4K3JB

Crystal structure of onartuzumab fab in complex with met and hgf-beta
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
526
structure length
499
Chain Sequence
MKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/immune system/growth factor
molecule keywords Hepatocyte growth factor
publication title Monovalent antibody design and mechanism of action of onartuzumab, a MET antagonist with anti-tumor activity as a therapeutic agent.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 499
sequence length 526
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4k3jB01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4k3jB02
2PM9A 2IURA 2AGWA 5AMSA 3IJ0A 3OKYB 2PM9B 1PBYB 3UVOA 4CI2A 1OLZA 4PSXB 2H13A 3I7KA 3P4FA 4X60B 5IT9g 5K1CC 2HYEA 2HJBA 2AGXA 4J81A 1S4UX 3SWSD 3JRPA 1K8KC 5AFU3 1U8CB 5IJ7E 3AL8A 4QRJA 5FKSA 3ODTA 4FA1D 3SLED 5K19A 2CNXA 2XYIA 3AL8B 3PVWB 5CXBA 2H9MA 1SSLA 5I5IA 3RN0D 4G56B 4K3JB 2Z2PA 4XYHA 5CXBB 4CI1A 2OJYA 3IJCA 5AJAA 2YB8B 1JMXB 3EG6A 3GREA 4K3ID 5GSAA 4FA5D 5A2Qg 3ZDYB 3EWEA 4ZOVA 3CIKB 4J77A 2H6NA 3RFGA 5I5MA 4U1EI 5EAPA 4BH6A 4E5ZB 2CE9A 5TEFA 3RMZD 4UM9D 4TZ4A 4R7AB 4ERZA 5SXMA 2QXVA 1JMZB 2BCJB 3V5WB 2CN2A 5C2WB 1PI6A 1P22A 3F3PA 4WK0B 3B7FA 1TBGA 2P9LC 4O45A 3PXSD 2YNPA 4BUJC 4FHLA 2VDNB 2CN3A 4D0KA 3FGBA 2IUPA 4Z7NB 3EI4B 4HDJA 1RI6A 1U4CA 3SCYA 4Z8LA 2VDRB 2P9IC 4GGAA 3UKUC 3W15A 3DXKC 3ZDXB 1R5MA 2HKRA 4ZN4A 3HFQA 4MK0B 2CO0C 3J81g 4Z7QB 4CY1A 4JT5C 3I7PA 4I79A 4CI3A 3JPXA 5FKQA 1MG2A 5B4WA 3MZLA 2PBIB 4D6VA 4KFMB 2IWFA 4GQBB 5EMLB 3NIFB 4Y7RA 4JT6C 3C75H 2EBSA 4ERQA 4L9OA 5FA5B 3E0CA 4QQEA 4AEZA 2VDMB 2AQ5A 4J86A 3OKWA 3DWLC 3OKYA 3L4OD 3PSLA 3UVMA 4J82A 4JSXC 3EU7A 3T3MB 2H9LA 4PC0A 2GC4A 1TYQC 3NVXA 2P28A 2VDLB 3I7NA 2YMUA 3ZE1B 3IIYA 4ZOYA 3IJ1A 3UVNA 2P9KC 2TRCB 2IAAA 4ZOZA 3AH8B 4U7AA 2H6QA 2HXCA 4XYIA 5TEEA 4J8GA 2Z2OA 3MZKA 2B5MA 3C5MA 2B5NA 5EAMA 2B5LA 4GMBA 3SXTD 3I89A 4QL1A 2CO0A 2VDQB 4LG9A 3OTTA 5EALA 1YUKA 3PXWD 4JSPC 2PM6B 3PVUB 2XL3A 2OK4A 2AGYA 3OL2B 4XEIC 4A11A 3DXMC 2MTAH 4JXMA 1A0RB 3NVQA 3CFVA 5E6RB 4GM3A 4LG8A 4H5IA 4A11B 2H47A 2YBAA 3SBQA 1B9XA 2W18A 1NEXB 1VYHC 4J84A 3UR4A 4E5ZA 3K27A 5JWZA 3VH0A 2VDOB 3PXTD 3ZDZB 1TYEB 3SBRA 3JZNA 4WK4B 1MDAH 2I0RA 5HE3B 5HE2B 5FLXg 3F3FA 5EMJB 4UM9B 2P9NC 5THAA 3IIWA 2GNQA 2PM7B 2VC2B 4Z7OB 4PSWB 4X61B 2GC7A 5TDHB 3EI3A 5C2VB 5I5JA 2OVPB 4A08A 2H3XA 3EI4A 3MKSB 4N14A 1PEVA 2P9SC 3EI3B 3EMHA 3SMRA 1XIPA 4A08B 3AL9A 4A7JA 3K26A 4JD2C 4A0AB 5HYNB 5GMKn 4A2MA 2QC5A 4CI8A 2YNOA 3DM0A 4X3EA 4CZYA 5IC7A 4GQ2P 3N0DA 3I7LA 3VGZA 2UZXB 3ULEC 3C99A 3SVWD 5H17A 1GXRA 5H14A 3MMYA 4Y5RD 3UVKA 3VI4B 3I7OA 2IUQA 3KRXB 3I2NA 1MG3A 3OKTA 4CY5A 3VI3B 1NR0A 2BBKH 1XKSA 3SHFA 5HE1B 2AGLA 5FKRA 2CE8A 4ZOXA 3FCUB 3BG1A 3ZE2B 1JJUB 2UZYB 3ZE0B 3JAMg 3RN1D 3AFCA 4A09A 3BG0A 4IA9A 3JZHA 4FWWA 5H1MA 4A09B 2I3TA 4BL0A 4LGNA 5EARA 4IMMA 1SHYB 2HKMA 2H9PA 3PSCB 4PBYA 4QT8A 4ERYA 4A2LA 4FB1D 4J73A 2H9NA 5TF2A 3MKQA 3EI2A 4ESGA 1FWXA 4E54B 3V9FA 5GXIA 5CYKA 3EI2B 2B4EA 3I8CA 5CYKB 4CY3A 5FQDA 4OZUA 5E6SB 3ZWLB 4J8BA 1GG2B 2VDKB 5HQGA 1PGUA 1XHMA 3U4YA 4FA9D 4OWRA 1GOTB 2G99A 3JB9L 5FXYA 1N6DA 2H6KA 3OL2A 5EM2A 3VA6A 4FA4D 4UI9R 4CZXA 1GP2B 2H14A 5IGOA 5EM2B 4GM8A 2J57G 3IKOA 4O3UB 2XL2A 3C9CA 5CXCA 2J56H 2AH1A 3SBPA 4WJKB 5CXCB 4CY2A 2OIZA 2OK6A 3SN6B 5EMMB 4J0WA 3SJLD 1ERJA 2P9PC 4J0XA 4GZ8A 4A0BA 3I7HA 2YNNA 3JZGA 4A0BB 1YFQA 4PNKB 2O9KA 3V7DB 4WK2B 2OVRB 4J79A 1K32A 3NVNA 2HESX 4O1QD 2Q7QA 2G9AA 4CC9A 2I0TA 3N0EA 4GGCA 4A0AA 5GXHA 1N6FA 3UVLA 1SQ9A 4L3GD 3RRMC 3NIGB 4YVDA 4J78A 2I3SA 2J55H 2OVQB 3L4MD 5EMKB 1QNIA 3DSMA 2H68A 3GFCA 1OMWB 2XU7A 4PBZA 4X63B 3KRWB 5IGQA 3BWSA 2AGZA 3RSEC 3JROA 4FAND 4H5JA 4UM8B 5E6UB 2P26A 3FM0A 4PXWA 3ORVD 4GGDA 5FKTA 4CZVA 4NSXA 1N6EA 2I0SA 2VDPB 3J80g 2AH0A 3EI1A 3RLMD 4O9DA 4JSNC 4J87A 4JSVC 3EI1B 3T3PB 3OW8A 4L3HD 5IJ8E 2Z2NA 3RFHA 3PE7A 3FRXA 1Q47A 4GQ1A 5HDBB 1L0QA 3MXXA 5C9ZB 4ES0A 4E54A 5HE0B 3F3GA 3UKRC 3NIDB 1JOFA 3CFSB 2HJ4A 2P9UC 4AOWA 1B9YA 4GM9A 4EWRA 5KDOB 1U2VC 3A0FA 4L1QD 2IUVA 1SQJA 4O3TB 3SFZA 3I8EA 4FAVD 2IWKA
chains in the Genus database with same CATH superfamily
2PM9A 2IURA 2AGWA 4JHNA 5AMSA 3IJ0A 3OKYB 2PM9B 1PBYB 1QFSA 2QZPA 3UVOA 4CI2A 1OLZA 4PSXB 3MVDK 2H13A 3IUNA 3I7KA 3P4FA 4X60B 5IT9g 5K1CC 2HYEA 2HJBA 1UOPA 4WJKA 1U8CA 2AGXA 4J81A 1S4UX 3SWSD 2WQ8A 3JRPA 1K8KC 5AFU3 1U8CB 5IJ7E 3AL8A 4QRJA 1E8MA 5FKSA 4AN0A 3ODTA 4FA1D 3GD1I 3SLED 5K19A 2CNXA 2XYIA 3AL8B 3PVWB 5CXBA 2H9MA 1SSLA 5I5IA 3RN0D 4G56B 4K3JB 2Z2PA 4XYHA 1E5TA 5CXBB 3IVMA 2BKLA 4CI1A 2OJYA 3IJCA 5AJAA 3O4IA 2YB8B 1JMXB 3EG6A 3GREA 4K3ID 5GSAA 4QAMA 3K6SA 4FA5D 3IUJA 5A2Qg 3ZDYB 3EWEA 4ZOVA 1VE7A 3CIKB 4J77A 2H6NA 3RFGA 5I5MA 4U1EI 5EAPA 4BH6A 4E5ZB 2CE9A 5TEFA 3RMZD 3O4JA 4UM9D 4TZ4A 3IJEA 4R7AB 4ERZA 5SXMA 2QXVA 1JMZB 2BCJB 3V5WB 2CN2A 5C2WB 1PI6A 4WK0A 1P22A 1E8NA 3F3PA 1L5GA 5M5RA 4WK0B 3B7FA 1TBGA 2P9LC 4O45A 3PXSD 2YNPA 4BUJC 4Z7NA 3O4GA 4FHLA 2VDNB 2CN3A 4D0KA 3FGBA 2IUPA 3O4HA 4Z7NB 3EI4B 1QFMA 4HDJA 2EIEA 1RI6A 1U4CA 3SCYA 4Z8LA 4DNVA 2VDRB 1A12A 3ZDXA 2P9IC 4GGAA 5E6UA 3UKUC 3W15A 3DXKC 1VZ2A 5C92A 1M1XA 3ZDXB 1R5MA 2HKRA 4ZN4A 2EIBA 3HFQA 4MK0B 2CO0C 3J81g 4Z7QB 4CY1A 4JT5C 3T3PA 3I7PA 4I79A 4CI3A 2JWHA 3JPXA 5FKQA 5HDBA 1MG2A 5B4WA 3MZLA 1GOGA 1YR2A 2PBIB 1T2XA 1VE6A 4D6VA 3NIFA 1VZ3A 3NIDA 4KFMB 2IWFA 4GQBB 5EMLB 3NIFB 4Y7RA 4JT6C 3C75H 2EBSA 4ERQA 4NC4A 4L9OA 5FA5B 3E0CA 3K72A 4QQEA 4AEZA 2VDMB 2AQ5A 4J86A 3OKWA 3DWLC 1C9LA 3T3MA 1JTDB 3OKYA 3L4OD 3PSLA 3UVMA 4BP9A 4J82A 2VDLA 5M61A 4G55A 4JSXC 3EU7A 3T3MB 2H9LA 4PC0A 2GC4A 1TYQC 3NVXA 2P28A 2VDLB 3I7NA 2YMUA 3ZE1B 3IIYA 4ZOYA 3KCIA 3IJ1A 3UVNA 5M5UA 2P9KC 2TRCB 2IAAA 4ZOZA 3AH8B 4U7AA 2H6QA 2HXCA 4O02A 4AMZA 4XYIA 5TEEA 4J8GA 2Z2OA 3MZKA 1JV2A 2B5MA 3C5MA 2B5NA 4JHPC 5EAMA 2B5LA 4GMBA 2VDQA 3SXTD 3I89A 4QL1A 2CO0A 2VDQB 4LG9A 3OTTA 5EALA 1YUKA 3PXWD 4JSPC 2PM6B 3PVUB 2XL3A 2OK4A 2AGYA 3OL2B 5E6RA 4XEIC 4A11A 3DXMC 4NAAA 2MTAH 4JXMA 1A0RB 3NVQA 3CFVA 5E6RB 4GM3A 3ZDYA 4LG8A 4H5IA 4A11B 2H47A 2YBAA 4DNUA 3SBQA 1B9XA 2W18A 1NEXB 1VYHC 4J84A 3UR4A 3ZDZA 4E5ZA 1TYEA 3K27A 5JWZA 3VH0A 2VDOB 3PXTD 1H2ZA 3ZDZB 1TYEB 3SBRA 3JZNA 4WK4B 4BP8A 1UOOA 3EQ8A 1MDAH 4UM9A 4AMYA 2I0RA 5HE3B 2VC2A 5HE2B 5FLXg 3F3FA 5EMJB 4UM9B 2P9NC 5THAA 3IIWA 2GNQA 2PM7B 2VC2B 4Z7OB 4PSWB 4X61B 2GC7A 2VDNA 5TDHB 3EI3A 5C2VB 5I5JA 2OVPB 2XZGA 4A08A 2H3XA 3EI4A 3MKSB 1PEVA 4N14A 2P9SC 3EI3B 3EMHA 3SMRA 1XIPA 2VDRA 4A08B 3AL9A 4A7JA 3K26A 4JD2C 4A0AB 5HYNB 2XDWA 5GMKn 4A2MA 2QC5A 4CI8A 2YNOA 3DM0A 4X3EA 4CZYA 4Z7QA 5IC7A 4GQ2P 3N0DA 4BCCA 3I7LA 4MMXA 3VGZA 2UZXB 3ULEC 4L1MA 3C99A 3SVWD 3MUOA 5H17A 1GXRA 5H14A 3VI3A 3MMYA 4BCBA 4Y5RD 3UVKA 3VI4B 3EQ7A 4NBMA 3I7OA 2IUQA 3KRXB 3I2NA 1MG3A 3OKTA 4CY5A 3VI3B 1NR0A 2BBKH 4AN1A 1XKSA 3SHFA 2QR5A 5HE1B 2VZ1A 3ZE2A 2AGLA 3IUMA 4O2WA 5FKRA 3ZE0A 2CE8A 4ZOXA 1H2WA 3FCUB 3BG1A 3ZE2B 1JJUB 2VDMA 2UZYB 3ZE0B 3JAMg 3RN1D 3AFCA 4A09A 3MUNA 3BG0A 4IA9A 2HU5A 3GC3B 3JZHA 4FWWA 5H1MA 4A09B 2I3TA 4BL0A 4LGNA 5EARA 4IMMA 1SHYB 2HKMA 2H9PA 3PSCB 4PBYA 4RE5A 4QT8A 4ERYA 4A2LA 1UOQA 4FB1D 3ZE1A 4J73A 2H9NA 4NENA 4RE6A 5TF2A 3MKQA 3EI2A 4ESGA 1FWXA 4E54B 3V9FA 4D9SA 5GXIA 5CYKA 3EI2B 2B4EA 2VDKA 3I8CA 5CYKB 4CY3A 5FQDA 4OZUA 5E6SB 2JKXA 3ZWLB 5C86A 4J8BA 3V4VA 1GG2B 2VDKB 5HQGA 1I2MB 1PGUA 1XHMA 3U4YA 4FA9D 4OWRA 1GOTB 2G99A 2XE4A 3JB9L 5FXYA 1N6DA 2H6KA 3OL2A 5EM2A 3VA6A 3IULA 1BPOA 4FA4D 4UI9R 4CZXA 1GP2B 2H14A 4MMZA 5IGOA 5M5TA 5EM2B 4GM8A 2J57G 3DDUA 3IKOA 4O3UB 2XL2A 3C9CA 5CXCA 2J56H 2AH1A 4G1EA 5FFGA 3SBPA 5M5SA 4WJKB 5CXCB 4CY2A 2VDOA 2OIZA 2OK6A 3SN6B 4WK4A 5EMMB 4J0WA 3SJLD 1ERJA 2VZ3A 2P9PC 4J0XA 4GZ8A 4A0BA 1GOHA 2EICA 3I7HA 2YNNA 4Z7OA 4WK2A 4BCDA 3JZGA 1GOFA 4A0BB 1YFQA 2JWGA 4PNKB 2O9KA 3V7DB 4WK2B 2OVRB 4J79A 1K32A 3NVNA 1H2YA 2HESX 4O1QD 4DNWA 2Q7QA 1K3IA 2G9AA 4CC9A 2I0TA 3N0EA 3QI0A 4GGCA 4A0AA 4G1MA 5GXHA 1N6FA 3UVLA 1SQ9A 3NIGA 4L3GD 2HU7A 3K71A 1UTCA 3RRMC 1H2XA 1C9IA 3NIGB 4YVDA 4J78A 2I3SA 5M5VA 2J55H 2OVQB 3L4MD 5EMKB 1QNIA 3DSMA 2H68A 3GFCA 3QHYB 1OMWB 3VI4A 2XU7A 4PBZA 4X63B 3KRWB 5IGQA 3BWSA 2AGZA 1O6FA 3RSEC 4UM8A 3JROA 4FAND 4H5JA 3IURA 3FCUA 4UM8B 5E6UB 2P26A 2VDPA 3FM0A 4PXWA 3ORVD 4GGDA 5FKTA 4CZVA 4NSXA 3OF7A 1N6EA 2I0SA 2VDPB 3J80g 2AH0A 3EI1A 2HU8A 3RLMD 4O9DA 4JSNC 4J87A 4JSVC 3EI1B 3T3PB 3OW8A 4L3HD 5FFOA 5IJ8E 4IRZA 2Z2NA 3RFHA 3PE7A 3FRXA 1Q47A 3FCSA 4GQ1A 5HDBB 2EIDA 1L0QA 3MXXA 5C9ZB 4MMYA 4ES0A 4E54A 5HE0B 3F3GA 3EQ9A 3IUQA 3UKRC 3NIDB 1JOFA 4AX4A 3CFSB 2HJ4A 5E6SA 2P9UC 4AOWA 1B9YA 4GM9A 4EWRA 5KDOB 3V4PA 1U2VC 3A0FA 4L1QD 2IUVA 1SQJA 4O3TB 3SFZA 3I8EA 4FAVD 1O6GA 2IWKA
chains in the Genus database with same CATH topology
2PM9A 2IURA 2AGWA 5AMSA 3IJ0A 3OKYB 2PM9B 1PBYB 3UVOA 4CI2A 1OLZA 4PSXB 2H13A 3I7KA 3P4FA 4X60B 5IT9g 5K1CC 2HYEA 2HJBA 2AGXA 4J81A 1S4UX 3SWSD 3JRPA 1K8KC 5AFU3 1U8CB 5IJ7E 3AL8A 4QRJA 5FKSA 3ODTA 4FA1D 3SLED 5K19A 2CNXA 2XYIA 3AL8B 3PVWB 5CXBA 2H9MA 1SSLA 5I5IA 3RN0D 4G56B 4K3JB 2Z2PA 4XYHA 5CXBB 4CI1A 2OJYA 3IJCA 5AJAA 2YB8B 1JMXB 3EG6A 3GREA 4K3ID 5GSAA 4FA5D 5A2Qg 3ZDYB 3EWEA 4ZOVA 3CIKB 4J77A 2H6NA 3RFGA 5I5MA 4U1EI 5EAPA 4BH6A 4E5ZB 2CE9A 5TEFA 3RMZD 4UM9D 4TZ4A 4R7AB 4ERZA 5SXMA 2QXVA 1JMZB 2BCJB 3V5WB 2CN2A 5C2WB 1PI6A 1P22A 3F3PA 4WK0B 3B7FA 1TBGA 2P9LC 4O45A 3PXSD 2YNPA 4BUJC 4FHLA 2VDNB 2CN3A 4D0KA 3FGBA 2IUPA 4Z7NB 3EI4B 4HDJA 1RI6A 1U4CA 3SCYA 4Z8LA 2VDRB 2P9IC 4GGAA 3UKUC 3W15A 3DXKC 3ZDXB 1R5MA 2HKRA 4ZN4A 3HFQA 4MK0B 2CO0C 3J81g 4Z7QB 4CY1A 4JT5C 3I7PA 4I79A 4CI3A 2JWHA 3JPXA 5FKQA 1MG2A 5B4WA 3MZLA 2PBIB 4D6VA 4KFMB 2IWFA 4GQBB 5EMLB 3NIFB 4Y7RA 4JT6C 3C75H 2EBSA 4ERQA 4L9OA 5FA5B 3E0CA 4QQEA 4AEZA 2VDMB 2AQ5A 4J86A 3OKWA 3DWLC 3OKYA 3L4OD 3PSLA 3UVMA 4J82A 4JSXC 3EU7A 3T3MB 2H9LA 4PC0A 2GC4A 1TYQC 3NVXA 2P28A 2VDLB 3I7NA 2YMUA 3ZE1B 3IIYA 4ZOYA 3IJ1A 3UVNA 2P9KC 2TRCB 2IAAA 4ZOZA 3AH8B 4U7AA 2H6QA 2HXCA 4XYIA 5TEEA 4J8GA 2Z2OA 3MZKA 2B5MA 3C5MA 2B5NA 5EAMA 2B5LA 4GMBA 3SXTD 3I89A 4QL1A 2CO0A 2VDQB 4LG9A 3OTTA 5EALA 1YUKA 3PXWD 4JSPC 2PM6B 3PVUB 2XL3A 2OK4A 2AGYA 3OL2B 4XEIC 4A11A 3DXMC 2MTAH 4JXMA 1A0RB 3NVQA 3CFVA 5E6RB 4GM3A 4LG8A 4H5IA 4A11B 2H47A 2YBAA 3SBQA 1B9XA 2W18A 1NEXB 1VYHC 4J84A 3UR4A 4E5ZA 3K27A 5JWZA 3VH0A 2VDOB 3PXTD 3ZDZB 1TYEB 3SBRA 3JZNA 4WK4B 1MDAH 2I0RA 5HE3B 5HE2B 5FLXg 3F3FA 5EMJB 4UM9B 2P9NC 5THAA 3IIWA 2GNQA 2PM7B 2VC2B 4Z7OB 4PSWB 4X61B 2GC7A 5TDHB 3EI3A 5C2VB 5I5JA 2OVPB 4A08A 2H3XA 3EI4A 3MKSB 4N14A 1PEVA 2P9SC 3EI3B 3EMHA 3SMRA 1XIPA 4A08B 3AL9A 4A7JA 3K26A 4JD2C 4A0AB 5HYNB 5GMKn 4A2MA 2QC5A 4CI8A 2YNOA 3DM0A 4X3EA 4CZYA 5IC7A 4GQ2P 3N0DA 3I7LA 3VGZA 2UZXB 3ULEC 3C99A 3SVWD 5H17A 1GXRA 5H14A 3MMYA 4Y5RD 3UVKA 3VI4B 3I7OA 2IUQA 3KRXB 3I2NA 1MG3A 3OKTA 4CY5A 3VI3B 1NR0A 2BBKH 1XKSA 3SHFA 5HE1B 2AGLA 5FKRA 2CE8A 4ZOXA 3FCUB 3BG1A 3ZE2B 1JJUB 2UZYB 3ZE0B 3JAMg 3RN1D 3AFCA 4A09A 3BG0A 4IA9A 3JZHA 4FWWA 5H1MA 4A09B 2I3TA 4BL0A 4LGNA 5EARA 4IMMA 1SHYB 2HKMA 2H9PA 3PSCB 4PBYA 4QT8A 4ERYA 4A2LA 4FB1D 4J73A 2H9NA 5TF2A 3MKQA 3EI2A 4ESGA 1FWXA 4E54B 3V9FA 5GXIA 5CYKA 3EI2B 2B4EA 3I8CA 5CYKB 4CY3A 5FQDA 4OZUA 5E6SB 3ZWLB 4J8BA 1GG2B 2VDKB 5HQGA 1PGUA 1XHMA 3U4YA 4FA9D 4OWRA 1GOTB 2G99A 3JB9L 5FXYA 1N6DA 2H6KA 3OL2A 5EM2A 3VA6A 4FA4D 4UI9R 4CZXA 1GP2B 2H14A 5IGOA 5EM2B 4GM8A 2J57G 3IKOA 4O3UB 2XL2A 3C9CA 5CXCA 2J56H 2AH1A 3SBPA 4WJKB 5CXCB 4CY2A 2OIZA 2OK6A 3SN6B 5EMMB 4J0WA 3SJLD 1ERJA 2P9PC 4J0XA 4GZ8A 4A0BA 3I7HA 2YNNA 3JZGA 4A0BB 1YFQA 2JWGA 4PNKB 2O9KA 3V7DB 4WK2B 2OVRB 4J79A 1K32A 3NVNA 2HESX 4O1QD 2Q7QA 2G9AA 4CC9A 2I0TA 3N0EA 4GGCA 4A0AA 5GXHA 1N6FA 3UVLA 1SQ9A 4L3GD 3RRMC 3NIGB 4YVDA 4J78A 2I3SA 2J55H 2OVQB 3L4MD 5EMKB 1QNIA 3DSMA 2H68A 3GFCA 1OMWB 2XU7A 4PBZA 4X63B 3KRWB 5IGQA 3BWSA 2AGZA 3RSEC 3JROA 4FAND 4H5JA 4UM8B 5E6UB 2P26A 3FM0A 4PXWA 3ORVD 4GGDA 5FKTA 4CZVA 4NSXA 1N6EA 2I0SA 2VDPB 3J80g 2AH0A 3EI1A 3RLMD 4O9DA 4JSNC 4J87A 4JSVC 3EI1B 3T3PB 3OW8A 4L3HD 5IJ8E 2Z2NA 3RFHA 3PE7A 3FRXA 1Q47A 4GQ1A 5HDBB 1L0QA 3MXXA 5C9ZB 4ES0A 4E54A 5HE0B 3F3GA 3UKRC 3NIDB 1JOFA 3CFSB 2HJ4A 2P9UC 4AOWA 1B9YA 4GM9A 4EWRA 5KDOB 1U2VC 3A0FA 4L1QD 2IUVA 1SQJA 4O3TB 3SFZA 3I8EA 4FAVD 2IWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PM9 A;  2IUR A;  2AGW A;  5AMS A;  3IJ0 A;  3OKY B;  2PM9 B;  1PBY B;  3UVO A;  4CI2 A;  1OLZ A;  4PSX B;  2H13 A;  3I7K A;  3P4F A;  4X60 B;  5IT9 g;  5K1C C;  2HYE A;  2HJB A;  2AGX A;  4J81 A;  1S4U X;  3SWS D;  3JRP A;  1K8K C;  5AFU 3;  1U8C B;  5IJ7 E;  3AL8 A;  4QRJ A;  5FKS A;  3ODT A;  4FA1 D;  3SLE D;  5K19 A;  2CNX A;  2XYI A;  3AL8 B;  3PVW B;  5CXB A;  2H9M A;  1SSL A;  5I5I A;  3RN0 D;  4G56 B;  4K3J B;  2Z2P A;  4XYH A;  5CXB B;  4CI1 A;  2OJY A;  3IJC A;  5AJA A;  2YB8 B;  1JMX B;  3EG6 A;  3GRE A;  4K3I D;  5GSA A;  4FA5 D;  5A2Q g;  3ZDY B;  3EWE A;  4ZOV A;  3CIK B;  4J77 A;  2H6N A;  3RFG A;  5I5M A;  4U1E I;  5EAP A;  4BH6 A;  4E5Z B;  2CE9 A;  5TEF A;  3RMZ D;  4UM9 D;  4TZ4 A;  4R7A B;  4ERZ A;  5SXM A;  2QXV A;  1JMZ B;  2BCJ B;  3V5W B;  2CN2 A;  5C2W B;  1PI6 A;  1P22 A;  3F3P A;  4WK0 B;  3B7F A;  1TBG A;  2P9L C;  4O45 A;  3PXS D;  2YNP A;  4BUJ C;  4FHL A;  2VDN B;  2CN3 A;  4D0K A;  3FGB A;  2IUP A;  4Z7N B;  3EI4 B;  4HDJ A;  1RI6 A;  1U4C A;  3SCY A;  4Z8L A;  2VDR B;  2P9I C;  4GGA A;  3UKU C;  3W15 A;  3DXK C;  3ZDX B;  1R5M A;  2HKR A;  4ZN4 A;  3HFQ A;  4MK0 B;  2CO0 C;  3J81 g;  4Z7Q B;  4CY1 A;  4JT5 C;  3I7P A;  4I79 A;  4CI3 A;  3JPX A;  5FKQ A;  1MG2 A;  5B4W A;  3MZL A;  2PBI B;  4D6V A;  4KFM B;  2IWF A;  4GQB B;  5EML B;  3NIF B;  4Y7R A;  4JT6 C;  3C75 H;  2EBS A;  4ERQ A;  4L9O A;  5FA5 B;  3E0C A;  4QQE A;  4AEZ A;  2VDM B;  2AQ5 A;  4J86 A;  3OKW A;  3DWL C;  3OKY A;  3L4O D;  3PSL A;  3UVM A;  4J82 A;  4JSX C;  3EU7 A;  3T3M B;  2H9L A;  4PC0 A;  2GC4 A;  1TYQ C;  3NVX A;  2P28 A;  2VDL B;  3I7N A;  2YMU A;  3ZE1 B;  3IIY A;  4ZOY A;  3IJ1 A;  3UVN A;  2P9K C;  2TRC B;  2IAA A;  4ZOZ A;  3AH8 B;  4U7A A;  2H6Q A;  2HXC A;  4XYI A;  5TEE A;  4J8G A;  2Z2O A;  3MZK A;  2B5M A;  3C5M A;  2B5N A;  5EAM A;  2B5L A;  4GMB A;  3SXT D;  3I89 A;  4QL1 A;  2CO0 A;  2VDQ B;  4LG9 A;  3OTT A;  5EAL A;  1YUK A;  3PXW D;  4JSP C;  2PM6 B;  3PVU B;  2XL3 A;  2OK4 A;  2AGY A;  3OL2 B;  4XEI C;  4A11 A;  3DXM C;  2MTA H;  4JXM A;  1A0R B;  3NVQ A;  3CFV A;  5E6R B;  4GM3 A;  4LG8 A;  4H5I A;  4A11 B;  2H47 A;  2YBA A;  3SBQ A;  1B9X A;  2W18 A;  1NEX B;  1VYH C;  4J84 A;  3UR4 A;  4E5Z A;  3K27 A;  5JWZ A;  3VH0 A;  2VDO B;  3PXT D;  3ZDZ B;  1TYE B;  3SBR A;  3JZN A;  4WK4 B;  1MDA H;  2I0R A;  5HE3 B;  5HE2 B;  5FLX g;  3F3F A;  5EMJ B;  4UM9 B;  2P9N C;  5THA A;  3IIW A;  2GNQ A;  2PM7 B;  2VC2 B;  4Z7O B;  4PSW B;  4X61 B;  2GC7 A;  5TDH B;  3EI3 A;  5C2V B;  5I5J A;  2OVP B;  4A08 A;  2H3X A;  3EI4 A;  3MKS B;  4N14 A;  1PEV A;  2P9S C;  3EI3 B;  3EMH A;  3SMR A;  1XIP A;  4A08 B;  3AL9 A;  4A7J A;  3K26 A;  4JD2 C;  4A0A B;  5HYN B;  5GMK n;  4A2M A;  2QC5 A;  4CI8 A;  2YNO A;  3DM0 A;  4X3E A;  4CZY A;  5IC7 A;  4GQ2 P;  3N0D A;  3I7L A;  3VGZ A;  2UZX B;  3ULE C;  3C99 A;  3SVW D;  5H17 A;  1GXR A;  5H14 A;  3MMY A;  4Y5R D;  3UVK A;  3VI4 B;  3I7O A;  2IUQ A;  3KRX B;  3I2N A;  1MG3 A;  3OKT A;  4CY5 A;  3VI3 B;  1NR0 A;  2BBK H;  1XKS A;  3SHF A;  5HE1 B;  2AGL A;  5FKR A;  2CE8 A;  4ZOX A;  3FCU B;  3BG1 A;  3ZE2 B;  1JJU B;  2UZY B;  3ZE0 B;  3JAM g;  3RN1 D;  3AFC A;  4A09 A;  3BG0 A;  4IA9 A;  3JZH A;  4FWW A;  5H1M A;  4A09 B;  2I3T A;  4BL0 A;  4LGN A;  5EAR A;  4IMM A;  1SHY B;  2HKM A;  2H9P A;  3PSC B;  4PBY A;  4QT8 A;  4ERY A;  4A2L A;  4FB1 D;  4J73 A;  2H9N A;  5TF2 A;  3MKQ A;  3EI2 A;  4ESG A;  1FWX A;  4E54 B;  3V9F A;  5GXI A;  5CYK A;  3EI2 B;  2B4E A;  3I8C A;  5CYK B;  4CY3 A;  5FQD A;  4OZU A;  5E6S B;  3ZWL B;  4J8B A;  1GG2 B;  2VDK B;  5HQG A;  1PGU A;  1XHM A;  3U4Y A;  4FA9 D;  4OWR A;  1GOT B;  2G99 A;  3JB9 L;  5FXY A;  1N6D A;  2H6K A;  3OL2 A;  5EM2 A;  3VA6 A;  4FA4 D;  4UI9 R;  4CZX A;  1GP2 B;  2H14 A;  5IGO A;  5EM2 B;  4GM8 A;  2J57 G;  3IKO A;  4O3U B;  2XL2 A;  3C9C A;  5CXC A;  2J56 H;  2AH1 A;  3SBP A;  4WJK B;  5CXC B;  4CY2 A;  2OIZ A;  2OK6 A;  3SN6 B;  5EMM B;  4J0W A;  3SJL D;  1ERJ A;  2P9P C;  4J0X A;  4GZ8 A;  4A0B A;  3I7H A;  2YNN A;  3JZG A;  4A0B B;  1YFQ A;  4PNK B;  2O9K A;  3V7D B;  4WK2 B;  2OVR B;  4J79 A;  1K32 A;  3NVN A;  2HES X;  4O1Q D;  2Q7Q A;  2G9A A;  4CC9 A;  2I0T A;  3N0E A;  4GGC A;  4A0A A;  5GXH A;  1N6F A;  3UVL A;  1SQ9 A;  4L3G D;  3RRM C;  3NIG B;  4YVD A;  4J78 A;  2I3S A;  2J55 H;  2OVQ B;  3L4M D;  5EMK B;  1QNI A;  3DSM A;  2H68 A;  3GFC A;  1OMW B;  2XU7 A;  4PBZ A;  4X63 B;  3KRW B;  5IGQ A;  3BWS A;  2AGZ A;  3RSE C;  3JRO A;  4FAN D;  4H5J A;  4UM8 B;  5E6U B;  2P26 A;  3FM0 A;  4PXW A;  3ORV D;  4GGD A;  5FKT A;  4CZV A;  4NSX A;  1N6E A;  2I0S A;  2VDP B;  3J80 g;  2AH0 A;  3EI1 A;  3RLM D;  4O9D A;  4JSN C;  4J87 A;  4JSV C;  3EI1 B;  3T3P B;  3OW8 A;  4L3H D;  5IJ8 E;  2Z2N A;  3RFH A;  3PE7 A;  3FRX A;  1Q47 A;  4GQ1 A;  5HDB B;  1L0Q A;  3MXX A;  5C9Z B;  4ES0 A;  4E54 A;  5HE0 B;  3F3G A;  3UKR C;  3NID B;  1JOF A;  3CFS B;  2HJ4 A;  2P9U C;  4AOW A;  1B9Y A;  4GM9 A;  4EWR A;  5KDO B;  1U2V C;  3A0F A;  4L1Q D;  2IUV A;  1SQJ A;  4O3T B;  3SFZ A;  3I8E A;  4FAV D;  2IWK A; 
#chains in the Genus database with same CATH topology
 2PM9 A;  2IUR A;  2AGW A;  4JHN A;  5AMS A;  3IJ0 A;  3OKY B;  2PM9 B;  1PBY B;  1QFS A;  2QZP A;  3UVO A;  4CI2 A;  1OLZ A;  4PSX B;  3MVD K;  2H13 A;  3IUN A;  3I7K A;  3P4F A;  4X60 B;  5IT9 g;  5K1C C;  2HYE A;  2HJB A;  1UOP A;  4WJK A;  1U8C A;  2AGX A;  4J81 A;  1S4U X;  3SWS D;  2WQ8 A;  3JRP A;  1K8K C;  5AFU 3;  1U8C B;  5IJ7 E;  3AL8 A;  4QRJ A;  1E8M A;  5FKS A;  4AN0 A;  3ODT A;  4FA1 D;  3GD1 I;  3SLE D;  5K19 A;  2CNX A;  2XYI A;  3AL8 B;  3PVW B;  5CXB A;  2H9M A;  1SSL A;  5I5I A;  3RN0 D;  4G56 B;  4K3J B;  2Z2P A;  4XYH A;  1E5T A;  5CXB B;  3IVM A;  2BKL A;  4CI1 A;  2OJY A;  3IJC A;  5AJA A;  3O4I A;  2YB8 B;  1JMX B;  3EG6 A;  3GRE A;  4K3I D;  5GSA A;  4QAM A;  3K6S A;  4FA5 D;  3IUJ A;  5A2Q g;  3ZDY B;  3EWE A;  4ZOV A;  1VE7 A;  3CIK B;  4J77 A;  2H6N A;  3RFG A;  5I5M A;  4U1E I;  5EAP A;  4BH6 A;  4E5Z B;  2CE9 A;  5TEF A;  3RMZ D;  3O4J A;  4UM9 D;  4TZ4 A;  3IJE A;  4R7A B;  4ERZ A;  5SXM A;  2QXV A;  1JMZ B;  2BCJ B;  3V5W B;  2CN2 A;  5C2W B;  1PI6 A;  4WK0 A;  1P22 A;  1E8N A;  3F3P A;  1L5G A;  5M5R A;  4WK0 B;  3B7F A;  1TBG A;  2P9L C;  4O45 A;  3PXS D;  2YNP A;  4BUJ C;  4Z7N A;  3O4G A;  4FHL A;  2VDN B;  2CN3 A;  4D0K A;  3FGB A;  2IUP A;  3O4H A;  4Z7N B;  3EI4 B;  1QFM A;  4HDJ A;  2EIE A;  1RI6 A;  1U4C A;  3SCY A;  4Z8L A;  4DNV A;  2VDR B;  1A12 A;  3ZDX A;  2P9I C;  4GGA A;  5E6U A;  3UKU C;  3W15 A;  3DXK C;  1VZ2 A;  5C92 A;  1M1X A;  3ZDX B;  1R5M A;  2HKR A;  4ZN4 A;  2EIB A;  3HFQ A;  4MK0 B;  2CO0 C;  3J81 g;  4Z7Q B;  4CY1 A;  4JT5 C;  3T3P A;  3I7P A;  4I79 A;  4CI3 A;  2JWH A;  3JPX A;  5FKQ A;  5HDB A;  1MG2 A;  5B4W A;  3MZL A;  1GOG A;  1YR2 A;  2PBI B;  1T2X A;  1VE6 A;  4D6V A;  3NIF A;  1VZ3 A;  3NID A;  4KFM B;  2IWF A;  4GQB B;  5EML B;  3NIF B;  4Y7R A;  4JT6 C;  3C75 H;  2EBS A;  4ERQ A;  4NC4 A;  4L9O A;  5FA5 B;  3E0C A;  3K72 A;  4QQE A;  4AEZ A;  2VDM B;  2AQ5 A;  4J86 A;  3OKW A;  3DWL C;  1C9L A;  3T3M A;  1JTD B;  3OKY A;  3L4O D;  3PSL A;  3UVM A;  4BP9 A;  4J82 A;  2VDL A;  5M61 A;  4G55 A;  4JSX C;  3EU7 A;  3T3M B;  2H9L A;  4PC0 A;  2GC4 A;  1TYQ C;  3NVX A;  2P28 A;  2VDL B;  3I7N A;  2YMU A;  3ZE1 B;  3IIY A;  4ZOY A;  3KCI A;  3IJ1 A;  3UVN A;  5M5U A;  2P9K C;  2TRC B;  2IAA A;  4ZOZ A;  3AH8 B;  4U7A A;  2H6Q A;  2HXC A;  4O02 A;  4AMZ A;  4XYI A;  5TEE A;  4J8G A;  2Z2O A;  3MZK A;  1JV2 A;  2B5M A;  3C5M A;  2B5N A;  4JHP C;  5EAM A;  2B5L A;  4GMB A;  2VDQ A;  3SXT D;  3I89 A;  4QL1 A;  2CO0 A;  2VDQ B;  4LG9 A;  3OTT A;  5EAL A;  1YUK A;  3PXW D;  4JSP C;  2PM6 B;  3PVU B;  2XL3 A;  2OK4 A;  2AGY A;  3OL2 B;  5E6R A;  4XEI C;  4A11 A;  3DXM C;  4NAA A;  2MTA H;  4JXM A;  1A0R B;  3NVQ A;  3CFV A;  5E6R B;  4GM3 A;  3ZDY A;  4LG8 A;  4H5I A;  4A11 B;  2H47 A;  2YBA A;  4DNU A;  3SBQ A;  1B9X A;  2W18 A;  1NEX B;  1VYH C;  4J84 A;  3UR4 A;  3ZDZ A;  4E5Z A;  1TYE A;  3K27 A;  5JWZ A;  3VH0 A;  2VDO B;  3PXT D;  1H2Z A;  3ZDZ B;  1TYE B;  3SBR A;  3JZN A;  4WK4 B;  4BP8 A;  1UOO A;  3EQ8 A;  1MDA H;  4UM9 A;  4AMY A;  2I0R A;  5HE3 B;  2VC2 A;  5HE2 B;  5FLX g;  3F3F A;  5EMJ B;  4UM9 B;  2P9N C;  5THA A;  3IIW A;  2GNQ A;  2PM7 B;  2VC2 B;  4Z7O B;  4PSW B;  4X61 B;  2GC7 A;  2VDN A;  5TDH B;  3EI3 A;  5C2V B;  5I5J A;  2OVP B;  2XZG A;  4A08 A;  2H3X A;  3EI4 A;  3MKS B;  1PEV A;  4N14 A;  2P9S C;  3EI3 B;  3EMH A;  3SMR A;  1XIP A;  2VDR A;  4A08 B;  3AL9 A;  4A7J A;  3K26 A;  4JD2 C;  4A0A B;  5HYN B;  2XDW A;  5GMK n;  4A2M A;  2QC5 A;  4CI8 A;  2YNO A;  3DM0 A;  4X3E A;  4CZY A;  4Z7Q A;  5IC7 A;  4GQ2 P;  3N0D A;  4BCC A;  3I7L A;  4MMX A;  3VGZ A;  2UZX B;  3ULE C;  4L1M A;  3C99 A;  3SVW D;  3MUO A;  5H17 A;  1GXR A;  5H14 A;  3VI3 A;  3MMY A;  4BCB A;  4Y5R D;  3UVK A;  3VI4 B;  3EQ7 A;  4NBM A;  3I7O A;  2IUQ A;  3KRX B;  3I2N A;  1MG3 A;  3OKT A;  4CY5 A;  3VI3 B;  1NR0 A;  2BBK H;  4AN1 A;  1XKS A;  3SHF A;  2QR5 A;  5HE1 B;  2VZ1 A;  3ZE2 A;  2AGL A;  3IUM A;  4O2W A;  5FKR A;  3ZE0 A;  2CE8 A;  4ZOX A;  1H2W A;  3FCU B;  3BG1 A;  3ZE2 B;  1JJU B;  2VDM A;  2UZY B;  3ZE0 B;  3JAM g;  3RN1 D;  3AFC A;  4A09 A;  3MUN A;  3BG0 A;  4IA9 A;  2HU5 A;  3GC3 B;  3JZH A;  4FWW A;  5H1M A;  4A09 B;  2I3T A;  4BL0 A;  4LGN A;  5EAR A;  4IMM A;  1SHY B;  2HKM A;  2H9P A;  3PSC B;  4PBY A;  4RE5 A;  4QT8 A;  4ERY A;  4A2L A;  1UOQ A;  4FB1 D;  3ZE1 A;  4J73 A;  2H9N A;  4NEN A;  4RE6 A;  5TF2 A;  3MKQ A;  3EI2 A;  4ESG A;  1FWX A;  4E54 B;  3V9F A;  4D9S A;  5GXI A;  5CYK A;  3EI2 B;  2B4E A;  2VDK A;  3I8C A;  5CYK B;  4CY3 A;  5FQD A;  4OZU A;  5E6S B;  2JKX A;  3ZWL B;  5C86 A;  4J8B A;  3V4V A;  1GG2 B;  2VDK B;  5HQG A;  1I2M B;  1PGU A;  1XHM A;  3U4Y A;  4FA9 D;  4OWR A;  1GOT B;  2G99 A;  2XE4 A;  3JB9 L;  5FXY A;  1N6D A;  2H6K A;  3OL2 A;  5EM2 A;  3VA6 A;  3IUL A;  1BPO A;  4FA4 D;  4UI9 R;  4CZX A;  1GP2 B;  2H14 A;  4MMZ A;  5IGO A;  5M5T A;  5EM2 B;  4GM8 A;  2J57 G;  3DDU A;  3IKO A;  4O3U B;  2XL2 A;  3C9C A;  5CXC A;  2J56 H;  2AH1 A;  4G1E A;  5FFG A;  3SBP A;  5M5S A;  4WJK B;  5CXC B;  4CY2 A;  2VDO A;  2OIZ A;  2OK6 A;  3SN6 B;  4WK4 A;  5EMM B;  4J0W A;  3SJL D;  1ERJ A;  2VZ3 A;  2P9P C;  4J0X A;  4GZ8 A;  4A0B A;  1GOH A;  2EIC A;  3I7H A;  2YNN A;  4Z7O A;  4WK2 A;  4BCD A;  3JZG A;  1GOF A;  4A0B B;  1YFQ A;  2JWG A;  4PNK B;  2O9K A;  3V7D B;  4WK2 B;  2OVR B;  4J79 A;  1K32 A;  3NVN A;  1H2Y A;  2HES X;  4O1Q D;  4DNW A;  2Q7Q A;  1K3I A;  2G9A A;  4CC9 A;  2I0T A;  3N0E A;  3QI0 A;  4GGC A;  4A0A A;  4G1M A;  5GXH A;  1N6F A;  3UVL A;  1SQ9 A;  3NIG A;  4L3G D;  2HU7 A;  3K71 A;  1UTC A;  3RRM C;  1H2X A;  1C9I A;  3NIG B;  4YVD A;  4J78 A;  2I3S A;  5M5V A;  2J55 H;  2OVQ B;  3L4M D;  5EMK B;  1QNI A;  3DSM A;  2H68 A;  3GFC A;  3QHY B;  1OMW B;  3VI4 A;  2XU7 A;  4PBZ A;  4X63 B;  3KRW B;  5IGQ A;  3BWS A;  2AGZ A;  1O6F A;  3RSE C;  4UM8 A;  3JRO A;  4FAN D;  4H5J A;  3IUR A;  3FCU A;  4UM8 B;  5E6U B;  2P26 A;  2VDP A;  3FM0 A;  4PXW A;  3ORV D;  4GGD A;  5FKT A;  4CZV A;  4NSX A;  3OF7 A;  1N6E A;  2I0S A;  2VDP B;  3J80 g;  2AH0 A;  3EI1 A;  2HU8 A;  3RLM D;  4O9D A;  4JSN C;  4J87 A;  4JSV C;  3EI1 B;  3T3P B;  3OW8 A;  4L3H D;  5FFO A;  5IJ8 E;  4IRZ A;  2Z2N A;  3RFH A;  3PE7 A;  3FRX A;  1Q47 A;  3FCS A;  4GQ1 A;  5HDB B;  2EID A;  1L0Q A;  3MXX A;  5C9Z B;  4MMY A;  4ES0 A;  4E54 A;  5HE0 B;  3F3G A;  3EQ9 A;  3IUQ A;  3UKR C;  3NID B;  1JOF A;  4AX4 A;  3CFS B;  2HJ4 A;  5E6S A;  2P9U C;  4AOW A;  1B9Y A;  4GM9 A;  4EWR A;  5KDO B;  3V4P A;  1U2V C;  3A0F A;  4L1Q D;  2IUV A;  1SQJ A;  4O3T B;  3SFZ A;  3I8E A;  4FAV D;  1O6G A;  2IWK A; 
#chains in the Genus database with same CATH homology
 2PM9 A;  2IUR A;  2AGW A;  5AMS A;  3IJ0 A;  3OKY B;  2PM9 B;  1PBY B;  3UVO A;  4CI2 A;  1OLZ A;  4PSX B;  2H13 A;  3I7K A;  3P4F A;  4X60 B;  5IT9 g;  5K1C C;  2HYE A;  2HJB A;  2AGX A;  4J81 A;  1S4U X;  3SWS D;  3JRP A;  1K8K C;  5AFU 3;  1U8C B;  5IJ7 E;  3AL8 A;  4QRJ A;  5FKS A;  3ODT A;  4FA1 D;  3SLE D;  5K19 A;  2CNX A;  2XYI A;  3AL8 B;  3PVW B;  5CXB A;  2H9M A;  1SSL A;  5I5I A;  3RN0 D;  4G56 B;  4K3J B;  2Z2P A;  4XYH A;  5CXB B;  4CI1 A;  2OJY A;  3IJC A;  5AJA A;  2YB8 B;  1JMX B;  3EG6 A;  3GRE A;  4K3I D;  5GSA A;  4FA5 D;  5A2Q g;  3ZDY B;  3EWE A;  4ZOV A;  3CIK B;  4J77 A;  2H6N A;  3RFG A;  5I5M A;  4U1E I;  5EAP A;  4BH6 A;  4E5Z B;  2CE9 A;  5TEF A;  3RMZ D;  4UM9 D;  4TZ4 A;  4R7A B;  4ERZ A;  5SXM A;  2QXV A;  1JMZ B;  2BCJ B;  3V5W B;  2CN2 A;  5C2W B;  1PI6 A;  1P22 A;  3F3P A;  4WK0 B;  3B7F A;  1TBG A;  2P9L C;  4O45 A;  3PXS D;  2YNP A;  4BUJ C;  4FHL A;  2VDN B;  2CN3 A;  4D0K A;  3FGB A;  2IUP A;  4Z7N B;  3EI4 B;  4HDJ A;  1RI6 A;  1U4C A;  3SCY A;  4Z8L A;  2VDR B;  2P9I C;  4GGA A;  3UKU C;  3W15 A;  3DXK C;  3ZDX B;  1R5M A;  2HKR A;  4ZN4 A;  3HFQ A;  4MK0 B;  2CO0 C;  3J81 g;  4Z7Q B;  4CY1 A;  4JT5 C;  3I7P A;  4I79 A;  4CI3 A;  2JWH A;  3JPX A;  5FKQ A;  1MG2 A;  5B4W A;  3MZL A;  2PBI B;  4D6V A;  4KFM B;  2IWF A;  4GQB B;  5EML B;  3NIF B;  4Y7R A;  4JT6 C;  3C75 H;  2EBS A;  4ERQ A;  4L9O A;  5FA5 B;  3E0C A;  4QQE A;  4AEZ A;  2VDM B;  2AQ5 A;  4J86 A;  3OKW A;  3DWL C;  3OKY A;  3L4O D;  3PSL A;  3UVM A;  4J82 A;  4JSX C;  3EU7 A;  3T3M B;  2H9L A;  4PC0 A;  2GC4 A;  1TYQ C;  3NVX A;  2P28 A;  2VDL B;  3I7N A;  2YMU A;  3ZE1 B;  3IIY A;  4ZOY A;  3IJ1 A;  3UVN A;  2P9K C;  2TRC B;  2IAA A;  4ZOZ A;  3AH8 B;  4U7A A;  2H6Q A;  2HXC A;  4XYI A;  5TEE A;  4J8G A;  2Z2O A;  3MZK A;  2B5M A;  3C5M A;  2B5N A;  5EAM A;  2B5L A;  4GMB A;  3SXT D;  3I89 A;  4QL1 A;  2CO0 A;  2VDQ B;  4LG9 A;  3OTT A;  5EAL A;  1YUK A;  3PXW D;  4JSP C;  2PM6 B;  3PVU B;  2XL3 A;  2OK4 A;  2AGY A;  3OL2 B;  4XEI C;  4A11 A;  3DXM C;  2MTA H;  4JXM A;  1A0R B;  3NVQ A;  3CFV A;  5E6R B;  4GM3 A;  4LG8 A;  4H5I A;  4A11 B;  2H47 A;  2YBA A;  3SBQ A;  1B9X A;  2W18 A;  1NEX B;  1VYH C;  4J84 A;  3UR4 A;  4E5Z A;  3K27 A;  5JWZ A;  3VH0 A;  2VDO B;  3PXT D;  3ZDZ B;  1TYE B;  3SBR A;  3JZN A;  4WK4 B;  1MDA H;  2I0R A;  5HE3 B;  5HE2 B;  5FLX g;  3F3F A;  5EMJ B;  4UM9 B;  2P9N C;  5THA A;  3IIW A;  2GNQ A;  2PM7 B;  2VC2 B;  4Z7O B;  4PSW B;  4X61 B;  2GC7 A;  5TDH B;  3EI3 A;  5C2V B;  5I5J A;  2OVP B;  4A08 A;  2H3X A;  3EI4 A;  3MKS B;  4N14 A;  1PEV A;  2P9S C;  3EI3 B;  3EMH A;  3SMR A;  1XIP A;  4A08 B;  3AL9 A;  4A7J A;  3K26 A;  4JD2 C;  4A0A B;  5HYN B;  5GMK n;  4A2M A;  2QC5 A;  4CI8 A;  2YNO A;  3DM0 A;  4X3E A;  4CZY A;  5IC7 A;  4GQ2 P;  3N0D A;  3I7L A;  3VGZ A;  2UZX B;  3ULE C;  3C99 A;  3SVW D;  5H17 A;  1GXR A;  5H14 A;  3MMY A;  4Y5R D;  3UVK A;  3VI4 B;  3I7O A;  2IUQ A;  3KRX B;  3I2N A;  1MG3 A;  3OKT A;  4CY5 A;  3VI3 B;  1NR0 A;  2BBK H;  1XKS A;  3SHF A;  5HE1 B;  2AGL A;  5FKR A;  2CE8 A;  4ZOX A;  3FCU B;  3BG1 A;  3ZE2 B;  1JJU B;  2UZY B;  3ZE0 B;  3JAM g;  3RN1 D;  3AFC A;  4A09 A;  3BG0 A;  4IA9 A;  3JZH A;  4FWW A;  5H1M A;  4A09 B;  2I3T A;  4BL0 A;  4LGN A;  5EAR A;  4IMM A;  1SHY B;  2HKM A;  2H9P A;  3PSC B;  4PBY A;  4QT8 A;  4ERY A;  4A2L A;  4FB1 D;  4J73 A;  2H9N A;  5TF2 A;  3MKQ A;  3EI2 A;  4ESG A;  1FWX A;  4E54 B;  3V9F A;  5GXI A;  5CYK A;  3EI2 B;  2B4E A;  3I8C A;  5CYK B;  4CY3 A;  5FQD A;  4OZU A;  5E6S B;  3ZWL B;  4J8B A;  1GG2 B;  2VDK B;  5HQG A;  1PGU A;  1XHM A;  3U4Y A;  4FA9 D;  4OWR A;  1GOT B;  2G99 A;  3JB9 L;  5FXY A;  1N6D A;  2H6K A;  3OL2 A;  5EM2 A;  3VA6 A;  4FA4 D;  4UI9 R;  4CZX A;  1GP2 B;  2H14 A;  5IGO A;  5EM2 B;  4GM8 A;  2J57 G;  3IKO A;  4O3U B;  2XL2 A;  3C9C A;  5CXC A;  2J56 H;  2AH1 A;  3SBP A;  4WJK B;  5CXC B;  4CY2 A;  2OIZ A;  2OK6 A;  3SN6 B;  5EMM B;  4J0W A;  3SJL D;  1ERJ A;  2P9P C;  4J0X A;  4GZ8 A;  4A0B A;  3I7H A;  2YNN A;  3JZG A;  4A0B B;  1YFQ A;  2JWG A;  4PNK B;  2O9K A;  3V7D B;  4WK2 B;  2OVR B;  4J79 A;  1K32 A;  3NVN A;  2HES X;  4O1Q D;  2Q7Q A;  2G9A A;  4CC9 A;  2I0T A;  3N0E A;  4GGC A;  4A0A A;  5GXH A;  1N6F A;  3UVL A;  1SQ9 A;  4L3G D;  3RRM C;  3NIG B;  4YVD A;  4J78 A;  2I3S A;  2J55 H;  2OVQ B;  3L4M D;  5EMK B;  1QNI A;  3DSM A;  2H68 A;  3GFC A;  1OMW B;  2XU7 A;  4PBZ A;  4X63 B;  3KRW B;  5IGQ A;  3BWS A;  2AGZ A;  3RSE C;  3JRO A;  4FAN D;  4H5J A;  4UM8 B;  5E6U B;  2P26 A;  3FM0 A;  4PXW A;  3ORV D;  4GGD A;  5FKT A;  4CZV A;  4NSX A;  1N6E A;  2I0S A;  2VDP B;  3J80 g;  2AH0 A;  3EI1 A;  3RLM D;  4O9D A;  4JSN C;  4J87 A;  4JSV C;  3EI1 B;  3T3P B;  3OW8 A;  4L3H D;  5IJ8 E;  2Z2N A;  3RFH A;  3PE7 A;  3FRX A;  1Q47 A;  4GQ1 A;  5HDB B;  1L0Q A;  3MXX A;  5C9Z B;  4ES0 A;  4E54 A;  5HE0 B;  3F3G A;  3UKR C;  3NID B;  1JOF A;  3CFS B;  2HJ4 A;  2P9U C;  4AOW A;  1B9Y A;  4GM9 A;  4EWR A;  5KDO B;  1U2V C;  3A0F A;  4L1Q D;  2IUV A;  1SQJ A;  4O3T B;  3SFZ A;  3I8E A;  4FAV D;  2IWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...