1M1X A;  5C2W B;  3VGZ A;  3SBP A;  2AQ5 A;  2VZ3 A;  4O45 A;  4A0B B;  1UOQ A;  3V5W B;  2H13 A;  3U4Y A;  1MG3 A;  2OVR B;  1B9Y A;  4O1Q D;  3RN0 D;  1O6G A;  4J0X A;  4JSX C;  4CY2 A;  4E54 B;  3V4P A;  4O9D A;  3UVM A;  3KRX B;  2PBI B;  4YVD A;  3RRM C;  1JTD B;  3O4J A;  5FXY A;  3ZE1 A;  2WQ8 A;  3PE7 A;  2XL2 A;  3UVL A;  4BH6 A;  3ZE2 A;  4J78 A;  2AGW A;  2CN2 A;  4XYH A;  5FQD A;  2CO0 A;  2PM9 A;  4X3E A;  2W18 A;  1I2M B;  3VI4 A;  4QAM A;  4ERY A;  5C92 A;  4J82 A;  3OL2 A;  2HES X;  4FA4 D;  4ZOY A;  4J73 A;  3UVK A;  1E8M A;  3IJE A;  1ERJ A;  4BP8 A;  5M61 A;  3SBR A;  3MKS B;  4R7A B;  5E6R A;  3PXW D;  2XZG A;  1SQJ A;  3K72 A;  4CI2 A;  3J80 g;  4HDJ A;  1JMZ B;  2EIB A;  4NAA A;  2HYE A;  2TRC B;  3IJ0 A;  4X60 B;  5H14 A;  3O4H A;  2BBK H;  4CI1 A;  3CFV A;  3SBQ A;  4PSW B;  1VE6 A;  3FCU A;  3I7O A;  4FA5 D;  3SFZ A;  4RE5 A;  5AFU 3;  2HU8 A;  4OZU A;  4FB1 D;  5HE3 B;  4CY3 A;  3OKY B;  4CZX A;  5IJ8 E;  4G1M A;  4XYI A;  2VDN A;  3SWS D;  1SHY B;  1H2Y A;  3N0E A;  3UKR C;  3VH0 A;  4E5Z B;  3IUN A;  3GRE A;  4J0W A;  3MVD K;  2EBS A;  4MMY A;  1NEX B;  3EG6 A;  2HKR A;  3RLM D;  4AMZ A;  2H6K A;  5I5J A;  3W15 A;  2P9I C;  3I89 A;  3ULE C;  5CYK B;  4FAN D;  3C99 A;  3PXS D;  5CXC A;  4CY5 A;  1OLZ A;  3IIW A;  2H3X A;  4JT5 C;  3QI0 A;  3V9F A;  2PM7 B;  4FWW A;  4DNW A;  2XE4 A;  4BP9 A;  1JV2 A;  3E0C A;  4AMY A;  5AMS A;  2YNN A;  4A11 B;  5HYN B;  4JSV C;  4A7J A;  3I7L A;  1UOP A;  5M5R A;  1SQ9 A;  3JZN A;  5M5V A;  3SCY A;  5EM2 A;  3DWL C;  1A0R B;  3K71 A;  2IWK A;  3EI4 B;  1RI6 A;  2G9A A;  2OIZ A;  3IUJ A;  4N14 A;  5GMK n;  3EI1 A;  2QXV A;  3NVN A;  3UVN A;  2VDP A;  1Q47 A;  1XHM A;  4O3T B;  1N6D A;  1JOF A;  4GGC A;  5B4W A;  4ZOX A;  4J87 A;  3PSC B;  1K8K C;  4A08 B;  3L4O D;  4H5J A;  4UI9 R;  2B5M A;  3RFG A;  3MXX A;  4GZ8 A;  3T3M A;  4J8G A;  5HDB A;  2Z2O A;  2PM6 B;  3BG1 A;  5GXI A;  4BCD A;  3DSM A;  4GM8 A;  4K3I D;  4GQB B;  5FKT A;  4WK0 A;  4G55 A;  3MUO A;  2HXC A;  1PEV A;  1VZ3 A;  2Q7Q A;  3MZK A;  3RSE C;  5M5U A;  1PBY B;  4JSN C;  1VE7 A;  1E5T A;  3OKY A;  4JHN A;  5GXH A;  5TEF A;  3GD1 I;  3RN1 D;  3DXK C;  3O4I A;  3JAM g;  5THA A;  2HJ4 A;  5IJ7 E;  2B5L A;  3EQ9 A;  3PSL A;  4A11 A;  3V7D B;  3BWS A;  4WK2 A;  3K6S A;  4E54 A;  5FKQ A;  4GGA A;  1H2W A;  4MMZ A;  3EI1 B;  2G99 A;  2H9P A;  3DXM C;  5FLX g;  2VDM A;  4IA9 A;  3MUN A;  4RE6 A;  5TF2 A;  1TBG A;  4JHP C;  4L3H D;  4I79 A;  3AL8 B;  2YBA A;  3A0F A;  4J84 A;  4PC0 A;  2J55 H;  5KDO B;  3I7P A;  4PBY A;  1JJU B;  3MZL A;  3MMY A;  2H6Q A;  1K3I A;  5FA5 B;  4BCB A;  2CO0 C;  3CIK B;  3SXT D;  4Y7R A;  3SJL D;  4FA1 D;  3OF7 A;  4WK4 A;  1C9I A;  2IAA A;  4ERZ A;  5CXB A;  4Y5R D;  4O3U B;  1GOT B;  2YNO A;  4A2L A;  4GM3 A;  2XYI A;  4L3G D;  2XDW A;  4O2W A;  4UM9 A;  2OK4 A;  3V4V A;  3C9C A;  3AL9 A;  3MKQ A;  1K32 A;  2HU7 A;  2GNQ A;  5A2Q g;  2BCJ B;  5FKR A;  4D6V A;  1UTC A;  2P9S C;  5H1M A;  4ES0 A;  2HJB A;  1QFM A;  2CN3 A;  2BKL A;  4IRZ A;  4D0K A;  2XL3 A;  2EIC A;  4ZOV A;  4CZY A;  2H47 A;  3FRX A;  3GC3 B;  3GFC A;  4QT8 A;  3AL8 A;  2Z2P A;  3SHF A;  4UM8 A;  2P9L C;  2QZP A;  4GMB A;  4Z7N A;  4LG8 A;  5K19 A;  4JD2 C;  1R5M A;  1O6F A;  2GC7 A;  4QRJ A;  3RMZ D;  2H9N A;  3T3P A;  2MTA H;  3ZWL B;  2CNX A;  2HU5 A;  5FFG A;  2I3S A;  3IKO A;  2H14 A;  4BCC A;  3EQ7 A;  2UZX B;  4BL0 A;  1L5G A;  3IUL A;  4TZ4 A;  2H9L A;  4J81 A;  1GOG A;  5E6U A;  3SLE D;  5GSA A;  3IJ1 A;  4X63 B;  1L0Q A;  2VDL A;  3JPX A;  4NBM A;  3K27 A;  2B5N A;  5HE2 B;  4CI8 A;  2AGX A;  3ODT A;  3EI3 A;  4DNV A;  3EMH A;  2OVP B; 
#chains in the Genus database with same CATH homology
 4BUJ C;  4U7A A;  5AJA A;  2OJY A;  4L9O A;  4ZN4 A;  3B7F A;  1U2V C;  3EI2 A;  5EML B;  4AEZ A;  3HFQ A;  2AGZ A;  4CC9 A;  3CFS B;  3RFH A;  5HQG A;  1N6F A;  5IGO A;  5EAL A;  3AH8 B;  4K3J B;  3F3G A;  1TYQ C;  4ESG A;  2OK6 A;  1XKS A;  1GG2 B;  3SN6 B;  4A09 A;  4EWR A;  2I0S A;  4A08 A;  2J56 H;  4ZOZ A;  5EAP A;  2IUV A;  5HE0 B;  5SXM A;  1B9X A;  2CE8 A;  3JB9 L;  1JMX B;  4IMM A;  4QQE A;  1MDA H;  4GQ2 P;  4AOW A;  3C5M A;  3I7H A;  4GQ1 A;  3OTT A;  1VYH C;  2XU7 A;  4PSX B;  2IUR A;  3PVW B;  4CI3 A;  1MG2 A;  2CE9 A;  4LG9 A;  2GC4 A;  2B4E A;  2IUQ A;  1N6E A;  4H5I A;  4JSP C;  5IC7 A;  4XEI C;  3UVO A;  5I5I A;  5EMM B;  5C9Z B;  5TEE A;  3UR4 A;  1PGU A;  1S4U X;  2P9K C;  3IIY A;  3JZG A;  3P4F A;  4KFM B;  4A0A A;  3K26 A;  3OKW A;  3PVU B;  3OW8 A;  1YFQ A;  2H68 A;  4ERQ A;  3I8E A;  3I7N A;  4J79 A;  5CXB B;  3J81 g;  2J57 G;  2O9K A;  5K1C C;  3EWE A;  3L4M D;  4Z8L A;  5EMK B;  2HKM A;  5C2V B;  2P9U C;  3DM0 A;  3JZH A;  3OL2 B;  5JWZ A;  4PBZ A;  2I3T A;  4PNK B;  4OWR A;  2QC5 A;  1P22 A;  2IWF A;  5CYK A;  4FAV D;  4GM9 A;  3SVW D;  4X61 B;  2Z2N A;  3JRP A;  4J8B A;  4JT6 C;  3I8C A;  2AH1 A;  4JXM A;  3NVX A;  1NR0 A;  4GGD A;  4A0B A;  3N0D A;  3EI3 B;  3F3P A;  3AFC A;  5EMJ B;  5EM2 B;  3I7K A;  5IT9 g;  4CY1 A;  2YMU A;  3I2N A;  3BG0 A;  3FGB A;  2YB8 B;  2AGY A;  2H9M A;  3PXT D;  4MK0 B;  3KRW B;  5FKS A;  4J86 A;  5I5M A;  2UZY B;  2PM9 B;  2I0T A;  3F3F A;  3SMR A;  4A2M A;  1OMW B;  4E5Z A;  5EAM A;  1U4C A;  2P9N C;  4FHL A;  5IGQ A;  3IJC A;  3ORV D;  3EU7 A;  5EAR A;  1QNI A;  2IUP A;  3FM0 A;  2YNP A;  3EI2 B;  2H6N A;  3NVQ A;  4U1E I;  4PXW A;  5TDH B;  2AH0 A;  4FA9 D;  4CZV A;  3VA6 A;  3C75 H;  3EI4 A;  4NSX A;  4A09 B;  5CXC B;  1PI6 A;  2I0R A;  4QL1 A;  4L1Q D;  4A0A B;  1GXR A;  1XIP A;  4J77 A;  5H17 A;  4G56 B;  1FWX A;  2OVQ B;  4LGN A;  3UKU C;  2AGL A;  3JRO A;  3OKT A;  2P9P C;  5HE1 B;  1GP2 B;  5C2W B;  3VGZ A;  3SBP A;  2AQ5 A;  4O45 A;  4A0B B;  3V5W B;  2H13 A;  3U4Y A;  1MG3 A;  2OVR B;  1B9Y A;  4O1Q D;  3RN0 D;  4CY2 A;  4J0X A;  4JSX C;  4E54 B;  4O9D A;  3UVM A;  3KRX B;  2PBI B;  4YVD A;  3RRM C;  5FXY A;  3PE7 A;  2XL2 A;  3UVL A;  4BH6 A;  4J78 A;  2AGW A;  2CN2 A;  4XYH A;  5FQD A;  2CO0 A;  2PM9 A;  4X3E A;  2W18 A;  4ERY A;  4J82 A;  3OL2 A;  2HES X;  4FA4 D;  4ZOY A;  4J73 A;  3UVK A;  1ERJ A;  3SBR A;  3MKS B;  4R7A B;  3PXW D;  1SQJ A;  3J80 g;  4CI2 A;  4HDJ A;  1JMZ B;  2HYE A;  2TRC B;  3IJ0 A;  4X60 B;  5H14 A;  2BBK H;  4CI1 A;  3CFV A;  3SBQ A;  4PSW B;  3I7O A;  4FA5 D;  3SFZ A;  5AFU 3;  4OZU A;  4FB1 D;  5HE3 B;  4CY3 A;  3OKY B;  4CZX A;  5IJ8 E;  4XYI A;  3SWS D;  1SHY B;  3N0E A;  3UKR C;  3VH0 A;  4E5Z B;  3GRE A;  4J0W A;  2EBS A;  1NEX B;  3EG6 A;  2HKR A;  3RLM D;  2H6K A;  5I5J A;  3W15 A;  2P9I C;  3I89 A;  3ULE C;  5CYK B;  4FAN D;  3C99 A;  3PXS D;  5CXC A;  4CY5 A;  1OLZ A;  3IIW A;  2H3X A;  4JT5 C;  3V9F A;  2PM7 B;  4FWW A;  3E0C A;  5AMS A;  2YNN A;  4A11 B;  5HYN B;  4JSV C;  4A7J A;  3I7L A;  1SQ9 A;  3JZN A;  3SCY A;  5EM2 A;  3DWL C;  1A0R B;  2IWK A;  3EI4 B;  1RI6 A;  2G9A A;  2OIZ A;  4N14 A;  3EI1 A;  5GMK n;  2QXV A;  3NVN A;  3UVN A;  1Q47 A;  1XHM A;  4O3T B;  1N6D A;  1JOF A;  4GGC A;  5B4W A;  4ZOX A;  4J87 A;  1K8K C;  3PSC B;  4A08 B;  4UI9 R;  3L4O D;  4H5J A;  2B5M A;  3RFG A;  3MXX A;  4GZ8 A;  4J8G A;  2Z2O A;  2PM6 B;  3BG1 A;  5GXI A;  3DSM A;  4K3I D;  4GM8 A;  4GQB B;  5FKT A;  2HXC A;  1PEV A;  2Q7Q A;  3MZK A;  3RSE C;  1PBY B;  4JSN C;  3OKY A;  5GXH A;  5TEF A;  3RN1 D;  3DXK C;  3JAM g;  5THA A;  2HJ4 A;  5IJ7 E;  2B5L A;  3PSL A;  4A11 A;  3V7D B;  3BWS A;  4E54 A;  5FKQ A;  4GGA A;  3EI1 B;  2G99 A;  2H9P A;  3DXM C;  5FLX g;  4IA9 A;  5TF2 A;  1TBG A;  4L3H D;  4I79 A;  3AL8 B;  2YBA A;  3A0F A;  4J84 A;  4PC0 A;  2J55 H;  5KDO B;  3I7P A;  4PBY A;  1JJU B;  3MZL A;  3MMY A;  2H6Q A;  5FA5 B;  2CO0 C;  3CIK B;  3SXT D;  4Y7R A;  3SJL D;  4FA1 D;  2IAA A;  4ERZ A;  5CXB A;  4Y5R D;  4O3U B;  1GOT B;  2YNO A;  4A2L A;  4GM3 A;  2XYI A;  4L3G D;  2OK4 A;  3C9C A;  3AL9 A;  3MKQ A;  1K32 A;  5A2Q g;  2GNQ A;  2BCJ B;  5FKR A;  4D6V A;  2P9S C;  5H1M A;  4ES0 A;  2HJB A;  2CN3 A;  4D0K A;  2XL3 A;  4ZOV A;  4CZY A;  2H47 A;  3FRX A;  3GFC A;  4QT8 A;  3AL8 A;  2Z2P A;  3SHF A;  2P9L C;  4GMB A;  4LG8 A;  5K19 A;  4JD2 C;  1R5M A;  2GC7 A;  4QRJ A;  3RMZ D;  3ZWL B;  2H9N A;  2MTA H;  2CNX A;  2I3S A;  3IKO A;  2H14 A;  2UZX B;  4BL0 A;  4TZ4 A;  2H9L A;  4J81 A;  3SLE D;  5GSA A;  3IJ1 A;  4X63 B;  1L0Q A;  3JPX A;  3K27 A;  2B5N A;  5HE2 B;  4CI8 A;  2AGX A;  3ODT A;  3EI3 A;  3EMH A;  2OVP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...