5IGQA

Wd40 domain of human e3 ubiquitin ligase cop1 (rfwd2) bound to peptide from trib1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
341
structure length
324
Chain Sequence
EFQECLSKFTRYNSVRPLATLSYALYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase RFWD2
publication title Structural Basis for Substrate Selectivity of the E3 Ligase COP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
total genus 74
structure length 324
sequence length 341
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5igqA00
4E5ZA 4J81A 2Z2PA 4MK0B 1GXRA 2G9AA 1SQJA 2B5NA 3SJLD 5JWZA 2H47A 5CXBB 1A0RB 2XYIA 4IMMA 2PBIB 4GMBA 5FKQA 2G99A 5EMLB 2CE8A 4CY2A 1R5MA 4J0XA 1MG2A 2IUVA 4A08B 4A0BA 5GSAA 1SQ9A 2XL2A 1S4UX 3AFCA 3L4OD 5EMJB 3EI1A 3RLMD 3UVMA 2Z2OA 3SHFA 4ERYA 2O9KA 5HE2B 4CY1A 1P22A 3CFVA 4GGAA 5SXMA 1JMZB 4LGNA 4CI8A 3C75H 3OL2A 2H13A 3JZNA 2I0TA 2CN2A 3B7FA 3NVXA 3MZLA 3MMYA 3OKYA 1K8KC 3PVUB 3EI2B 5AMSA 4PBYA 4PSWB 4X60B 3UVKA 3K26A 5I5MA 1TBGA 1L0QA 5H1MA 1ERJA 1RI6A 5K1CC 4N14A 3V7DB 4UI9R 5B4WA 2MTAH 4JSPC 4YVDA 3OTTA 4A7JA 4A0AA 4J82A 2UZXB 3JROA 2H68A 3PSLA 4XYIA 3BG0A 2PM6B 1U2VC 3EMHA 3MXXA 2HYEA 3JZHA 3EU7A 3MZKA 3SBPA 2HJ4A 2AGLA 4J86A 4CY3A 3CFSB 1U4CA 4GGCA 4HDJA 5EALA 4E54A 1JJUB 4PSXB 3DXKC 4EWRA 3IKOA 2OK4A 5IJ7E 3BG1A 1YFQA 1FWXA 4GM3A 5IJ8E 1N6DA 4GZ8A 4J8BA 2AGWA 3I7LA 1NEXB 4TZ4A 5CXCB 4X63B 5TF2A 3SN6B 1SHYB 4GQ2P 3L4MD 4JD2C 3J80g 1N6EA 2XU7A 2HKMA 5EM2B 3RSEC 4ZOVA 3W15A 2P9PC 5HE1B 2P9SC 3EWEA 3FM0A 2AGXA 3SLED 1GG2B 2H3XA 5EMMB 4Y7RA 4L3GD 1Q47A 3FGBA 3I7PA 4IA9A 3NVQA 2IWFA 2P9IC 3ODTA 4CC9A 5C2WB 3EI4B 2P9UC 3SBQA 2OJYA 3F3PA 2HESX 3DXMC 3SWSD 4PXWA 4FAND 4L3HD 4O3UB 3DWLC 2QXVA 3PXTD 4G56B 1VYHC 2CE9A 3AL8A 2Q7QA 4FA5D 3N0EA 3VA6A 4LG9A 1MG3A 4BH6A 5EARA 4QT8A 2UZYB 3ORVD 3PE7A 1PEVA 4A09B 1XIPA 3PXSD 3VH0A 3I89A 1JMXB 2GNQA 3EI3B 2IUQA 4J8GA 4GM9A 4ZOZA 4A11A 4GQBB 3I7OA 2PM9B 3AH8B 5CYKB 5AFU3 5KDOB 2YBAA 2CN3A 3C5MA 4U7AA 4CI1A 4O3TB 3SCYA 3IJ0A 2AGYA 4A2LA 5HYNB 4OZUA 2HXCA 1K32A 4U1EI 2H6NA 2GC7A 3KRXB 3RFGA 1B9XA 4E5ZB 4JSXC 3DM0A 5TDHB 3UVOA 4X3EA 4ZOYA 4L1QD 3IJ1A 3PSCB 4J78A 2OIZA 5K19A 4PBZA 3ZWLB 2OVPB 3JAMg 3NVNA 4BUJC 3SVWD 3EG6A 4FAVD 4A0BB 2OVQB 3AL9A 3SXTD 5TEFA 4FA1D 3OKTA 3EI1B 2IUPA 3DSMA 2EBSA 3IJCA 4J0WA 4JXMA 4ES0A 2W18A 5FXYA 3I7KA 5CXBA 2H9NA 5THAA 5IGQA 4GQ1A 2P9LC 2YNNA 3K27A 3OL2B 4D6VA 3E0CA 3UKUC 4A08A 2QC5A 3OKYB 3CIKB 5H14A 2YNOA 2I3SA 5I5JA 5FKRA 3I8CA 3IIYA 5IC7A 3UR4A 4PNKB 4FWWA 2B5LA 3RMZD 1OMWB 3KRWB 4H5IA 5FKSA 2B5MA 3I8EA 4JSVC 4L9OA 5HE0B 5GXIA 4A0AB 4H5JA 5I5IA 4ESGA 3VGZA 2BBKH 2OK6A 3EI2A 2I0SA 2H9PA 1PBYB 4D0KA 2CO0C 2GC4A 3J81g 3MKQA 4FHLA 5H17A 5HQGA 3FRXA 1XKSA 2P9KC 2H9LA 3RN1D 4E54B 4FA9D 5C2VB 3RN0D 1XHMA 3MKSB 4J87A 2H14A 5HE3B 3JB9L 2BCJB 3F3GA 4CZVA 3U4YA 3N0DA 5EMKB 4CZXA 2AH0A 4K3JB 4A2MA 1GOTB 2P9NC 2CNXA 4GGDA 2J56H 1PGUA 4FA4D 3GFCA 3P4FA 2TRCB 1NR0A 3A0FA 4I79A 3C9CA 4Z8LA 4CI2A 5A2Qg 3PVWB 2CO0A 2YNPA 2AH1A 4ZOXA 2PM7B 2H9MA 2J57G 3ULEC 3UVNA 3RRMC 1B9YA 2OVRB 4AOWA 5CXCA 2IAAA 3RFHA 1OLZA 4J73A 4O1QD 3V5WB 2IURA 3SFZA 5EM2A 4J84A 3SMRA 1GP2B 4ERZA 3HFQA 4J79A 4ERQA 4CI3A 3AL8B 3PXWD 5EAPA 3F3FA 5FKTA 5FLXg 3V9FA 4AEZA 4O45A 3JRPA 5EAMA 1JOFA 1QNIA 2YMUA 2YB8B 2B4EA 3C99A 2I0RA 3IIWA 2J55H 3EI4A 4QL1A 5IGOA 2H6KA 4JT6C 3OKWA 4LG8A 5GMKn 4FB1D 4QRJA 3GREA 4Y5RD 4KFMB 4PC0A 4OWRA 4XYHA 5GXHA 4JSNC 2AGZA 4A11B 5C9ZB 4GM8A 2HJBA 4O9DA 2I3TA 3JPXA 4CZYA 3I2NA 4QQEA 2IWKA 3BWSA 3SBRA 4J77A 4K3ID 5FQDA 2AQ5A 3I7NA 3I7HA 5IT9g 1MDAH 2Z2NA 5TEEA 1PI6A 2XL3A 4A09A 3UKRC 3OW8A 3EI3A 2HKRA 1TYQC 3UVLA 4R7AB 4XEIC 4CY5A 4X61B 4NSXA 1N6FA 2PM9A 5CYKA 5FA5B 4BL0A 5AJAA 3JZGA 4JT5C 4ZN4A 2H6QA
chains in the Genus database with same CATH superfamily
4WJKA 4E5ZA 4J81A 3V4VA 2Z2PA 5E6UA 4MK0B 1GXRA 2G9AA 1SQJA 2B5NA 3SJLD 5JWZA 1E5TA 2H47A 5CXBB 4NBMA 1A0RB 5M61A 2XYIA 1VZ2A 2EIDA 4IMMA 4UM8A 2PBIB 1H2YA 4GMBA 5FKQA 2G99A 5EMLB 2CE8A 4CY2A 1R5MA 4J0XA 1MG2A 5M5SA 3O4IA 4RE6A 2IUVA 4NENA 4AMYA 4DNWA 4A08B 4A0BA 3OF7A 5GSAA 1SQ9A 2XL2A 1S4UX 3AFCA 3L4OD 5EMJB 3EI1A 3RLMD 3UVMA 1UOQA 2Z2OA 3SHFA 1E8NA 4ERYA 2O9KA 5HE2B 1O6FA 4CY1A 3IJEA 5HDBA 1P22A 3CFVA 4GGAA 5SXMA 1JMZB 4LGNA 4CI8A 3C75H 5M5VA 3OL2A 3IUQA 2H13A 3JZNA 2I0TA 2CN2A 3B7FA 3NIGA 3NVXA 3MZLA 3MMYA 1L5GA 3OKYA 1K8KC 5FFOA 3PVUB 5M5TA 3EI2B 1H2WA 5AMSA 4PBYA 4PSWB 4X60B 3UVKA 3K26A 5I5MA 1TBGA 1L0QA 5H1MA 4RE5A 3QHYB 4BCCA 1ERJA 1RI6A 5K1CC 4N14A 3V7DB 4UI9R 5B4WA 3IULA 2MTAH 4JSPC 4YVDA 3OTTA 4A7JA 5C92A 1E8MA 4A0AA 4J82A 2UZXB 3JROA 2QR5A 2H68A 3PSLA 4XYIA 1QFSA 3BG0A 2PM6B 1U2VC 3EMHA 3MXXA 2HYEA 3JZHA 3EU7A 3MZKA 3SBPA 4AMZA 2HJ4A 2AGLA 4J86A 4CY3A 3CFSB 1UOOA 4O2WA 1U4CA 4GGCA 4HDJA 5EALA 4E54A 1JJUB 4PSXB 3DXKC 4EWRA 3IKOA 2OK4A 3VI3A 5IJ7E 3O4HA 3V4PA 3BG1A 1H2ZA 1YFQA 1H2XA 1FWXA 4GM3A 5IJ8E 1N6DA 4GZ8A 4J8BA 4Z7QA 2AGWA 3I7LA 1NEXB 4TZ4A 5CXCB 3MVDK 4X63B 5TF2A 3SN6B 1SHYB 4GQ2P 3L4MD 4JD2C 3J80g 1N6EA 2XU7A 2HKMA 5EM2B 3K71A 3RSEC 1GOFA 4ZOVA 3MUNA 3W15A 2P9PC 5HE1B 2P9SC 3EWEA 3FM0A 2AGXA 3SLED 3EQ8A 4G1MA 1GG2B 2H3XA 4AX4A 5EMMB 4Y7RA 4L3GD 3DDUA 1Q47A 3FGBA 3I7PA 2VDNA 4IA9A 4BP8A 5E6SA 3NVQA 1YR2A 2IWFA 2P9IC 3ODTA 4CC9A 3ZDYA 5C2WB 3EI4B 1O6GA 2P9UC 3SBQA 3GC3B 2OJYA 3F3PA 2HESX 3DXMC 3SWSD 4PXWA 4FAND 4L3HD 4O3UB 4AN0A 2VDOA 4JHNA 3DWLC 2QXVA 1K3IA 3PXTD 4G56B 5M5UA 1VYHC 2CE9A 3QI0A 3AL8A 2Q7QA 5FFGA 4FA5D 3N0EA 1VE6A 4DNVA 3VA6A 4LG9A 3ZDZA 1MG3A 4WK4A 4BH6A 3NIFA 3IUJA 5EARA 4Z7OA 4QT8A 4BCDA 4Z7NA 2UZYB 3ORVD 3PE7A 1PEVA 4A09B 1XIPA 2EIBA 3PXSD 3VH0A 3I89A 1JMXB 1TYEA 2GNQA 3IUMA 3EI3B 2IUQA 4J8GA 3MUOA 4GM9A 4ZOZA 4D9SA 2JKXA 4MMZA 4A11A 1JV2A 4GQBB 3I7OA 2PM9B 3AH8B 5CYKB 5AFU3 5KDOB 2YBAA 2CN3A 3C5MA 4U7AA 3O4JA 4CI1A 4O3TB 3SCYA 3O4GA 1M1XA 3IJ0A 2AGYA 4A2LA 5HYNB 4OZUA 2HXCA 1K32A 4U1EI 2H6NA 2GC7A 3KRXB 3RFGA 1B9XA 3IURA 2VC2A 4E5ZB 4JSXC 3DM0A 5TDHB 3UVOA 4AN1A 4X3EA 4ZOYA 4L1QD 2QZPA 2HU7A 3IJ1A 3PSCB 4J78A 2OIZA 5K19A 4MMXA 2VDLA 4PBZA 3ZWLB 2OVPB 3JAMg 3NVNA 4G55A 4BUJC 3SVWD 2EIEA 2WQ8A 3EG6A 2XDWA 4FAVD 4A0BB 2OVQB 3AL9A 3SXTD 5TEFA 4FA1D 3OKTA 3EI1B 1I2MB 4QAMA 2IUPA 3DSMA 2EBSA 3IJCA 4J0WA 4JXMA 4NAAA 4ES0A 2W18A 3FCUA 2XE4A 5FXYA 3I7KA 5CXBA 2VDKA 2H9NA 5THAA 5IGQA 4GQ1A 2P9LC 2VZ3A 2YNNA 3T3PA 3K27A 3OL2B 4D6VA 3E0CA 2VDPA 2VDQA 3UKUC 3VI4A 4A08A 2QC5A 3OKYB 2VDMA 3CIKB 5H14A 3IUNA 2YNOA 4NC4A 2I3SA 5I5JA 4BCBA 5FKRA 4O02A 4BP9A 3I8CA 1U8CA 3IIYA 5IC7A 3UR4A 1A12A 4PNKB 4FWWA 3EQ7A 3KCIA 2B5LA 3ZE0A 1BPOA 3K72A 2VDRA 3RMZD 1OMWB 3KRWB 4H5IA 5FKSA 2B5MA 3I8EA 4JSVC 4L9OA 5HE0B 5GXIA 4A0AB 4H5JA 5I5IA 4ESGA 3VGZA 2BBKH 2OK6A 3EI2A 2I0SA 1T2XA 2H9PA 1PBYB 4D0KA 2CO0C 2GC4A 3K6SA 3J81g 3MKQA 4FHLA 5H17A 5HQGA 3FRXA 1XKSA 2P9KC 2H9LA 3RN1D 2EICA 4E54B 4FA9D 5C2VB 3RN0D 1XHMA 1JTDB 4G1EA 3ZDXA 3MKSB 5C86A 4J87A 2H14A 5HE3B 3JB9L 4DNUA 2BCJB 3F3GA 4CZVA 2BKLA 3U4YA 3N0DA 5EMKB 4CZXA 2AH0A 4JHPC 4K3JB 4A2MA 1GOTB 2P9NC 2CNXA 4GGDA 4IRZA 2J56H 1GOHA 1QFMA 1PGUA 4FA4D 3GFCA 4WK0A 3P4FA 2TRCB 1NR0A 4WK2A 3A0FA 4I79A 3C9CA 4Z8LA 4CI2A 1VZ3A 5A2Qg 3PVWB 2CO0A 2YNPA 2AH1A 4ZOXA 2PM7B 2H9MA 1C9LA 2J57G 2VZ1A 3ULEC 1VE7A 3RRMC 1B9YA 2OVRB 3UVNA 4AOWA 2HU8A 1UTCA 5CXCA 3IVMA 2IAAA 3RFHA 1OLZA 4J73A 4O1QD 3V5WB 2IURA 3SFZA 5EM2A 4J84A 3SMRA 1GP2B 4ERZA 3HFQA 4J79A 4ERQA 4CI3A 3AL8B 3PXWD 5EAPA 3F3FA 5FKTA 5FLXg 3V9FA 4AEZA 4O45A 3GD1I 3JRPA 5EAMA 1JOFA 1QNIA 2YMUA 2YB8B 2B4EA 3C99A 2I0RA 3IIWA 2J55H 3EI4A 4QL1A 5IGOA 2H6KA 4JT6C 3OKWA 4LG8A 5GMKn 4FB1D 4QRJA 3GREA 4Y5RD 4KFMB 4PC0A 3FCSA 1UOPA 4UM9A 2HU5A 4OWRA 4XYHA 5GXHA 4JSNC 2AGZA 4A11B 5C9ZB 4GM8A 2HJBA 4O9DA 2I3TA 3JPXA 4CZYA 3EQ9A 3I2NA 4QQEA 2IWKA 3BWSA 3SBRA 4J77A 4K3ID 5FQDA 2AQ5A 3I7NA 3I7HA 5IT9g 1MDAH 2Z2NA 5TEEA 1PI6A 3NIDA 4L1MA 2XL3A 3ZE1A 4A09A 5E6RA 3UKRC 2XZGA 3OW8A 3EI3A 2HKRA 1TYQC 3UVLA 4R7AB 4XEIC 4CY5A 4MMYA 3ZE2A 4X61B 4NSXA 3T3MA 1N6FA 2PM9A 5CYKA 5FA5B 4BL0A 5M5RA 1GOGA 5AJAA 3JZGA 1C9IA 4JT5C 4ZN4A 2H6QA
chains in the Genus database with same CATH topology
4E5ZA 4J81A 2Z2PA 4MK0B 1GXRA 2G9AA 1SQJA 2B5NA 3SJLD 5JWZA 2H47A 5CXBB 1A0RB 2XYIA 4IMMA 2PBIB 4GMBA 5FKQA 2G99A 5EMLB 2CE8A 4CY2A 1R5MA 4J0XA 1MG2A 2IUVA 4A08B 4A0BA 5GSAA 1SQ9A 2XL2A 1S4UX 3AFCA 3L4OD 5EMJB 3EI1A 3RLMD 3UVMA 2Z2OA 3SHFA 4ERYA 2O9KA 5HE2B 4CY1A 1P22A 3CFVA 4GGAA 5SXMA 1JMZB 4LGNA 4CI8A 3C75H 3OL2A 2H13A 3JZNA 2I0TA 2CN2A 3B7FA 3NVXA 3MZLA 3MMYA 3OKYA 1K8KC 3PVUB 3EI2B 5AMSA 4PBYA 4PSWB 4X60B 3UVKA 3K26A 5I5MA 1TBGA 1L0QA 5H1MA 1ERJA 1RI6A 5K1CC 4N14A 3V7DB 4UI9R 5B4WA 2MTAH 4JSPC 4YVDA 3OTTA 4A7JA 4A0AA 4J82A 2UZXB 3JROA 2H68A 3PSLA 4XYIA 3BG0A 2PM6B 1U2VC 3EMHA 3MXXA 2HYEA 3JZHA 3EU7A 3MZKA 3SBPA 2HJ4A 2AGLA 4J86A 4CY3A 3CFSB 1U4CA 4GGCA 4HDJA 5EALA 4E54A 1JJUB 4PSXB 3DXKC 4EWRA 3IKOA 2OK4A 5IJ7E 3BG1A 1YFQA 1FWXA 4GM3A 5IJ8E 1N6DA 4GZ8A 4J8BA 2AGWA 3I7LA 1NEXB 4TZ4A 5CXCB 4X63B 5TF2A 3SN6B 1SHYB 4GQ2P 3L4MD 4JD2C 3J80g 1N6EA 2XU7A 2HKMA 5EM2B 3RSEC 4ZOVA 3W15A 2P9PC 5HE1B 2P9SC 3EWEA 3FM0A 2AGXA 3SLED 1GG2B 2H3XA 5EMMB 4Y7RA 4L3GD 1Q47A 3FGBA 3I7PA 4IA9A 3NVQA 2IWFA 2P9IC 3ODTA 4CC9A 5C2WB 3EI4B 2P9UC 3SBQA 2OJYA 3F3PA 2HESX 3DXMC 3SWSD 4PXWA 4FAND 4L3HD 4O3UB 3DWLC 2QXVA 3PXTD 4G56B 1VYHC 2CE9A 3AL8A 2Q7QA 4FA5D 3N0EA 3VA6A 4LG9A 1MG3A 4BH6A 5EARA 4QT8A 2UZYB 3ORVD 3PE7A 1PEVA 4A09B 1XIPA 3PXSD 3VH0A 3I89A 1JMXB 2GNQA 3EI3B 2IUQA 4J8GA 4GM9A 4ZOZA 4A11A 4GQBB 3I7OA 2PM9B 3AH8B 5CYKB 5AFU3 5KDOB 2YBAA 2CN3A 3C5MA 4U7AA 4CI1A 4O3TB 3SCYA 3IJ0A 2AGYA 4A2LA 5HYNB 4OZUA 2HXCA 1K32A 4U1EI 2H6NA 2GC7A 3KRXB 3RFGA 1B9XA 4E5ZB 4JSXC 3DM0A 5TDHB 3UVOA 4X3EA 4ZOYA 4L1QD 3IJ1A 3PSCB 4J78A 2OIZA 5K19A 4PBZA 3ZWLB 2OVPB 3JAMg 3NVNA 4BUJC 3SVWD 3EG6A 4FAVD 4A0BB 2OVQB 3AL9A 3SXTD 5TEFA 4FA1D 3OKTA 3EI1B 2IUPA 3DSMA 2EBSA 3IJCA 4J0WA 4JXMA 4ES0A 2W18A 5FXYA 3I7KA 5CXBA 2H9NA 5THAA 5IGQA 4GQ1A 2P9LC 2YNNA 3K27A 3OL2B 4D6VA 3E0CA 3UKUC 4A08A 2QC5A 3OKYB 3CIKB 5H14A 2YNOA 2I3SA 5I5JA 5FKRA 3I8CA 3IIYA 5IC7A 3UR4A 4PNKB 4FWWA 2B5LA 3RMZD 1OMWB 3KRWB 4H5IA 5FKSA 2B5MA 3I8EA 4JSVC 4L9OA 5HE0B 5GXIA 4A0AB 4H5JA 5I5IA 4ESGA 3VGZA 2BBKH 2OK6A 3EI2A 2I0SA 2H9PA 1PBYB 4D0KA 2CO0C 2GC4A 3J81g 3MKQA 4FHLA 5H17A 5HQGA 3FRXA 1XKSA 2P9KC 2H9LA 3RN1D 4E54B 4FA9D 5C2VB 3RN0D 1XHMA 3MKSB 4J87A 2H14A 5HE3B 3JB9L 2BCJB 3F3GA 4CZVA 3U4YA 3N0DA 5EMKB 4CZXA 2AH0A 4K3JB 4A2MA 1GOTB 2P9NC 2CNXA 4GGDA 2J56H 1PGUA 4FA4D 3GFCA 3P4FA 2TRCB 1NR0A 3A0FA 4I79A 3C9CA 4Z8LA 4CI2A 5A2Qg 3PVWB 2CO0A 2YNPA 2AH1A 4ZOXA 2PM7B 2H9MA 2J57G 3ULEC 3UVNA 3RRMC 1B9YA 2OVRB 4AOWA 5CXCA 2IAAA 3RFHA 1OLZA 4J73A 4O1QD 3V5WB 2IURA 3SFZA 5EM2A 4J84A 3SMRA 1GP2B 4ERZA 3HFQA 4J79A 4ERQA 4CI3A 3AL8B 3PXWD 5EAPA 3F3FA 5FKTA 5FLXg 3V9FA 4AEZA 4O45A 3JRPA 5EAMA 1JOFA 1QNIA 2YMUA 2YB8B 2B4EA 3C99A 2I0RA 3IIWA 2J55H 3EI4A 4QL1A 5IGOA 2H6KA 4JT6C 3OKWA 4LG8A 5GMKn 4FB1D 4QRJA 3GREA 4Y5RD 4KFMB 4PC0A 4OWRA 4XYHA 5GXHA 4JSNC 2AGZA 4A11B 5C9ZB 4GM8A 2HJBA 4O9DA 2I3TA 3JPXA 4CZYA 3I2NA 4QQEA 2IWKA 3BWSA 3SBRA 4J77A 4K3ID 5FQDA 2AQ5A 3I7NA 3I7HA 5IT9g 1MDAH 2Z2NA 5TEEA 1PI6A 2XL3A 4A09A 3UKRC 3OW8A 3EI3A 2HKRA 1TYQC 3UVLA 4R7AB 4XEIC 4CY5A 4X61B 4NSXA 1N6FA 2PM9A 5CYKA 5FA5B 4BL0A 5AJAA 3JZGA 4JT5C 4ZN4A 2H6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E5Z A;  4J81 A;  2Z2P A;  4MK0 B;  1GXR A;  2G9A A;  1SQJ A;  2B5N A;  3SJL D;  5JWZ A;  2H47 A;  5CXB B;  1A0R B;  2XYI A;  4IMM A;  2PBI B;  4GMB A;  5FKQ A;  2G99 A;  5EML B;  2CE8 A;  4CY2 A;  1R5M A;  4J0X A;  1MG2 A;  2IUV A;  4A08 B;  4A0B A;  5GSA A;  1SQ9 A;  2XL2 A;  1S4U X;  3AFC A;  3L4O D;  5EMJ B;  3EI1 A;  3RLM D;  3UVM A;  2Z2O A;  3SHF A;  4ERY A;  2O9K A;  5HE2 B;  4CY1 A;  1P22 A;  3CFV A;  4GGA A;  5SXM A;  1JMZ B;  4LGN A;  4CI8 A;  3C75 H;  3OL2 A;  2H13 A;  3JZN A;  2I0T A;  2CN2 A;  3B7F A;  3NVX A;  3MZL A;  3MMY A;  3OKY A;  1K8K C;  3PVU B;  3EI2 B;  5AMS A;  4PBY A;  4PSW B;  4X60 B;  3UVK A;  3K26 A;  5I5M A;  1TBG A;  1L0Q A;  5H1M A;  1ERJ A;  1RI6 A;  5K1C C;  4N14 A;  3V7D B;  4UI9 R;  5B4W A;  2MTA H;  4JSP C;  4YVD A;  3OTT A;  4A7J A;  4A0A A;  4J82 A;  2UZX B;  3JRO A;  2H68 A;  3PSL A;  4XYI A;  3BG0 A;  2PM6 B;  1U2V C;  3EMH A;  3MXX A;  2HYE A;  3JZH A;  3EU7 A;  3MZK A;  3SBP A;  2HJ4 A;  2AGL A;  4J86 A;  4CY3 A;  3CFS B;  1U4C A;  4GGC A;  4HDJ A;  5EAL A;  4E54 A;  1JJU B;  4PSX B;  3DXK C;  4EWR A;  3IKO A;  2OK4 A;  5IJ7 E;  3BG1 A;  1YFQ A;  1FWX A;  4GM3 A;  5IJ8 E;  1N6D A;  4GZ8 A;  4J8B A;  2AGW A;  3I7L A;  1NEX B;  4TZ4 A;  5CXC B;  4X63 B;  5TF2 A;  3SN6 B;  1SHY B;  4GQ2 P;  3L4M D;  4JD2 C;  3J80 g;  1N6E A;  2XU7 A;  2HKM A;  5EM2 B;  3RSE C;  4ZOV A;  3W15 A;  2P9P C;  5HE1 B;  2P9S C;  3EWE A;  3FM0 A;  2AGX A;  3SLE D;  1GG2 B;  2H3X A;  5EMM B;  4Y7R A;  4L3G D;  1Q47 A;  3FGB A;  3I7P A;  4IA9 A;  3NVQ A;  2IWF A;  2P9I C;  3ODT A;  4CC9 A;  5C2W B;  3EI4 B;  2P9U C;  3SBQ A;  2OJY A;  3F3P A;  2HES X;  3DXM C;  3SWS D;  4PXW A;  4FAN D;  4L3H D;  4O3U B;  3DWL C;  2QXV A;  3PXT D;  4G56 B;  1VYH C;  2CE9 A;  3AL8 A;  2Q7Q A;  4FA5 D;  3N0E A;  3VA6 A;  4LG9 A;  1MG3 A;  4BH6 A;  5EAR A;  4QT8 A;  2UZY B;  3ORV D;  3PE7 A;  1PEV A;  4A09 B;  1XIP A;  3PXS D;  3VH0 A;  3I89 A;  1JMX B;  2GNQ A;  3EI3 B;  2IUQ A;  4J8G A;  4GM9 A;  4ZOZ A;  4A11 A;  4GQB B;  3I7O A;  2PM9 B;  3AH8 B;  5CYK B;  5AFU 3;  5KDO B;  2YBA A;  2CN3 A;  3C5M A;  4U7A A;  4CI1 A;  4O3T B;  3SCY A;  3IJ0 A;  2AGY A;  4A2L A;  5HYN B;  4OZU A;  2HXC A;  1K32 A;  4U1E I;  2H6N A;  2GC7 A;  3KRX B;  3RFG A;  1B9X A;  4E5Z B;  4JSX C;  3DM0 A;  5TDH B;  3UVO A;  4X3E A;  4ZOY A;  4L1Q D;  3IJ1 A;  3PSC B;  4J78 A;  2OIZ A;  5K19 A;  4PBZ A;  3ZWL B;  2OVP B;  3JAM g;  3NVN A;  4BUJ C;  3SVW D;  3EG6 A;  4FAV D;  4A0B B;  2OVQ B;  3AL9 A;  3SXT D;  5TEF A;  4FA1 D;  3OKT A;  3EI1 B;  2IUP A;  3DSM A;  2EBS A;  3IJC A;  4J0W A;  4JXM A;  4ES0 A;  2W18 A;  5FXY A;  3I7K A;  5CXB A;  2H9N A;  5THA A;  5IGQ A;  4GQ1 A;  2P9L C;  2YNN A;  3K27 A;  3OL2 B;  4D6V A;  3E0C A;  3UKU C;  4A08 A;  2QC5 A;  3OKY B;  3CIK B;  5H14 A;  2YNO A;  2I3S A;  5I5J A;  5FKR A;  3I8C A;  3IIY A;  5IC7 A;  3UR4 A;  4PNK B;  4FWW A;  2B5L A;  3RMZ D;  1OMW B;  3KRW B;  4H5I A;  5FKS A;  2B5M A;  3I8E A;  4JSV C;  4L9O A;  5HE0 B;  5GXI A;  4A0A B;  4H5J A;  5I5I A;  4ESG A;  3VGZ A;  2BBK H;  2OK6 A;  3EI2 A;  2I0S A;  2H9P A;  1PBY B;  4D0K A;  2CO0 C;  2GC4 A;  3J81 g;  3MKQ A;  4FHL A;  5H17 A;  5HQG A;  3FRX A;  1XKS A;  2P9K C;  2H9L A;  3RN1 D;  4E54 B;  4FA9 D;  5C2V B;  3RN0 D;  1XHM A;  3MKS B;  4J87 A;  2H14 A;  5HE3 B;  3JB9 L;  2BCJ B;  3F3G A;  4CZV A;  3U4Y A;  3N0D A;  5EMK B;  4CZX A;  2AH0 A;  4K3J B;  4A2M A;  1GOT B;  2P9N C;  2CNX A;  4GGD A;  2J56 H;  1PGU A;  4FA4 D;  3GFC A;  3P4F A;  2TRC B;  1NR0 A;  3A0F A;  4I79 A;  3C9C A;  4Z8L A;  4CI2 A;  5A2Q g;  3PVW B;  2CO0 A;  2YNP A;  2AH1 A;  4ZOX A;  2PM7 B;  2H9M A;  2J57 G;  3ULE C;  3UVN A;  3RRM C;  1B9Y A;  2OVR B;  4AOW A;  5CXC A;  2IAA A;  3RFH A;  1OLZ A;  4J73 A;  4O1Q D;  3V5W B;  2IUR A;  3SFZ A;  5EM2 A;  4J84 A;  3SMR A;  1GP2 B;  4ERZ A;  3HFQ A;  4J79 A;  4ERQ A;  4CI3 A;  3AL8 B;  3PXW D;  5EAP A;  3F3F A;  5FKT A;  5FLX g;  3V9F A;  4AEZ A;  4O45 A;  3JRP A;  5EAM A;  1JOF A;  1QNI A;  2YMU A;  2YB8 B;  2B4E A;  3C99 A;  2I0R A;  3IIW A;  2J55 H;  3EI4 A;  4QL1 A;  5IGO A;  2H6K A;  4JT6 C;  3OKW A;  4LG8 A;  5GMK n;  4FB1 D;  4QRJ A;  3GRE A;  4Y5R D;  4KFM B;  4PC0 A;  4OWR A;  4XYH A;  5GXH A;  4JSN C;  2AGZ A;  4A11 B;  5C9Z B;  4GM8 A;  2HJB A;  4O9D A;  2I3T A;  3JPX A;  4CZY A;  3I2N A;  4QQE A;  2IWK A;  3BWS A;  3SBR A;  4J77 A;  4K3I D;  5FQD A;  2AQ5 A;  3I7N A;  3I7H A;  5IT9 g;  1MDA H;  2Z2N A;  5TEE A;  1PI6 A;  2XL3 A;  4A09 A;  3UKR C;  3OW8 A;  3EI3 A;  2HKR A;  1TYQ C;  3UVL A;  4R7A B;  4XEI C;  4CY5 A;  4X61 B;  4NSX A;  1N6F A;  2PM9 A;  5CYK A;  5FA5 B;  4BL0 A;  5AJA A;  3JZG A;  4JT5 C;  4ZN4 A;  2H6Q A; 
#chains in the Genus database with same CATH topology
 4WJK A;  4E5Z A;  4J81 A;  3V4V A;  2Z2P A;  5E6U A;  4MK0 B;  1GXR A;  2G9A A;  1SQJ A;  2B5N A;  3SJL D;  5JWZ A;  1E5T A;  2H47 A;  5CXB B;  4NBM A;  1A0R B;  5M61 A;  2XYI A;  1VZ2 A;  2EID A;  4IMM A;  4UM8 A;  2PBI B;  1H2Y A;  4GMB A;  5FKQ A;  2G99 A;  5EML B;  2CE8 A;  4CY2 A;  1R5M A;  4J0X A;  1MG2 A;  5M5S A;  3O4I A;  4RE6 A;  2IUV A;  4NEN A;  4AMY A;  4DNW A;  4A08 B;  4A0B A;  3OF7 A;  5GSA A;  1SQ9 A;  2XL2 A;  1S4U X;  3AFC A;  3L4O D;  5EMJ B;  3EI1 A;  3RLM D;  3UVM A;  1UOQ A;  2Z2O A;  3SHF A;  1E8N A;  4ERY A;  2O9K A;  5HE2 B;  1O6F A;  4CY1 A;  3IJE A;  5HDB A;  1P22 A;  3CFV A;  4GGA A;  5SXM A;  1JMZ B;  4LGN A;  4CI8 A;  3C75 H;  5M5V A;  3OL2 A;  3IUQ A;  2H13 A;  3JZN A;  2I0T A;  2CN2 A;  3B7F A;  3NIG A;  3NVX A;  3MZL A;  3MMY A;  1L5G A;  3OKY A;  1K8K C;  5FFO A;  3PVU B;  5M5T A;  3EI2 B;  1H2W A;  5AMS A;  4PBY A;  4PSW B;  4X60 B;  3UVK A;  3K26 A;  5I5M A;  1TBG A;  1L0Q A;  5H1M A;  4RE5 A;  3QHY B;  4BCC A;  1ERJ A;  1RI6 A;  5K1C C;  4N14 A;  3V7D B;  4UI9 R;  5B4W A;  3IUL A;  2MTA H;  4JSP C;  4YVD A;  3OTT A;  4A7J A;  5C92 A;  1E8M A;  4A0A A;  4J82 A;  2UZX B;  3JRO A;  2QR5 A;  2H68 A;  3PSL A;  4XYI A;  1QFS A;  3BG0 A;  2PM6 B;  1U2V C;  3EMH A;  3MXX A;  2HYE A;  3JZH A;  3EU7 A;  3MZK A;  3SBP A;  4AMZ A;  2HJ4 A;  2AGL A;  4J86 A;  4CY3 A;  3CFS B;  1UOO A;  4O2W A;  1U4C A;  4GGC A;  4HDJ A;  5EAL A;  4E54 A;  1JJU B;  4PSX B;  3DXK C;  4EWR A;  3IKO A;  2OK4 A;  3VI3 A;  5IJ7 E;  3O4H A;  3V4P A;  3BG1 A;  1H2Z A;  1YFQ A;  1H2X A;  1FWX A;  4GM3 A;  5IJ8 E;  1N6D A;  4GZ8 A;  4J8B A;  4Z7Q A;  2AGW A;  3I7L A;  1NEX B;  4TZ4 A;  5CXC B;  3MVD K;  4X63 B;  5TF2 A;  3SN6 B;  1SHY B;  4GQ2 P;  3L4M D;  4JD2 C;  3J80 g;  1N6E A;  2XU7 A;  2HKM A;  5EM2 B;  3K71 A;  3RSE C;  1GOF A;  4ZOV A;  3MUN A;  3W15 A;  2P9P C;  5HE1 B;  2P9S C;  3EWE A;  3FM0 A;  2AGX A;  3SLE D;  3EQ8 A;  4G1M A;  1GG2 B;  2H3X A;  4AX4 A;  5EMM B;  4Y7R A;  4L3G D;  3DDU A;  1Q47 A;  3FGB A;  3I7P A;  2VDN A;  4IA9 A;  4BP8 A;  5E6S A;  3NVQ A;  1YR2 A;  2IWF A;  2P9I C;  3ODT A;  4CC9 A;  3ZDY A;  5C2W B;  3EI4 B;  1O6G A;  2P9U C;  3SBQ A;  3GC3 B;  2OJY A;  3F3P A;  2HES X;  3DXM C;  3SWS D;  4PXW A;  4FAN D;  4L3H D;  4O3U B;  4AN0 A;  2VDO A;  4JHN A;  3DWL C;  2QXV A;  1K3I A;  3PXT D;  4G56 B;  5M5U A;  1VYH C;  2CE9 A;  3QI0 A;  3AL8 A;  2Q7Q A;  5FFG A;  4FA5 D;  3N0E A;  1VE6 A;  4DNV A;  3VA6 A;  4LG9 A;  3ZDZ A;  1MG3 A;  4WK4 A;  4BH6 A;  3NIF A;  3IUJ A;  5EAR A;  4Z7O A;  4QT8 A;  4BCD A;  4Z7N A;  2UZY B;  3ORV D;  3PE7 A;  1PEV A;  4A09 B;  1XIP A;  2EIB A;  3PXS D;  3VH0 A;  3I89 A;  1JMX B;  1TYE A;  2GNQ A;  3IUM A;  3EI3 B;  2IUQ A;  4J8G A;  3MUO A;  4GM9 A;  4ZOZ A;  4D9S A;  2JKX A;  4MMZ A;  4A11 A;  1JV2 A;  4GQB B;  3I7O A;  2PM9 B;  3AH8 B;  5CYK B;  5AFU 3;  5KDO B;  2YBA A;  2CN3 A;  3C5M A;  4U7A A;  3O4J A;  4CI1 A;  4O3T B;  3SCY A;  3O4G A;  1M1X A;  3IJ0 A;  2AGY A;  4A2L A;  5HYN B;  4OZU A;  2HXC A;  1K32 A;  4U1E I;  2H6N A;  2GC7 A;  3KRX B;  3RFG A;  1B9X A;  3IUR A;  2VC2 A;  4E5Z B;  4JSX C;  3DM0 A;  5TDH B;  3UVO A;  4AN1 A;  4X3E A;  4ZOY A;  4L1Q D;  2QZP A;  2HU7 A;  3IJ1 A;  3PSC B;  4J78 A;  2OIZ A;  5K19 A;  4MMX A;  2VDL A;  4PBZ A;  3ZWL B;  2OVP B;  3JAM g;  3NVN A;  4G55 A;  4BUJ C;  3SVW D;  2EIE A;  2WQ8 A;  3EG6 A;  2XDW A;  4FAV D;  4A0B B;  2OVQ B;  3AL9 A;  3SXT D;  5TEF A;  4FA1 D;  3OKT A;  3EI1 B;  1I2M B;  4QAM A;  2IUP A;  3DSM A;  2EBS A;  3IJC A;  4J0W A;  4JXM A;  4NAA A;  4ES0 A;  2W18 A;  3FCU A;  2XE4 A;  5FXY A;  3I7K A;  5CXB A;  2VDK A;  2H9N A;  5THA A;  5IGQ A;  4GQ1 A;  2P9L C;  2VZ3 A;  2YNN A;  3T3P A;  3K27 A;  3OL2 B;  4D6V A;  3E0C A;  2VDP A;  2VDQ A;  3UKU C;  3VI4 A;  4A08 A;  2QC5 A;  3OKY B;  2VDM A;  3CIK B;  5H14 A;  3IUN A;  2YNO A;  4NC4 A;  2I3S A;  5I5J A;  4BCB A;  5FKR A;  4O02 A;  4BP9 A;  3I8C A;  1U8C A;  3IIY A;  5IC7 A;  3UR4 A;  1A12 A;  4PNK B;  4FWW A;  3EQ7 A;  3KCI A;  2B5L A;  3ZE0 A;  1BPO A;  3K72 A;  2VDR A;  3RMZ D;  1OMW B;  3KRW B;  4H5I A;  5FKS A;  2B5M A;  3I8E A;  4JSV C;  4L9O A;  5HE0 B;  5GXI A;  4A0A B;  4H5J A;  5I5I A;  4ESG A;  3VGZ A;  2BBK H;  2OK6 A;  3EI2 A;  2I0S A;  1T2X A;  2H9P A;  1PBY B;  4D0K A;  2CO0 C;  2GC4 A;  3K6S A;  3J81 g;  3MKQ A;  4FHL A;  5H17 A;  5HQG A;  3FRX A;  1XKS A;  2P9K C;  2H9L A;  3RN1 D;  2EIC A;  4E54 B;  4FA9 D;  5C2V B;  3RN0 D;  1XHM A;  1JTD B;  4G1E A;  3ZDX A;  3MKS B;  5C86 A;  4J87 A;  2H14 A;  5HE3 B;  3JB9 L;  4DNU A;  2BCJ B;  3F3G A;  4CZV A;  2BKL A;  3U4Y A;  3N0D A;  5EMK B;  4CZX A;  2AH0 A;  4JHP C;  4K3J B;  4A2M A;  1GOT B;  2P9N C;  2CNX A;  4GGD A;  4IRZ A;  2J56 H;  1GOH A;  1QFM A;  1PGU A;  4FA4 D;  3GFC A;  4WK0 A;  3P4F A;  2TRC B;  1NR0 A;  4WK2 A;  3A0F A;  4I79 A;  3C9C A;  4Z8L A;  4CI2 A;  1VZ3 A;  5A2Q g;  3PVW B;  2CO0 A;  2YNP A;  2AH1 A;  4ZOX A;  2PM7 B;  2H9M A;  1C9L A;  2J57 G;  2VZ1 A;  3ULE C;  1VE7 A;  3RRM C;  1B9Y A;  2OVR B;  3UVN A;  4AOW A;  2HU8 A;  1UTC A;  5CXC A;  3IVM A;  2IAA A;  3RFH A;  1OLZ A;  4J73 A;  4O1Q D;  3V5W B;  2IUR A;  3SFZ A;  5EM2 A;  4J84 A;  3SMR A;  1GP2 B;  4ERZ A;  3HFQ A;  4J79 A;  4ERQ A;  4CI3 A;  3AL8 B;  3PXW D;  5EAP A;  3F3F A;  5FKT A;  5FLX g;  3V9F A;  4AEZ A;  4O45 A;  3GD1 I;  3JRP A;  5EAM A;  1JOF A;  1QNI A;  2YMU A;  2YB8 B;  2B4E A;  3C99 A;  2I0R A;  3IIW A;  2J55 H;  3EI4 A;  4QL1 A;  5IGO A;  2H6K A;  4JT6 C;  3OKW A;  4LG8 A;  5GMK n;  4FB1 D;  4QRJ A;  3GRE A;  4Y5R D;  4KFM B;  4PC0 A;  3FCS A;  1UOP A;  4UM9 A;  2HU5 A;  4OWR A;  4XYH A;  5GXH A;  4JSN C;  2AGZ A;  4A11 B;  5C9Z B;  4GM8 A;  2HJB A;  4O9D A;  2I3T A;  3JPX A;  4CZY A;  3EQ9 A;  3I2N A;  4QQE A;  2IWK A;  3BWS A;  3SBR A;  4J77 A;  4K3I D;  5FQD A;  2AQ5 A;  3I7N A;  3I7H A;  5IT9 g;  1MDA H;  2Z2N A;  5TEE A;  1PI6 A;  3NID A;  4L1M A;  2XL3 A;  3ZE1 A;  4A09 A;  5E6R A;  3UKR C;  2XZG A;  3OW8 A;  3EI3 A;  2HKR A;  1TYQ C;  3UVL A;  4R7A B;  4XEI C;  4CY5 A;  4MMY A;  3ZE2 A;  4X61 B;  4NSX A;  3T3M A;  1N6F A;  2PM9 A;  5CYK A;  5FA5 B;  4BL0 A;  5M5R A;  1GOG A;  5AJA A;  3JZG A;  1C9I A;  4JT5 C;  4ZN4 A;  2H6Q A; 
#chains in the Genus database with same CATH homology
 4E5Z A;  4J81 A;  2Z2P A;  4MK0 B;  1GXR A;  2G9A A;  1SQJ A;  2B5N A;  3SJL D;  5JWZ A;  2H47 A;  5CXB B;  1A0R B;  2XYI A;  4IMM A;  2PBI B;  4GMB A;  5FKQ A;  2G99 A;  5EML B;  2CE8 A;  4CY2 A;  1R5M A;  4J0X A;  1MG2 A;  2IUV A;  4A08 B;  4A0B A;  5GSA A;  1SQ9 A;  2XL2 A;  1S4U X;  3AFC A;  3L4O D;  5EMJ B;  3EI1 A;  3RLM D;  3UVM A;  2Z2O A;  3SHF A;  4ERY A;  2O9K A;  5HE2 B;  4CY1 A;  1P22 A;  3CFV A;  4GGA A;  5SXM A;  1JMZ B;  4LGN A;  4CI8 A;  3C75 H;  3OL2 A;  2H13 A;  3JZN A;  2I0T A;  2CN2 A;  3B7F A;  3NVX A;  3MZL A;  3MMY A;  3OKY A;  1K8K C;  3PVU B;  3EI2 B;  5AMS A;  4PBY A;  4PSW B;  4X60 B;  3UVK A;  3K26 A;  5I5M A;  1TBG A;  1L0Q A;  5H1M A;  1ERJ A;  1RI6 A;  5K1C C;  4N14 A;  3V7D B;  4UI9 R;  5B4W A;  2MTA H;  4JSP C;  4YVD A;  3OTT A;  4A7J A;  4A0A A;  4J82 A;  2UZX B;  3JRO A;  2H68 A;  3PSL A;  4XYI A;  3BG0 A;  2PM6 B;  1U2V C;  3EMH A;  3MXX A;  2HYE A;  3JZH A;  3EU7 A;  3MZK A;  3SBP A;  2HJ4 A;  2AGL A;  4J86 A;  4CY3 A;  3CFS B;  1U4C A;  4GGC A;  4HDJ A;  5EAL A;  4E54 A;  1JJU B;  4PSX B;  3DXK C;  4EWR A;  3IKO A;  2OK4 A;  5IJ7 E;  3BG1 A;  1YFQ A;  1FWX A;  4GM3 A;  5IJ8 E;  1N6D A;  4GZ8 A;  4J8B A;  2AGW A;  3I7L A;  1NEX B;  4TZ4 A;  5CXC B;  4X63 B;  5TF2 A;  3SN6 B;  1SHY B;  4GQ2 P;  3L4M D;  4JD2 C;  3J80 g;  1N6E A;  2XU7 A;  2HKM A;  5EM2 B;  3RSE C;  4ZOV A;  3W15 A;  2P9P C;  5HE1 B;  2P9S C;  3EWE A;  3FM0 A;  2AGX A;  3SLE D;  1GG2 B;  2H3X A;  5EMM B;  4Y7R A;  4L3G D;  1Q47 A;  3FGB A;  3I7P A;  4IA9 A;  3NVQ A;  2IWF A;  2P9I C;  3ODT A;  4CC9 A;  5C2W B;  3EI4 B;  2P9U C;  3SBQ A;  2OJY A;  3F3P A;  2HES X;  3DXM C;  3SWS D;  4PXW A;  4FAN D;  4L3H D;  4O3U B;  3DWL C;  2QXV A;  3PXT D;  4G56 B;  1VYH C;  2CE9 A;  3AL8 A;  2Q7Q A;  4FA5 D;  3N0E A;  3VA6 A;  4LG9 A;  1MG3 A;  4BH6 A;  5EAR A;  4QT8 A;  2UZY B;  3ORV D;  3PE7 A;  1PEV A;  4A09 B;  1XIP A;  3PXS D;  3VH0 A;  3I89 A;  1JMX B;  2GNQ A;  3EI3 B;  2IUQ A;  4J8G A;  4GM9 A;  4ZOZ A;  4A11 A;  4GQB B;  3I7O A;  2PM9 B;  3AH8 B;  5CYK B;  5AFU 3;  5KDO B;  2YBA A;  2CN3 A;  3C5M A;  4U7A A;  4CI1 A;  4O3T B;  3SCY A;  3IJ0 A;  2AGY A;  4A2L A;  5HYN B;  4OZU A;  2HXC A;  1K32 A;  4U1E I;  2H6N A;  2GC7 A;  3KRX B;  3RFG A;  1B9X A;  4E5Z B;  4JSX C;  3DM0 A;  5TDH B;  3UVO A;  4X3E A;  4ZOY A;  4L1Q D;  3IJ1 A;  3PSC B;  4J78 A;  2OIZ A;  5K19 A;  4PBZ A;  3ZWL B;  2OVP B;  3JAM g;  3NVN A;  4BUJ C;  3SVW D;  3EG6 A;  4FAV D;  4A0B B;  2OVQ B;  3AL9 A;  3SXT D;  5TEF A;  4FA1 D;  3OKT A;  3EI1 B;  2IUP A;  3DSM A;  2EBS A;  3IJC A;  4J0W A;  4JXM A;  4ES0 A;  2W18 A;  5FXY A;  3I7K A;  5CXB A;  2H9N A;  5THA A;  5IGQ A;  4GQ1 A;  2P9L C;  2YNN A;  3K27 A;  3OL2 B;  4D6V A;  3E0C A;  3UKU C;  4A08 A;  2QC5 A;  3OKY B;  3CIK B;  5H14 A;  2YNO A;  2I3S A;  5I5J A;  5FKR A;  3I8C A;  3IIY A;  5IC7 A;  3UR4 A;  4PNK B;  4FWW A;  2B5L A;  3RMZ D;  1OMW B;  3KRW B;  4H5I A;  5FKS A;  2B5M A;  3I8E A;  4JSV C;  4L9O A;  5HE0 B;  5GXI A;  4A0A B;  4H5J A;  5I5I A;  4ESG A;  3VGZ A;  2BBK H;  2OK6 A;  3EI2 A;  2I0S A;  2H9P A;  1PBY B;  4D0K A;  2CO0 C;  2GC4 A;  3J81 g;  3MKQ A;  4FHL A;  5H17 A;  5HQG A;  3FRX A;  1XKS A;  2P9K C;  2H9L A;  3RN1 D;  4E54 B;  4FA9 D;  5C2V B;  3RN0 D;  1XHM A;  3MKS B;  4J87 A;  2H14 A;  5HE3 B;  3JB9 L;  2BCJ B;  3F3G A;  4CZV A;  3U4Y A;  3N0D A;  5EMK B;  4CZX A;  2AH0 A;  4K3J B;  4A2M A;  1GOT B;  2P9N C;  2CNX A;  4GGD A;  2J56 H;  1PGU A;  4FA4 D;  3GFC A;  3P4F A;  2TRC B;  1NR0 A;  3A0F A;  4I79 A;  3C9C A;  4Z8L A;  4CI2 A;  5A2Q g;  3PVW B;  2CO0 A;  2YNP A;  2AH1 A;  4ZOX A;  2PM7 B;  2H9M A;  2J57 G;  3ULE C;  3UVN A;  3RRM C;  1B9Y A;  2OVR B;  4AOW A;  5CXC A;  2IAA A;  3RFH A;  1OLZ A;  4J73 A;  4O1Q D;  3V5W B;  2IUR A;  3SFZ A;  5EM2 A;  4J84 A;  3SMR A;  1GP2 B;  4ERZ A;  3HFQ A;  4J79 A;  4ERQ A;  4CI3 A;  3AL8 B;  3PXW D;  5EAP A;  3F3F A;  5FKT A;  5FLX g;  3V9F A;  4AEZ A;  4O45 A;  3JRP A;  5EAM A;  1JOF A;  1QNI A;  2YMU A;  2YB8 B;  2B4E A;  3C99 A;  2I0R A;  3IIW A;  2J55 H;  3EI4 A;  4QL1 A;  5IGO A;  2H6K A;  4JT6 C;  3OKW A;  4LG8 A;  5GMK n;  4FB1 D;  4QRJ A;  3GRE A;  4Y5R D;  4KFM B;  4PC0 A;  4OWR A;  4XYH A;  5GXH A;  4JSN C;  2AGZ A;  4A11 B;  5C9Z B;  4GM8 A;  2HJB A;  4O9D A;  2I3T A;  3JPX A;  4CZY A;  3I2N A;  4QQE A;  2IWK A;  3BWS A;  3SBR A;  4J77 A;  4K3I D;  5FQD A;  2AQ5 A;  3I7N A;  3I7H A;  5IT9 g;  1MDA H;  2Z2N A;  5TEE A;  1PI6 A;  2XL3 A;  4A09 A;  3UKR C;  3OW8 A;  3EI3 A;  2HKR A;  1TYQ C;  3UVL A;  4R7A B;  4XEI C;  4CY5 A;  4X61 B;  4NSX A;  1N6F A;  2PM9 A;  5CYK A;  5FA5 B;  4BL0 A;  5AJA A;  3JZG A;  4JT5 C;  4ZN4 A;  2H6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...