4K3JB

Crystal structure of onartuzumab fab in complex with met and hgf-beta
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
526
structure length
499
Chain Sequence
MKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hepatocyte growth factor
publication title Monovalent antibody design and mechanism of action of onartuzumab, a MET antagonist with anti-tumor activity as a therapeutic agent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system/growth factor
total genus 115
structure length 499
sequence length 526
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4k3jB01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4k3jB02
1R5MA 1FWXA 5HE0B 4QRJA 4J84A 3J81g 4GGAA 4GQ1A 2H9PA 4E5ZA 4FA9D 1N6EA 4GM3A 3SBRA 2AQ5A 2J57G 4E54A 2CN2A 2Q7QA 3OW8A 5IJ7E 5KDOB 2IUVA 2HKMA 4J73A 3PXWD 3SWSD 3ZDXB 1U4CA 5I5MA 4CI8A 4JSPC 4A08B 1N6FA 3L4MD 3J80g 1L0QA 3VA6A 3EU7A 3PSLA 1TYQC 2CO0C 5C9ZB 2O9KA 4H5IA 4L3HD 2B4EA 2H9MA 2BCJB 2VDLB 1JOFA 2B5LA 4A0AA 4FAVD 3RFHA 3F3GA 4YVDA 1MG3A 4O9DA 3EI3A 4LG8A 2G99A 3OKYA 3AL8B 4A0BB 2QXVA 5TEFA 2Z2OA 3CFSB 3IIWA 2IWFA 3ZDYB 4OWRA 2AGWA 5E6RB 2AGZA 5EAPA 2GC4A 3F3PA 4J81A 4PSWB 4OZUA 3UKUC 1MDAH 4XYIA 5FKQA 4Y5RD 3ULEC 4CI1A 4N14A 4GM8A 2UZYB 5E6UB 2CNXA 3UKRC 2HJBA 4CI3A 2OVQB 3PVWB 4PXWA 4UM8B 2XL2A 3FM0A 4J78A 5HDBB 1K8KC 4L9OA 4JXMA 4FHLA 2AH0A 2YNOA 3SBPA 3ZE2B 4G56B 5GMKn 3RN1D 2P9IC 2VDQB 3RFGA 1VYHC 5EALA 3PVUB 4KFMB 2P26A 5EMJB 3UVOA 5IT9g 4O3UB 1JMZB 1PI6A 2HKRA 4TZ4A 2PM6B 2P28A 4K3JB 4UI9R 3AFCA 2YNPA 1B9YA 5CXCB 1PBYB 4GMBA 2Z2PA 2G9AA 4D0KA 1YUKA 3SBQA 3EG6A 3I8CA 4HDJA 3SCYA 4CC9A 1K32A 2TRCB 1N6DA 3UVLA 4CZYA 4ERYA 2EBSA 3EI2B 2XU7A 3EI4B 3RN0D 3RSEC 2OIZA 3OKWA 3OKYB 4J0WA 2H13A 2PM9A 4ZOXA 1XHMA 4PBZA 2IWKA 2H3XA 3IIYA 4ZN4A 1A0RB 1Q47A 5H1MA 4BL0A 3ORVD 3JZHA 4MK0B 5EM2A 4QQEA 4PBYA 2I3TA 3NVQA 4PC0A 4XYHA 5GXIA 1YFQA 1NEXB 3C9CA 3CFVA 5EAMA 3T3PB 1TBGA 1SSLA 3OL2B 4PNKB 3EI1A 2I3SA 4CZXA 3V5WB 4J79A 2OVPB 3BWSA 3SMRA 3I8EA 4A11A 4BH6A 2MTAH 4I79A 3SJLD 4A7JA 2Z2NA 5FQDA 2VC2B 2H9LA 5IGQA 2YNNA 5B4WA 1PGUA 5FKTA 5CYKB 2OJYA 2P9SC 3K27A 4U7AA 3AH8B 3GFCA 3MZLA 3ZDZB 3PE7A 2AGXA 4L1QD 2H6KA 1B9XA 5FKSA 3RRMC 4CZVA 3I7OA 4D6VA 2IURA 4FAND 3F3FA 5C2WB 4WK2B 4R7AB 1GP2B 2AGYA 2QC5A 3DXKC 4A09A 4GZ8A 3IKOA 3SXTD 4UM9D 2HESX 3I7HA 3DWLC 4U1EI 5K1CC 5THAA 4Z7OB 2CO0A 2H9NA 1OMWB 5AMSA 4BUJC 5FXYA 4O1QD 2YMUA 3AL9A 3FRXA 3GREA 2YBAA 4A08A 4L3GD 5CXBA 2CE9A 1TYEB 1JJUB 4Z7NB 4CY2A 1XKSA 4E5ZB 4Z7QB 4O45A 5E6SB 2VDPB 5C2VB 4E54B 2P9KC 4X63B 4IMMA 5IGOA 5IJ8E 3I7PA 5H17A 5IC7A 2GNQA 1S4UX 4A2LA 3SVWD 4JD2C 5TEEA 4CY1A 2P9PC 3E0CA 3PXTD 1SHYB 3NVNA 2PM7B 2J56H 4WJKB 3AL8A 3MXXA 3NVXA 4A0BA 3C75H 4H5JA 3JB9L 3MZKA 2XYIA 4J86A 2UZXB 3JROA 4A2MA 3OKTA 4AEZA 2VDMB 3KRXB 4QL1A 2B5NA 2IUPA 3U4YA 3OTTA 2H47A 4A0AB 4LGNA 1XIPA 1JMXB 3IJ0A 5FKRA 4ZOZA 3K26A 3MKQA 1ERJA 5H14A 3I7LA 3N0EA 2OK4A 3FCUB 5AFU3 3N0DA 5HYNB 3EI3B 4O3TB 3VGZA 2I0TA 1OLZA 4ERQA 3P4FA 2HJ4A 1SQ9A 3DM0A 4FA4D 5I5IA 3BG1A 4JT6C 3VI4B 4JSXC 1MG2A 4GM9A 3IJCA 4J82A 2PBIB 3I7KA 4JT5C 4LG9A 4J8BA 4EWRA 3SLED 4Y7RA 4A09B 5FLXg 3MMYA 3V7DB 4GGDA 5EMLB 2IUQA 4X60B 4WK4B 2VDOB 3KRWB 1P22A 4CI2A 3JZNA 4GQBB 2XL3A 4GQ2P 4ERZA 4IA9A 1GG2B 2GC7A 1SQJA 5CXBB 2H6NA 5TF2A 5SXMA 5CXCA 3NIDB 2B5MA 4PSXB 3SFZA 2P9NC 2HXCA 3I2NA 4ES0A 4ZOYA 1RI6A 4CY3A 3RMZD 3B7FA 2OVRB 3I7NA 4WK0B 3C99A 3DSMA 3MKSB 4X61B 1GOTB 3EI2A 2OK6A 3JRPA 4AOWA 3EI4A 3I89A 3L4OD 3EWEA 4X3EA 3A0FA 4J8GA 2AH1A 2H68A 3UR4A 5A2Qg 4J77A 4ESGA 3UVMA 2VDKB 3FGBA 5JWZA 5GSAA 3VI3B 2CE8A 1U2VC 3ZE1B 3CIKB 5AJAA 3JZGA 3BG0A 1PEVA 3VH0A 2I0RA 2VDNB 5EMMB 4K3ID 2AGLA 3OL2A 4CY5A 1NR0A 1QNIA 4FA5D 3C5MA 2PM9B 2P9UC 2YB8B 3HFQA 5HE3B 3SHFA 5HQGA 4Z8LA 5FA5B 5I5JA 5EM2B 3NIGB 5EMKB 2CN3A 2HYEA 2P9LC 5CYKA 2I0SA 4J87A 5K19A 3PSCB 3UVKA 3RLMD 4JSVC 2H14A 3T3MB 2BBKH 5HE2B 3EI1B 5HE1B 3SN6B 5TDHB 2VDRB 2J55H 4UM9B 4ZOVA 4A11B 2IAAA 4JSNC 3ODTA 5EARA 4FA1D 4XEIC 1U8CB 3NIFB 4FB1D 3V9FA 3W15A 4J0XA 2H6QA 2W18A 3EMHA 3UVNA 1GXRA 4QT8A 4FWWA 4NSXA 4GGCA 3ZWLB 3DXMC 3IJ1A 3PXSD 3JAMg 3JPXA 3ZE0B 5GXHA
chains in the Genus database with same CATH superfamily
1R5MA 1FWXA 5HE0B 1TYEA 4QRJA 3QHYB 4J84A 4Z7NA 3J81g 5M5VA 4GGAA 4GQ1A 2H9PA 4E5ZA 4Z7QA 4FA9D 1N6EA 5E6SA 4GM3A 2VDPA 3SBRA 3K71A 2AQ5A 2J57G 1UOQA 4JHNA 4E54A 2JKXA 2CN2A 2Q7QA 3OW8A 5IJ7E 5KDOB 1C9LA 2HKMA 2IUVA 4J73A 3PXWD 3SWSD 3ZDXB 1U4CA 5I5MA 1H2XA 4CI8A 4JSPC 4A08B 4WJKA 1N6FA 5M5RA 3L4MD 3J80g 1L0QA 3VA6A 4BCBA 3EU7A 3PSLA 1TYQC 2CO0C 4RE5A 5C9ZB 2VDMA 2O9KA 4H5IA 4L3HD 2B4EA 2H9MA 2BCJB 2VDLB 1JOFA 2B5LA 4AMYA 4A0AA 4FAVD 3FCUA 3RFHA 3F3GA 4YVDA 1MG3A 2WQ8A 4O9DA 3EI3A 4LG8A 2G99A 3OKYA 3AL8B 4BP9A 4A0BB 2QXVA 5TEFA 2Z2OA 3VI4A 3GC3B 3IUNA 3CFSB 3IIWA 3QI0A 2IWFA 3ZDYB 4OWRA 2AGWA 5E6RB 2AGZA 5EAPA 4DNUA 2GC4A 3F3PA 4J81A 4PSWB 4OZUA 3UKUC 3IVMA 1MDAH 5M61A 4XYIA 5FKQA 4Y5RD 3ULEC 1E8NA 2VDOA 4N14A 4GM8A 4CI1A 2UZYB 5E6UB 2CNXA 3UKRC 2HJBA 4CI3A 2OVQB 3PVWB 4PXWA 3MVDK 4UM8B 1I2MB 2XL2A 3FM0A 4J78A 5HDBB 1K8KC 4L9OA 4JXMA 4FHLA 2AH0A 2YNOA 3SBPA 1QFMA 2XDWA 3ZE2B 3NIDA 4G56B 1UOOA 3FCSA 5GMKn 3O4HA 2XE4A 3RN1D 2P9IC 2VDQB 3RFGA 1VYHC 5EALA 3PVUB 4QAMA 3K6SA 4KFMB 2P26A 5EMJB 3UVOA 5IT9g 4WK0A 4O3UB 1T2XA 1JMZB 1PI6A 2HKRA 4TZ4A 2PM6B 2P28A 4DNWA 4K3JB 5M5TA 3IJEA 4UI9R 3AFCA 2YNPA 1B9YA 5CXCB 2QR5A 1PBYB 4GMBA 2Z2PA 2G9AA 4D0KA 4O02A 2VDKA 1YUKA 3VI3A 3SBQA 3EG6A 3I8CA 4HDJA 1BPOA 3SCYA 3ZE1A 4CC9A 1L5GA 1K32A 2TRCB 1N6DA 3DDUA 3UVLA 4CZYA 4ERYA 4AN1A 2EBSA 3EI2B 2XU7A 3EI4B 4JHPC 3RN0D 3RSEC 2OIZA 3OKWA 3OKYB 4J0WA 2H13A 3O4GA 2PM9A 4ZOXA 1XHMA 4O2WA 4PBZA 4BCDA 4RE6A 2IWKA 2H3XA 3IUMA 3IIYA 4ZN4A 1A0RB 1Q47A 5H1MA 4BL0A 3ORVD 3JZHA 4MK0B 5EM2A 3NIGA 4QQEA 5C92A 4PBYA 2I3TA 3NVQA 4PC0A 4XYHA 5GXIA 1YFQA 1NEXB 3C9CA 3CFVA 1M1XA 3T3MA 5EAMA 3T3PB 1TBGA 1SSLA 3OL2B 4PNKB 3EI1A 1GOFA 2I3SA 4CZXA 5M5SA 3V5WB 2VDRA 4J79A 4G1MA 4UM9A 2OVPB 3BWSA 3SMRA 3I8EA 4A11A 2QZPA 4BH6A 2MTAH 4I79A 3SJLD 3EQ9A 4A7JA 2Z2NA 5FQDA 2VC2B 1U8CA 2H9LA 3NIFA 5IGQA 2YNNA 5B4WA 1PGUA 5FKTA 5CYKB 2OJYA 2P9SC 3K27A 4U7AA 3AH8B 3GFCA 3MZLA 3ZDZB 3PE7A 2AGXA 4L1QD 2H6KA 3ZE0A 1B9XA 5FKSA 3RRMC 4CZVA 3MUOA 1VE7A 3IULA 3I7OA 4D6VA 2IURA 4FAND 3F3FA 5C2WB 4WK2B 4R7AB 1GP2B 4G1EA 4BCCA 2AGYA 2QC5A 3DXKC 2HU5A 4GZ8A 4A09A 3IKOA 3SXTD 4UM9D 2HESX 3I7HA 3DWLC 4U1EI 4WK4A 5K1CC 5THAA 4Z7OB 2JWGA 3IUQA 4L1MA 2CO0A 1QFSA 2H9NA 1OMWB 5AMSA 3ZDXA 4BUJC 5FXYA 4O1QD 2YMUA 3AL9A 1UTCA 3FRXA 3GREA 2YBAA 1GOHA 4L3GD 5CXBA 4A08A 2CE9A 1TYEB 2BKLA 1JJUB 4Z7NB 4CY2A 1XKSA 4E5ZB 1JTDB 4Z7QB 4O45A 1O6FA 5E6SB 2VDPB 5C2VB 4E54B 1VZ2A 2P9KC 2VDLA 4X63B 4IMMA 4MMXA 4BP8A 5IGOA 5IJ8E 3I7PA 1JV2A 5H17A 5IC7A 1A12A 2GNQA 1S4UX 4A2LA 3SVWD 4JD2C 5TEEA 1O6GA 2P9PC 3E0CA 3PXTD 1SHYB 4CY1A 3NVNA 2PM7B 2J56H 4WJKB 3AL8A 3MXXA 3NVXA 4A0BA 3C75H 4NAAA 4H5JA 3JB9L 3MZKA 2XYIA 4J86A 2UZXB 3JROA 4A2MA 3OKTA 4AEZA 2VDMB 3KRXB 2VZ1A 4QL1A 5E6RA 2B5NA 2IUPA 3U4YA 2VZ3A 3OTTA 1H2YA 2H47A 4A0AB 4LGNA 1XIPA 1JMXB 3IJ0A 5FKRA 4ZOZA 3K26A 3MKQA 1ERJA 2HU7A 1VZ3A 5H14A 3I7LA 2VDNA 2OK4A 3N0EA 3FCUB 5AFU3 4G55A 3N0DA 5HYNB 3EI3B 4O3TB 3VGZA 2I0TA 1OLZA 4ERQA 5E6UA 1C9IA 1GOGA 3P4FA 2HJ4A 1SQ9A 3DM0A 4FA4D 5I5IA 3BG1A 4JT6C 3VI4B 4JSXC 1MG2A 4UM8A 4GM9A 5HDBA 3IJCA 3EQ8A 4J82A 2PBIB 3ZE2A 3V4VA 3I7KA 4JT5C 4LG9A 4J8BA 4EWRA 3SLED 2VDQA 1K3IA 4Y7RA 4A09B 5FLXg 3MMYA 3V7DB 3GD1I 4GGDA 5EMLB 2IUQA 4X60B 4WK4B 2VDOB 3KRWB 1P22A 4CI2A 3JZNA 4GQBB 2XL3A 4GQ2P 4ERZA 1VE6A 4IA9A 1GG2B 2GC7A 1SQJA 3EQ7A 5CXBB 2H6NA 4MMYA 5TF2A 5SXMA 3MUNA 5CXCA 3NIDB 2B5MA 3KCIA 4PSXB 3SFZA 4AN0A 2P9NC 2HXCA 2EIDA 4AX4A 3I2NA 4ES0A 4ZOYA 1YR2A 1RI6A 5FFGA 3RMZD 3B7FA 2OVRB 4NBMA 4CY3A 3I7NA 4WK0B 3C99A 2JWHA 3DSMA 3MKSB 4X61B 1GOTB 3EI2A 2EICA 2OK6A 3JRPA 4NC4A 4AOWA 3EI4A 5C86A 3I89A 3K72A 3L4OD 3EWEA 4X3EA 3A0FA 4J8GA 2AH1A 3IUJA 2H68A 3UR4A 5A2Qg 4J77A 4ESGA 3UVMA 2VDKB 3FGBA 5JWZA 5GSAA 3VI3B 2CE8A 1U2VC 3ZE1B 2HU8A 3O4JA 3CIKB 5AJAA 3JZGA 4NENA 3BG0A 1PEVA 4DNVA 3VH0A 1H2ZA 2I0RA 4AMZA 3T3PA 2VDNB 5EMMB 4K3ID 2AGLA 3OL2A 4CY5A 1NR0A 1QNIA 3O4IA 3C5MA 4FA5D 4IRZA 3V4PA 2PM9B 2P9UC 2YB8B 3HFQA 5HE3B 3SHFA 2EIBA 5HQGA 4Z8LA 5FA5B 2VC2A 5I5JA 5EM2B 3NIGB 5EMKB 2CN3A 2HYEA 2P9LC 5CYKA 2I0SA 4J87A 5K19A 3PSCB 3UVKA 3RLMD 4JSVC 2H14A 4D9SA 3T3MB 3ZDZA 4MMZA 5M5UA 2BBKH 5HE2B 3EI1B 3ZDYA 1H2WA 5HE1B 3SN6B 1E8MA 5TDHB 3OF7A 2VDRB 2J55H 4UM9B 4ZOVA 4A11B 4WK2A 2IAAA 4JSNC 3ODTA 5EARA 4FA1D 4XEIC 1U8CB 3NIFB 4FB1D 3V9FA 3W15A 4Z7OA 4J0XA 2H6QA 2W18A 1UOPA 3EMHA 3UVNA 1GXRA 4QT8A 1E5TA 3IURA 4FWWA 4NSXA 4GGCA 2XZGA 2EIEA 3ZWLB 3DXMC 3IJ1A 3PXSD 5FFOA 3JAMg 3JPXA 3ZE0B 5GXHA
chains in the Genus database with same CATH topology
1R5MA 1FWXA 5HE0B 4QRJA 4J84A 3J81g 4GGAA 4GQ1A 2H9PA 4E5ZA 4FA9D 1N6EA 4GM3A 3SBRA 2AQ5A 2J57G 4E54A 2CN2A 2Q7QA 3OW8A 5IJ7E 5KDOB 2IUVA 2HKMA 4J73A 3PXWD 3SWSD 3ZDXB 1U4CA 5I5MA 4CI8A 4JSPC 4A08B 1N6FA 3L4MD 3J80g 1L0QA 3VA6A 3EU7A 3PSLA 1TYQC 2CO0C 5C9ZB 2O9KA 4H5IA 4L3HD 2B4EA 2H9MA 2BCJB 2VDLB 1JOFA 2B5LA 4A0AA 4FAVD 3RFHA 3F3GA 4YVDA 1MG3A 4O9DA 3EI3A 4LG8A 2G99A 3OKYA 3AL8B 4A0BB 2QXVA 5TEFA 2Z2OA 3CFSB 3IIWA 2IWFA 3ZDYB 4OWRA 2AGWA 5E6RB 2AGZA 5EAPA 2GC4A 3F3PA 4J81A 4PSWB 4OZUA 3UKUC 1MDAH 4XYIA 5FKQA 4Y5RD 3ULEC 4CI1A 4N14A 4GM8A 2UZYB 5E6UB 2CNXA 3UKRC 2HJBA 4CI3A 2OVQB 3PVWB 4PXWA 4UM8B 2XL2A 3FM0A 4J78A 5HDBB 1K8KC 4L9OA 4JXMA 4FHLA 2AH0A 2YNOA 3SBPA 3ZE2B 4G56B 5GMKn 3RN1D 2P9IC 2VDQB 3RFGA 1VYHC 5EALA 3PVUB 4KFMB 2P26A 5EMJB 3UVOA 5IT9g 4O3UB 1JMZB 1PI6A 2HKRA 4TZ4A 2PM6B 2P28A 4K3JB 4UI9R 3AFCA 2YNPA 1B9YA 5CXCB 1PBYB 4GMBA 2Z2PA 2G9AA 4D0KA 1YUKA 3SBQA 3EG6A 3I8CA 4HDJA 3SCYA 4CC9A 1K32A 2TRCB 1N6DA 3UVLA 4CZYA 4ERYA 2EBSA 3EI2B 2XU7A 3EI4B 3RN0D 3RSEC 2OIZA 3OKWA 3OKYB 4J0WA 2H13A 2PM9A 4ZOXA 1XHMA 4PBZA 2IWKA 2H3XA 3IIYA 4ZN4A 1A0RB 1Q47A 5H1MA 4BL0A 3ORVD 3JZHA 4MK0B 5EM2A 4QQEA 4PBYA 2I3TA 3NVQA 4PC0A 4XYHA 5GXIA 1YFQA 1NEXB 3C9CA 3CFVA 5EAMA 3T3PB 1TBGA 1SSLA 3OL2B 4PNKB 3EI1A 2I3SA 4CZXA 3V5WB 4J79A 2OVPB 3BWSA 3SMRA 3I8EA 4A11A 4BH6A 2MTAH 4I79A 3SJLD 4A7JA 2Z2NA 5FQDA 2VC2B 2H9LA 5IGQA 2YNNA 5B4WA 1PGUA 5FKTA 5CYKB 2OJYA 2P9SC 3K27A 4U7AA 3AH8B 3GFCA 3MZLA 3ZDZB 3PE7A 2AGXA 4L1QD 2H6KA 1B9XA 5FKSA 3RRMC 4CZVA 3I7OA 4D6VA 2IURA 4FAND 3F3FA 5C2WB 4WK2B 4R7AB 1GP2B 2AGYA 2QC5A 3DXKC 4A09A 4GZ8A 3IKOA 3SXTD 4UM9D 2HESX 3I7HA 3DWLC 4U1EI 5K1CC 5THAA 4Z7OB 2JWGA 2CO0A 2H9NA 1OMWB 5AMSA 4BUJC 5FXYA 4O1QD 2YMUA 3AL9A 3FRXA 3GREA 2YBAA 4A08A 4L3GD 5CXBA 2CE9A 1TYEB 1JJUB 4Z7NB 4CY2A 1XKSA 4E5ZB 4Z7QB 4O45A 5E6SB 2VDPB 5C2VB 4E54B 2P9KC 4X63B 4IMMA 5IGOA 5IJ8E 3I7PA 5H17A 5IC7A 2GNQA 1S4UX 4A2LA 3SVWD 4JD2C 5TEEA 4CY1A 2P9PC 3E0CA 3PXTD 1SHYB 3NVNA 2PM7B 2J56H 4WJKB 3AL8A 3MXXA 3NVXA 4A0BA 3C75H 4H5JA 3JB9L 3MZKA 2XYIA 4J86A 2UZXB 3JROA 4A2MA 3OKTA 4AEZA 2VDMB 3KRXB 4QL1A 2B5NA 2IUPA 3U4YA 3OTTA 2H47A 4A0AB 4LGNA 1XIPA 1JMXB 3IJ0A 5FKRA 4ZOZA 3K26A 3MKQA 1ERJA 5H14A 3I7LA 3N0EA 2OK4A 3FCUB 5AFU3 3N0DA 5HYNB 3EI3B 4O3TB 3VGZA 2I0TA 1OLZA 4ERQA 3P4FA 2HJ4A 1SQ9A 3DM0A 4FA4D 5I5IA 3BG1A 4JT6C 3VI4B 4JSXC 1MG2A 4GM9A 3IJCA 4J82A 2PBIB 3I7KA 4JT5C 4LG9A 4J8BA 4EWRA 3SLED 4Y7RA 4A09B 5FLXg 3MMYA 3V7DB 4GGDA 5EMLB 2IUQA 4X60B 4WK4B 2VDOB 3KRWB 1P22A 4CI2A 3JZNA 4GQBB 2XL3A 4GQ2P 4ERZA 4IA9A 1GG2B 2GC7A 1SQJA 5CXBB 2H6NA 5TF2A 5SXMA 5CXCA 3NIDB 2B5MA 4PSXB 3SFZA 2P9NC 2HXCA 3I2NA 4ES0A 4ZOYA 1RI6A 4CY3A 3RMZD 3B7FA 2OVRB 3I7NA 4WK0B 3C99A 2JWHA 3DSMA 3MKSB 4X61B 1GOTB 3EI2A 2OK6A 3JRPA 4AOWA 3EI4A 3I89A 3L4OD 3EWEA 4X3EA 3A0FA 4J8GA 2AH1A 2H68A 3UR4A 5A2Qg 4J77A 4ESGA 3UVMA 2VDKB 3FGBA 5JWZA 5GSAA 3VI3B 2CE8A 1U2VC 3ZE1B 3CIKB 5AJAA 3JZGA 3BG0A 1PEVA 3VH0A 2I0RA 2VDNB 5EMMB 4K3ID 2AGLA 3OL2A 4CY5A 1NR0A 1QNIA 4FA5D 3C5MA 2PM9B 2P9UC 2YB8B 3HFQA 5HE3B 3SHFA 5HQGA 4Z8LA 5FA5B 5I5JA 5EM2B 3NIGB 5EMKB 2CN3A 2HYEA 2P9LC 5CYKA 2I0SA 4J87A 5K19A 3PSCB 3UVKA 3RLMD 4JSVC 2H14A 3T3MB 2BBKH 5HE2B 3EI1B 5HE1B 3SN6B 5TDHB 2VDRB 2J55H 4UM9B 4ZOVA 4A11B 2IAAA 4JSNC 3ODTA 5EARA 4FA1D 4XEIC 1U8CB 3NIFB 4FB1D 3V9FA 3W15A 4J0XA 2H6QA 2W18A 3EMHA 3UVNA 1GXRA 4QT8A 4FWWA 4NSXA 4GGCA 3ZWLB 3DXMC 3IJ1A 3PXSD 3JAMg 3JPXA 3ZE0B 5GXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5M A;  1FWX A;  5HE0 B;  4QRJ A;  4J84 A;  3J81 g;  4GGA A;  4GQ1 A;  2H9P A;  4E5Z A;  4FA9 D;  1N6E A;  4GM3 A;  3SBR A;  2AQ5 A;  2J57 G;  4E54 A;  2CN2 A;  2Q7Q A;  3OW8 A;  5IJ7 E;  5KDO B;  2IUV A;  2HKM A;  4J73 A;  3PXW D;  3SWS D;  3ZDX B;  1U4C A;  5I5M A;  4CI8 A;  4JSP C;  4A08 B;  1N6F A;  3L4M D;  3J80 g;  1L0Q A;  3VA6 A;  3EU7 A;  3PSL A;  1TYQ C;  2CO0 C;  5C9Z B;  2O9K A;  4H5I A;  4L3H D;  2B4E A;  2H9M A;  2BCJ B;  2VDL B;  1JOF A;  2B5L A;  4A0A A;  4FAV D;  3RFH A;  3F3G A;  4YVD A;  1MG3 A;  4O9D A;  3EI3 A;  4LG8 A;  2G99 A;  3OKY A;  3AL8 B;  4A0B B;  2QXV A;  5TEF A;  2Z2O A;  3CFS B;  3IIW A;  2IWF A;  3ZDY B;  4OWR A;  2AGW A;  5E6R B;  2AGZ A;  5EAP A;  2GC4 A;  3F3P A;  4J81 A;  4PSW B;  4OZU A;  3UKU C;  1MDA H;  4XYI A;  5FKQ A;  4Y5R D;  3ULE C;  4CI1 A;  4N14 A;  4GM8 A;  2UZY B;  5E6U B;  2CNX A;  3UKR C;  2HJB A;  4CI3 A;  2OVQ B;  3PVW B;  4PXW A;  4UM8 B;  2XL2 A;  3FM0 A;  4J78 A;  5HDB B;  1K8K C;  4L9O A;  4JXM A;  4FHL A;  2AH0 A;  2YNO A;  3SBP A;  3ZE2 B;  4G56 B;  5GMK n;  3RN1 D;  2P9I C;  2VDQ B;  3RFG A;  1VYH C;  5EAL A;  3PVU B;  4KFM B;  2P26 A;  5EMJ B;  3UVO A;  5IT9 g;  4O3U B;  1JMZ B;  1PI6 A;  2HKR A;  4TZ4 A;  2PM6 B;  2P28 A;  4K3J B;  4UI9 R;  3AFC A;  2YNP A;  1B9Y A;  5CXC B;  1PBY B;  4GMB A;  2Z2P A;  2G9A A;  4D0K A;  1YUK A;  3SBQ A;  3EG6 A;  3I8C A;  4HDJ A;  3SCY A;  4CC9 A;  1K32 A;  2TRC B;  1N6D A;  3UVL A;  4CZY A;  4ERY A;  2EBS A;  3EI2 B;  2XU7 A;  3EI4 B;  3RN0 D;  3RSE C;  2OIZ A;  3OKW A;  3OKY B;  4J0W A;  2H13 A;  2PM9 A;  4ZOX A;  1XHM A;  4PBZ A;  2IWK A;  2H3X A;  3IIY A;  4ZN4 A;  1A0R B;  1Q47 A;  5H1M A;  4BL0 A;  3ORV D;  3JZH A;  4MK0 B;  5EM2 A;  4QQE A;  4PBY A;  2I3T A;  3NVQ A;  4PC0 A;  4XYH A;  5GXI A;  1YFQ A;  1NEX B;  3C9C A;  3CFV A;  5EAM A;  3T3P B;  1TBG A;  1SSL A;  3OL2 B;  4PNK B;  3EI1 A;  2I3S A;  4CZX A;  3V5W B;  4J79 A;  2OVP B;  3BWS A;  3SMR A;  3I8E A;  4A11 A;  4BH6 A;  2MTA H;  4I79 A;  3SJL D;  4A7J A;  2Z2N A;  5FQD A;  2VC2 B;  2H9L A;  5IGQ A;  2YNN A;  5B4W A;  1PGU A;  5FKT A;  5CYK B;  2OJY A;  2P9S C;  3K27 A;  4U7A A;  3AH8 B;  3GFC A;  3MZL A;  3ZDZ B;  3PE7 A;  2AGX A;  4L1Q D;  2H6K A;  1B9X A;  5FKS A;  3RRM C;  4CZV A;  3I7O A;  4D6V A;  2IUR A;  4FAN D;  3F3F A;  5C2W B;  4WK2 B;  4R7A B;  1GP2 B;  2AGY A;  2QC5 A;  3DXK C;  4A09 A;  4GZ8 A;  3IKO A;  3SXT D;  4UM9 D;  2HES X;  3I7H A;  3DWL C;  4U1E I;  5K1C C;  5THA A;  4Z7O B;  2CO0 A;  2H9N A;  1OMW B;  5AMS A;  4BUJ C;  5FXY A;  4O1Q D;  2YMU A;  3AL9 A;  3FRX A;  3GRE A;  2YBA A;  4A08 A;  4L3G D;  5CXB A;  2CE9 A;  1TYE B;  1JJU B;  4Z7N B;  4CY2 A;  1XKS A;  4E5Z B;  4Z7Q B;  4O45 A;  5E6S B;  2VDP B;  5C2V B;  4E54 B;  2P9K C;  4X63 B;  4IMM A;  5IGO A;  5IJ8 E;  3I7P A;  5H17 A;  5IC7 A;  2GNQ A;  1S4U X;  4A2L A;  3SVW D;  4JD2 C;  5TEE A;  4CY1 A;  2P9P C;  3E0C A;  3PXT D;  1SHY B;  3NVN A;  2PM7 B;  2J56 H;  4WJK B;  3AL8 A;  3MXX A;  3NVX A;  4A0B A;  3C75 H;  4H5J A;  3JB9 L;  3MZK A;  2XYI A;  4J86 A;  2UZX B;  3JRO A;  4A2M A;  3OKT A;  4AEZ A;  2VDM B;  3KRX B;  4QL1 A;  2B5N A;  2IUP A;  3U4Y A;  3OTT A;  2H47 A;  4A0A B;  4LGN A;  1XIP A;  1JMX B;  3IJ0 A;  5FKR A;  4ZOZ A;  3K26 A;  3MKQ A;  1ERJ A;  5H14 A;  3I7L A;  3N0E A;  2OK4 A;  3FCU B;  5AFU 3;  3N0D A;  5HYN B;  3EI3 B;  4O3T B;  3VGZ A;  2I0T A;  1OLZ A;  4ERQ A;  3P4F A;  2HJ4 A;  1SQ9 A;  3DM0 A;  4FA4 D;  5I5I A;  3BG1 A;  4JT6 C;  3VI4 B;  4JSX C;  1MG2 A;  4GM9 A;  3IJC A;  4J82 A;  2PBI B;  3I7K A;  4JT5 C;  4LG9 A;  4J8B A;  4EWR A;  3SLE D;  4Y7R A;  4A09 B;  5FLX g;  3MMY A;  3V7D B;  4GGD A;  5EML B;  2IUQ A;  4X60 B;  4WK4 B;  2VDO B;  3KRW B;  1P22 A;  4CI2 A;  3JZN A;  4GQB B;  2XL3 A;  4GQ2 P;  4ERZ A;  4IA9 A;  1GG2 B;  2GC7 A;  1SQJ A;  5CXB B;  2H6N A;  5TF2 A;  5SXM A;  5CXC A;  3NID B;  2B5M A;  4PSX B;  3SFZ A;  2P9N C;  2HXC A;  3I2N A;  4ES0 A;  4ZOY A;  1RI6 A;  4CY3 A;  3RMZ D;  3B7F A;  2OVR B;  3I7N A;  4WK0 B;  3C99 A;  3DSM A;  3MKS B;  4X61 B;  1GOT B;  3EI2 A;  2OK6 A;  3JRP A;  4AOW A;  3EI4 A;  3I89 A;  3L4O D;  3EWE A;  4X3E A;  3A0F A;  4J8G A;  2AH1 A;  2H68 A;  3UR4 A;  5A2Q g;  4J77 A;  4ESG A;  3UVM A;  2VDK B;  3FGB A;  5JWZ A;  5GSA A;  3VI3 B;  2CE8 A;  1U2V C;  3ZE1 B;  3CIK B;  5AJA A;  3JZG A;  3BG0 A;  1PEV A;  3VH0 A;  2I0R A;  2VDN B;  5EMM B;  4K3I D;  2AGL A;  3OL2 A;  4CY5 A;  1NR0 A;  1QNI A;  4FA5 D;  3C5M A;  2PM9 B;  2P9U C;  2YB8 B;  3HFQ A;  5HE3 B;  3SHF A;  5HQG A;  4Z8L A;  5FA5 B;  5I5J A;  5EM2 B;  3NIG B;  5EMK B;  2CN3 A;  2HYE A;  2P9L C;  5CYK A;  2I0S A;  4J87 A;  5K19 A;  3PSC B;  3UVK A;  3RLM D;  4JSV C;  2H14 A;  3T3M B;  2BBK H;  5HE2 B;  3EI1 B;  5HE1 B;  3SN6 B;  5TDH B;  2VDR B;  2J55 H;  4UM9 B;  4ZOV A;  4A11 B;  2IAA A;  4JSN C;  3ODT A;  5EAR A;  4FA1 D;  4XEI C;  1U8C B;  3NIF B;  4FB1 D;  3V9F A;  3W15 A;  4J0X A;  2H6Q A;  2W18 A;  3EMH A;  3UVN A;  1GXR A;  4QT8 A;  4FWW A;  4NSX A;  4GGC A;  3ZWL B;  3DXM C;  3IJ1 A;  3PXS D;  3JAM g;  3JPX A;  3ZE0 B;  5GXH A; 
#chains in the Genus database with same CATH topology
 1R5M A;  1FWX A;  5HE0 B;  1TYE A;  4QRJ A;  3QHY B;  4J84 A;  4Z7N A;  3J81 g;  5M5V A;  4GGA A;  4GQ1 A;  2H9P A;  4E5Z A;  4Z7Q A;  4FA9 D;  1N6E A;  5E6S A;  4GM3 A;  2VDP A;  3SBR A;  3K71 A;  2AQ5 A;  2J57 G;  1UOQ A;  4JHN A;  4E54 A;  2JKX A;  2CN2 A;  2Q7Q A;  3OW8 A;  5IJ7 E;  5KDO B;  1C9L A;  2HKM A;  2IUV A;  4J73 A;  3PXW D;  3SWS D;  3ZDX B;  1U4C A;  5I5M A;  1H2X A;  4CI8 A;  4JSP C;  4A08 B;  4WJK A;  1N6F A;  5M5R A;  3L4M D;  3J80 g;  1L0Q A;  3VA6 A;  4BCB A;  3EU7 A;  3PSL A;  1TYQ C;  2CO0 C;  4RE5 A;  5C9Z B;  2VDM A;  2O9K A;  4H5I A;  4L3H D;  2B4E A;  2H9M A;  2BCJ B;  2VDL B;  1JOF A;  2B5L A;  4AMY A;  4A0A A;  4FAV D;  3FCU A;  3RFH A;  3F3G A;  4YVD A;  1MG3 A;  2WQ8 A;  4O9D A;  3EI3 A;  4LG8 A;  2G99 A;  3OKY A;  3AL8 B;  4BP9 A;  4A0B B;  2QXV A;  5TEF A;  2Z2O A;  3VI4 A;  3GC3 B;  3IUN A;  3CFS B;  3IIW A;  3QI0 A;  2IWF A;  3ZDY B;  4OWR A;  2AGW A;  5E6R B;  2AGZ A;  5EAP A;  4DNU A;  2GC4 A;  3F3P A;  4J81 A;  4PSW B;  4OZU A;  3UKU C;  3IVM A;  1MDA H;  5M61 A;  4XYI A;  5FKQ A;  4Y5R D;  3ULE C;  1E8N A;  2VDO A;  4N14 A;  4GM8 A;  4CI1 A;  2UZY B;  5E6U B;  2CNX A;  3UKR C;  2HJB A;  4CI3 A;  2OVQ B;  3PVW B;  4PXW A;  3MVD K;  4UM8 B;  1I2M B;  2XL2 A;  3FM0 A;  4J78 A;  5HDB B;  1K8K C;  4L9O A;  4JXM A;  4FHL A;  2AH0 A;  2YNO A;  3SBP A;  1QFM A;  2XDW A;  3ZE2 B;  3NID A;  4G56 B;  1UOO A;  3FCS A;  5GMK n;  3O4H A;  2XE4 A;  3RN1 D;  2P9I C;  2VDQ B;  3RFG A;  1VYH C;  5EAL A;  3PVU B;  4QAM A;  3K6S A;  4KFM B;  2P26 A;  5EMJ B;  3UVO A;  5IT9 g;  4WK0 A;  4O3U B;  1T2X A;  1JMZ B;  1PI6 A;  2HKR A;  4TZ4 A;  2PM6 B;  2P28 A;  4DNW A;  4K3J B;  5M5T A;  3IJE A;  4UI9 R;  3AFC A;  2YNP A;  1B9Y A;  5CXC B;  2QR5 A;  1PBY B;  4GMB A;  2Z2P A;  2G9A A;  4D0K A;  4O02 A;  2VDK A;  1YUK A;  3VI3 A;  3SBQ A;  3EG6 A;  3I8C A;  4HDJ A;  1BPO A;  3SCY A;  3ZE1 A;  4CC9 A;  1L5G A;  1K32 A;  2TRC B;  1N6D A;  3DDU A;  3UVL A;  4CZY A;  4ERY A;  4AN1 A;  2EBS A;  3EI2 B;  2XU7 A;  3EI4 B;  4JHP C;  3RN0 D;  3RSE C;  2OIZ A;  3OKW A;  3OKY B;  4J0W A;  2H13 A;  3O4G A;  2PM9 A;  4ZOX A;  1XHM A;  4O2W A;  4PBZ A;  4BCD A;  4RE6 A;  2IWK A;  2H3X A;  3IUM A;  3IIY A;  4ZN4 A;  1A0R B;  1Q47 A;  5H1M A;  4BL0 A;  3ORV D;  3JZH A;  4MK0 B;  5EM2 A;  3NIG A;  4QQE A;  5C92 A;  4PBY A;  2I3T A;  3NVQ A;  4PC0 A;  4XYH A;  5GXI A;  1YFQ A;  1NEX B;  3C9C A;  3CFV A;  1M1X A;  3T3M A;  5EAM A;  3T3P B;  1TBG A;  1SSL A;  3OL2 B;  4PNK B;  3EI1 A;  1GOF A;  2I3S A;  4CZX A;  5M5S A;  3V5W B;  2VDR A;  4J79 A;  4G1M A;  4UM9 A;  2OVP B;  3BWS A;  3SMR A;  3I8E A;  4A11 A;  2QZP A;  4BH6 A;  2MTA H;  4I79 A;  3SJL D;  3EQ9 A;  4A7J A;  2Z2N A;  5FQD A;  2VC2 B;  1U8C A;  2H9L A;  3NIF A;  5IGQ A;  2YNN A;  5B4W A;  1PGU A;  5FKT A;  5CYK B;  2OJY A;  2P9S C;  3K27 A;  4U7A A;  3AH8 B;  3GFC A;  3MZL A;  3ZDZ B;  3PE7 A;  2AGX A;  4L1Q D;  2H6K A;  3ZE0 A;  1B9X A;  5FKS A;  3RRM C;  4CZV A;  3MUO A;  1VE7 A;  3IUL A;  3I7O A;  4D6V A;  2IUR A;  4FAN D;  3F3F A;  5C2W B;  4WK2 B;  4R7A B;  1GP2 B;  4G1E A;  4BCC A;  2AGY A;  2QC5 A;  3DXK C;  2HU5 A;  4GZ8 A;  4A09 A;  3IKO A;  3SXT D;  4UM9 D;  2HES X;  3I7H A;  3DWL C;  4U1E I;  4WK4 A;  5K1C C;  5THA A;  4Z7O B;  2JWG A;  3IUQ A;  4L1M A;  2CO0 A;  1QFS A;  2H9N A;  1OMW B;  5AMS A;  3ZDX A;  4BUJ C;  5FXY A;  4O1Q D;  2YMU A;  3AL9 A;  1UTC A;  3FRX A;  3GRE A;  2YBA A;  1GOH A;  4L3G D;  5CXB A;  4A08 A;  2CE9 A;  1TYE B;  2BKL A;  1JJU B;  4Z7N B;  4CY2 A;  1XKS A;  4E5Z B;  1JTD B;  4Z7Q B;  4O45 A;  1O6F A;  5E6S B;  2VDP B;  5C2V B;  4E54 B;  1VZ2 A;  2P9K C;  2VDL A;  4X63 B;  4IMM A;  4MMX A;  4BP8 A;  5IGO A;  5IJ8 E;  3I7P A;  1JV2 A;  5H17 A;  5IC7 A;  1A12 A;  2GNQ A;  1S4U X;  4A2L A;  3SVW D;  4JD2 C;  5TEE A;  1O6G A;  2P9P C;  3E0C A;  3PXT D;  1SHY B;  4CY1 A;  3NVN A;  2PM7 B;  2J56 H;  4WJK B;  3AL8 A;  3MXX A;  3NVX A;  4A0B A;  3C75 H;  4NAA A;  4H5J A;  3JB9 L;  3MZK A;  2XYI A;  4J86 A;  2UZX B;  3JRO A;  4A2M A;  3OKT A;  4AEZ A;  2VDM B;  3KRX B;  2VZ1 A;  4QL1 A;  5E6R A;  2B5N A;  2IUP A;  3U4Y A;  2VZ3 A;  3OTT A;  1H2Y A;  2H47 A;  4A0A B;  4LGN A;  1XIP A;  1JMX B;  3IJ0 A;  5FKR A;  4ZOZ A;  3K26 A;  3MKQ A;  1ERJ A;  2HU7 A;  1VZ3 A;  5H14 A;  3I7L A;  2VDN A;  2OK4 A;  3N0E A;  3FCU B;  5AFU 3;  4G55 A;  3N0D A;  5HYN B;  3EI3 B;  4O3T B;  3VGZ A;  2I0T A;  1OLZ A;  4ERQ A;  5E6U A;  1C9I A;  1GOG A;  3P4F A;  2HJ4 A;  1SQ9 A;  3DM0 A;  4FA4 D;  5I5I A;  3BG1 A;  4JT6 C;  3VI4 B;  4JSX C;  1MG2 A;  4UM8 A;  4GM9 A;  5HDB A;  3IJC A;  3EQ8 A;  4J82 A;  2PBI B;  3ZE2 A;  3V4V A;  3I7K A;  4JT5 C;  4LG9 A;  4J8B A;  4EWR A;  3SLE D;  2VDQ A;  1K3I A;  4Y7R A;  4A09 B;  5FLX g;  3MMY A;  3V7D B;  3GD1 I;  4GGD A;  5EML B;  2IUQ A;  4X60 B;  4WK4 B;  2VDO B;  3KRW B;  1P22 A;  4CI2 A;  3JZN A;  4GQB B;  2XL3 A;  4GQ2 P;  4ERZ A;  1VE6 A;  4IA9 A;  1GG2 B;  2GC7 A;  1SQJ A;  3EQ7 A;  5CXB B;  2H6N A;  4MMY A;  5TF2 A;  5SXM A;  3MUN A;  5CXC A;  3NID B;  2B5M A;  3KCI A;  4PSX B;  3SFZ A;  4AN0 A;  2P9N C;  2HXC A;  2EID A;  4AX4 A;  3I2N A;  4ES0 A;  4ZOY A;  1YR2 A;  1RI6 A;  5FFG A;  3RMZ D;  3B7F A;  2OVR B;  4NBM A;  4CY3 A;  3I7N A;  4WK0 B;  3C99 A;  2JWH A;  3DSM A;  3MKS B;  4X61 B;  1GOT B;  3EI2 A;  2EIC A;  2OK6 A;  3JRP A;  4NC4 A;  4AOW A;  3EI4 A;  5C86 A;  3I89 A;  3K72 A;  3L4O D;  3EWE A;  4X3E A;  3A0F A;  4J8G A;  2AH1 A;  3IUJ A;  2H68 A;  3UR4 A;  5A2Q g;  4J77 A;  4ESG A;  3UVM A;  2VDK B;  3FGB A;  5JWZ A;  5GSA A;  3VI3 B;  2CE8 A;  1U2V C;  3ZE1 B;  2HU8 A;  3O4J A;  3CIK B;  5AJA A;  3JZG A;  4NEN A;  3BG0 A;  1PEV A;  4DNV A;  3VH0 A;  1H2Z A;  2I0R A;  4AMZ A;  3T3P A;  2VDN B;  5EMM B;  4K3I D;  2AGL A;  3OL2 A;  4CY5 A;  1NR0 A;  1QNI A;  3O4I A;  3C5M A;  4FA5 D;  4IRZ A;  3V4P A;  2PM9 B;  2P9U C;  2YB8 B;  3HFQ A;  5HE3 B;  3SHF A;  2EIB A;  5HQG A;  4Z8L A;  5FA5 B;  2VC2 A;  5I5J A;  5EM2 B;  3NIG B;  5EMK B;  2CN3 A;  2HYE A;  2P9L C;  5CYK A;  2I0S A;  4J87 A;  5K19 A;  3PSC B;  3UVK A;  3RLM D;  4JSV C;  2H14 A;  4D9S A;  3T3M B;  3ZDZ A;  4MMZ A;  5M5U A;  2BBK H;  5HE2 B;  3EI1 B;  3ZDY A;  1H2W A;  5HE1 B;  3SN6 B;  1E8M A;  5TDH B;  3OF7 A;  2VDR B;  2J55 H;  4UM9 B;  4ZOV A;  4A11 B;  4WK2 A;  2IAA A;  4JSN C;  3ODT A;  5EAR A;  4FA1 D;  4XEI C;  1U8C B;  3NIF B;  4FB1 D;  3V9F A;  3W15 A;  4Z7O A;  4J0X A;  2H6Q A;  2W18 A;  1UOP A;  3EMH A;  3UVN A;  1GXR A;  4QT8 A;  1E5T A;  3IUR A;  4FWW A;  4NSX A;  4GGC A;  2XZG A;  2EIE A;  3ZWL B;  3DXM C;  3IJ1 A;  3PXS D;  5FFO A;  3JAM g;  3JPX A;  3ZE0 B;  5GXH A; 
#chains in the Genus database with same CATH homology
 1R5M A;  1FWX A;  5HE0 B;  4QRJ A;  4J84 A;  3J81 g;  4GGA A;  4GQ1 A;  2H9P A;  4E5Z A;  4FA9 D;  1N6E A;  4GM3 A;  3SBR A;  2AQ5 A;  2J57 G;  4E54 A;  2CN2 A;  2Q7Q A;  3OW8 A;  5IJ7 E;  5KDO B;  2IUV A;  2HKM A;  4J73 A;  3PXW D;  3SWS D;  3ZDX B;  1U4C A;  5I5M A;  4CI8 A;  4JSP C;  4A08 B;  1N6F A;  3L4M D;  3J80 g;  1L0Q A;  3VA6 A;  3EU7 A;  3PSL A;  1TYQ C;  2CO0 C;  5C9Z B;  2O9K A;  4H5I A;  4L3H D;  2B4E A;  2H9M A;  2BCJ B;  2VDL B;  1JOF A;  2B5L A;  4A0A A;  4FAV D;  3RFH A;  3F3G A;  4YVD A;  1MG3 A;  4O9D A;  3EI3 A;  4LG8 A;  2G99 A;  3OKY A;  3AL8 B;  4A0B B;  2QXV A;  5TEF A;  2Z2O A;  3CFS B;  3IIW A;  2IWF A;  3ZDY B;  4OWR A;  2AGW A;  5E6R B;  2AGZ A;  5EAP A;  2GC4 A;  3F3P A;  4J81 A;  4PSW B;  4OZU A;  3UKU C;  1MDA H;  4XYI A;  5FKQ A;  4Y5R D;  3ULE C;  4CI1 A;  4N14 A;  4GM8 A;  2UZY B;  5E6U B;  2CNX A;  3UKR C;  2HJB A;  4CI3 A;  2OVQ B;  3PVW B;  4PXW A;  4UM8 B;  2XL2 A;  3FM0 A;  4J78 A;  5HDB B;  1K8K C;  4L9O A;  4JXM A;  4FHL A;  2AH0 A;  2YNO A;  3SBP A;  3ZE2 B;  4G56 B;  5GMK n;  3RN1 D;  2P9I C;  2VDQ B;  3RFG A;  1VYH C;  5EAL A;  3PVU B;  4KFM B;  2P26 A;  5EMJ B;  3UVO A;  5IT9 g;  4O3U B;  1JMZ B;  1PI6 A;  2HKR A;  4TZ4 A;  2PM6 B;  2P28 A;  4K3J B;  4UI9 R;  3AFC A;  2YNP A;  1B9Y A;  5CXC B;  1PBY B;  4GMB A;  2Z2P A;  2G9A A;  4D0K A;  1YUK A;  3SBQ A;  3EG6 A;  3I8C A;  4HDJ A;  3SCY A;  4CC9 A;  1K32 A;  2TRC B;  1N6D A;  3UVL A;  4CZY A;  4ERY A;  2EBS A;  3EI2 B;  2XU7 A;  3EI4 B;  3RN0 D;  3RSE C;  2OIZ A;  3OKW A;  3OKY B;  4J0W A;  2H13 A;  2PM9 A;  4ZOX A;  1XHM A;  4PBZ A;  2IWK A;  2H3X A;  3IIY A;  4ZN4 A;  1A0R B;  1Q47 A;  5H1M A;  4BL0 A;  3ORV D;  3JZH A;  4MK0 B;  5EM2 A;  4QQE A;  4PBY A;  2I3T A;  3NVQ A;  4PC0 A;  4XYH A;  5GXI A;  1YFQ A;  1NEX B;  3C9C A;  3CFV A;  5EAM A;  3T3P B;  1TBG A;  1SSL A;  3OL2 B;  4PNK B;  3EI1 A;  2I3S A;  4CZX A;  3V5W B;  4J79 A;  2OVP B;  3BWS A;  3SMR A;  3I8E A;  4A11 A;  4BH6 A;  2MTA H;  4I79 A;  3SJL D;  4A7J A;  2Z2N A;  5FQD A;  2VC2 B;  2H9L A;  5IGQ A;  2YNN A;  5B4W A;  1PGU A;  5FKT A;  5CYK B;  2OJY A;  2P9S C;  3K27 A;  4U7A A;  3AH8 B;  3GFC A;  3MZL A;  3ZDZ B;  3PE7 A;  2AGX A;  4L1Q D;  2H6K A;  1B9X A;  5FKS A;  3RRM C;  4CZV A;  3I7O A;  4D6V A;  2IUR A;  4FAN D;  3F3F A;  5C2W B;  4WK2 B;  4R7A B;  1GP2 B;  2AGY A;  2QC5 A;  3DXK C;  4A09 A;  4GZ8 A;  3IKO A;  3SXT D;  4UM9 D;  2HES X;  3I7H A;  3DWL C;  4U1E I;  5K1C C;  5THA A;  4Z7O B;  2JWG A;  2CO0 A;  2H9N A;  1OMW B;  5AMS A;  4BUJ C;  5FXY A;  4O1Q D;  2YMU A;  3AL9 A;  3FRX A;  3GRE A;  2YBA A;  4A08 A;  4L3G D;  5CXB A;  2CE9 A;  1TYE B;  1JJU B;  4Z7N B;  4CY2 A;  1XKS A;  4E5Z B;  4Z7Q B;  4O45 A;  5E6S B;  2VDP B;  5C2V B;  4E54 B;  2P9K C;  4X63 B;  4IMM A;  5IGO A;  5IJ8 E;  3I7P A;  5H17 A;  5IC7 A;  2GNQ A;  1S4U X;  4A2L A;  3SVW D;  4JD2 C;  5TEE A;  4CY1 A;  2P9P C;  3E0C A;  3PXT D;  1SHY B;  3NVN A;  2PM7 B;  2J56 H;  4WJK B;  3AL8 A;  3MXX A;  3NVX A;  4A0B A;  3C75 H;  4H5J A;  3JB9 L;  3MZK A;  2XYI A;  4J86 A;  2UZX B;  3JRO A;  4A2M A;  3OKT A;  4AEZ A;  2VDM B;  3KRX B;  4QL1 A;  2B5N A;  2IUP A;  3U4Y A;  3OTT A;  2H47 A;  4A0A B;  4LGN A;  1XIP A;  1JMX B;  3IJ0 A;  5FKR A;  4ZOZ A;  3K26 A;  3MKQ A;  1ERJ A;  5H14 A;  3I7L A;  3N0E A;  2OK4 A;  3FCU B;  5AFU 3;  3N0D A;  5HYN B;  3EI3 B;  4O3T B;  3VGZ A;  2I0T A;  1OLZ A;  4ERQ A;  3P4F A;  2HJ4 A;  1SQ9 A;  3DM0 A;  4FA4 D;  5I5I A;  3BG1 A;  4JT6 C;  3VI4 B;  4JSX C;  1MG2 A;  4GM9 A;  3IJC A;  4J82 A;  2PBI B;  3I7K A;  4JT5 C;  4LG9 A;  4J8B A;  4EWR A;  3SLE D;  4Y7R A;  4A09 B;  5FLX g;  3MMY A;  3V7D B;  4GGD A;  5EML B;  2IUQ A;  4X60 B;  4WK4 B;  2VDO B;  3KRW B;  1P22 A;  4CI2 A;  3JZN A;  4GQB B;  2XL3 A;  4GQ2 P;  4ERZ A;  4IA9 A;  1GG2 B;  2GC7 A;  1SQJ A;  5CXB B;  2H6N A;  5TF2 A;  5SXM A;  5CXC A;  3NID B;  2B5M A;  4PSX B;  3SFZ A;  2P9N C;  2HXC A;  3I2N A;  4ES0 A;  4ZOY A;  1RI6 A;  4CY3 A;  3RMZ D;  3B7F A;  2OVR B;  3I7N A;  4WK0 B;  3C99 A;  2JWH A;  3DSM A;  3MKS B;  4X61 B;  1GOT B;  3EI2 A;  2OK6 A;  3JRP A;  4AOW A;  3EI4 A;  3I89 A;  3L4O D;  3EWE A;  4X3E A;  3A0F A;  4J8G A;  2AH1 A;  2H68 A;  3UR4 A;  5A2Q g;  4J77 A;  4ESG A;  3UVM A;  2VDK B;  3FGB A;  5JWZ A;  5GSA A;  3VI3 B;  2CE8 A;  1U2V C;  3ZE1 B;  3CIK B;  5AJA A;  3JZG A;  3BG0 A;  1PEV A;  3VH0 A;  2I0R A;  2VDN B;  5EMM B;  4K3I D;  2AGL A;  3OL2 A;  4CY5 A;  1NR0 A;  1QNI A;  4FA5 D;  3C5M A;  2PM9 B;  2P9U C;  2YB8 B;  3HFQ A;  5HE3 B;  3SHF A;  5HQG A;  4Z8L A;  5FA5 B;  5I5J A;  5EM2 B;  3NIG B;  5EMK B;  2CN3 A;  2HYE A;  2P9L C;  5CYK A;  2I0S A;  4J87 A;  5K19 A;  3PSC B;  3UVK A;  3RLM D;  4JSV C;  2H14 A;  3T3M B;  2BBK H;  5HE2 B;  3EI1 B;  5HE1 B;  3SN6 B;  5TDH B;  2VDR B;  2J55 H;  4UM9 B;  4ZOV A;  4A11 B;  2IAA A;  4JSN C;  3ODT A;  5EAR A;  4FA1 D;  4XEI C;  1U8C B;  3NIF B;  4FB1 D;  3V9F A;  3W15 A;  4J0X A;  2H6Q A;  2W18 A;  3EMH A;  3UVN A;  1GXR A;  4QT8 A;  4FWW A;  4NSX A;  4GGC A;  3ZWL B;  3DXM C;  3IJ1 A;  3PXS D;  3JAM g;  3JPX A;  3ZE0 B;  5GXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...