5I5JA

Shewanella denitrificans nitrous oxide reductase, reduced apo form
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
573
structure length
531
Chain Sequence
SAVVHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNRDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIANFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWRGRMLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
molecule tags Oxidoreductase
total genus 163
structure length 531
sequence length 573
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5jA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5jA01
1GS6X 4J77A 2IDSA 2I85A 4BL0A 1PI6A 2HZHA 4TXVB 2FQEA 7PCYA 1XKSA 4DPBX 3EU7A 2OV0A 3T71A 4GM8A 2VN3A 2PPCA 2XX1A 4HALA 4DPCX 4MK0B 4ZOVA 1XMEB 4FB1D 1AR1B 4ERZA 1ADWA 4J0XA 4NAJA 4G70B 2OIZA 5EM2B 4GM3A 1OE1A 2J57A 1N6EA 3FS9A 4AKOA 5GXIA 1F56A 1NTDA 3IJCA 3G5WA 3NJFA 4E9TA 3ABMB 2FWLB 1NR0A 3V9EA 2HKMA 1XIPA 5EARA 2Q5BA 3UVOA 3V5WB 4JD2C 4FA5D 3MZKA 4CI3A 2P9UC 4A08B 4YSSA 2JXMA 1PBYB 5EAPA 3AG2B 1RI6A 4P5RA 3U4YA 1BQKA 1TYQC 4LG8A 1X9RA 4NERA 4BWWA 3OKWA 4GY4A 2IDTA 2VM4A 2AH0A 3GFCA 4ERQA 3S8GB 5EMJB 1PZCA 4YVNA 4GMBA 1QHQA 2DYRB 3DSMA 1PLBA 2RACA 1E5YA 2EIJB 3NJMA 2VMJA 4RH4A 3FT0A 5F7AA 2YB8B 1ET8A 2XV0A 4GXFA 2PP9A 1JMZB 1QNIA 2UX7A 2BP8B 4DP1X 2P9LC 3DXMC 3I7KA 4IA9A 4J81A 3S8FB 3UVMA 4PBYA 4HDJA 1HFUA 1QLEB 1FWXA 4CI8A 2DYSB 4YSDA 2CBPA 1J9RA 3CZUB 3I7HA 4J86A 3A0FA 2PP8A 3V9FA 4Z8LA 1WA2X 1OMWB 1JVOA 3RFGA 2HRHA 2HLEB 2OK4A 4CZXA 3JROA 3FSZA 3JZHA 5IC7A 1MG2C 2H9MA 1RZQA 5THAA 2FQFA 1TEFA 2YNPA 5I6LA 2I3SA 3T6VA 5TEEA 4I79A 1JVLA 1XHMA 4K3JB 5EHFA 3BQVA 5HE3B 4PAZA 2BP0B 4AKPA 3JZNA 2IAAA 2UXGA 1ASQA 1BXAA 2FNWA 3OMAB 4GM9A 2R7EA 4JSXC 3NSDA 1KGYE 4J87A 1A3ZA 2HJBA 2OK6A 3I7OA 3H4HA 3I8CA 4ES0A 3WIAA 3QJVB 2XU7A 1L9QA 3IJ0A 2Z2NA 3X1BA 1WA0X 1PNCA 4GGAA 4AKQA 1M57B 3V9CA 1N68A 3NJNA 4GP5B 1M56B 2FT7A 3IN0A 3S3BB 1E65A 3IIYA 1HAUA 2N0MA 3NVXA 1ETJA 1NIBA 4GGCA 1SDDB 2O9KA 5H17A 1KBWA 2YAPA 3MBWB 4G7SB 3JTBA 2JFCA 3UADA 1B9YA 3CIKB 5B4WA 1VLXA 2YAMA 1RZPA 5I5JA 1ID2A 4PSXB 2XXFA 2I3TA 1WA1X 1IKOP 4F2EA 2HX7A 1OLZA 3SQRA 3RRMC 4X61B 1PY0A 3DIVA 2IH9A 3U25A 4LGNA 1T5KA 5B7MA 5EAMA 2VW7A 4ENZA 4WKXA 1GG2B 1SQ9A 2XL3A 3EI1B 2AVFA 3DWLC 3TBBA 4E9XA 9PCYA 3JRPA 2YXWA 4BH6A 3DM0A 4A0BB 1YLBB 2Q9OA 4EF3A 2P9PC 1A8ZA 3UVLA 3NJJA 1PZBA 4GQ2P 1YFQA 5CXBA 4QQEA 2I0SA 3EI4B 4BDVA 1AG6A 4YL4A 5B1BB 4Y7RA 1AS8A 2AGWA 2BW4A 3DXKC 4G7RB 4ZK8A 3CVDA 1L9RA 2XV3A 3DTUB 4HCIA 4F7KA 5I5IA 2G9AA 2H9NA 3UKRC 1RCYA 1KBVA 3I7PA 4KOCA 4A2EA 2HKRA 4QRJA 1ASPA 2W18A 1NZRA 3ASOB 5PCYA 2H6KA 4QKTA 2IURA 3AL8A 2GIMA 5I28A 3RN1D 4J84A 4CZYA 4YSEA 3EI2B 2YXVA 3IN2A 1NEXB 1K8KC 3BVDB 4BWTA 4A11A 5IGQA 4FHLA 2H13A 3JPXA 2BW5A 3F3FA 2YAFA 2BBKH 3SHFA 1AIZA 3KRWB 2BZCA 3HB3B 4PSWB 4A2HA 4XYHA 4CY1A 3L45A 3IIWA 1SFDA 2DWSA 3NSCA 4YSPA 4E9WA 3OL2A 4DP9X 3SWSD 3AFCA 3OKYB 4H5JA 4N4YB 3ULEC 3AY2A 1PF3A 3N0DA 4O9DA 4CC9A 2DWTA 2WO3B 4GP4B 3J80g 5FLXg 5H14A 4G7QB 5LDUA 1TBGA 3E0CA 3DKHA 4DP0X 1OOWA 3L4MD 3NJGA 1L9TA 4DP8X 2VSKB 3EWEA 5FKTA 5EM2A 2QDVA 5D4JA 3TBCA 2AGYA 5EMKB 2FQGA 5FKRA 5K1CC 4QL1A 4MFHA 3F3PA 1U2VC 3ODTA 4XYIA 2PLTA 3RMZD 3CFVA 2OJ1A 2GB2A 1A4CA 5FQDA 1GSKA 2CO0C 1ILSA 2HYEA 4A08A 4X3EA 1AAJA 3FGBA 3CG8A 2J56H 2OVPB 3X1NA 4HHGA 2QPDB 4H5IA 4L9OA 3SBPA 1SNRA 2CE8A 5HE0B 4A0AB 4UANA 1XB3A 2BHFA 5A2Qg 1BAWA 1WS8A 1ZPUA 1K32A 5AKRA 3C75A 1AZNA 4A66A 4O45A 4Q89A 3NSYA 2Z2OA 4CY5A 1TU2A 1W8EA 2H6QA 3OW8A 2XYBA 3K27A 1GR7A 3PXLA 1IBYA 1WAEA 2BP8A 5B1JC 1CURA 4CY2A 2Y69B 1OV8A 5C2VB 1XB8A 2DV6A 3HEIB 3BWSA 4E9VA 1AQ8A 5CXCB 4E54B 3UACA 3EF4A 2H3XC 2UZXB 2YBAA 2P9IC 3T9WA 2PCYA 2PPFA 3F3GA 1PNDA 3P4FA 4CY3A 4CI2A 5GMKn 3CVBA 2P80D 4K9JA 4ESGA 2AH1A 2PPEA 2CN2A 3W15A 5I6KA 4U1EI 1URIA 2UXFA 5B7EA 2PM9B 1OF0A 2AANA 5D4IA 3AZUA 4X4KA 1BQ5A 1A4AA 1KCBA 1OE2A 4BK5C 3CFSB 3FYIB 3IKOA 4F2FA 3I7LA 1NIFA 2XL2A 2H68A 4DP2X 2P9KC 2BWIA 1JERA 3EI3B 2HX9A 3ZIYA 1X9UA 1AZUA 1FFTB 5B1KA 4PBZA 4P5SA 3RSEC 4G56B 4CZVA 2BP0A 2FT6A 3NVNA 2QT6A 4A2MA 2B5MA 3SCYA 1PMYA 2VW4A 2XLLA 4BWUA 5B3SB 4PCYA 3AH8B 5IJ8E 3PXTD 4NB7A 6PAZA 4FAAB 3B7FA 4Q8BA 2B4EA 4A68A 3WKQA 2AGLA 3C99A 3FU9A 4HCFA 3K26A 4E9YA 2IWEA 3NVQA 4AI7A 1ET7A 1OE3A 2VSMB 1J5CA 4KOBA 3PXSD 1SDDA 4HZ1A 2UZYB 4GQ1A 1UATA 1RKRA 2GC4C 4CSZA 2ZWNA 1KYAA 2AGZA 3L4OD 4JKNA 1ZV2A 4KFMB 1AZRA 4KNTA 3X1FA 3N55A 4O1QD 4E9QA 3OL2B 7PAZA 1AZBA 2YAOA 3MXXA 1AACA 1E67A 3JT2A 3FSAA 3EG6A 4FWWA 2XXGA 2CO0A 3CDZB 4AX3A 2P9NC 3SXTD 1ET5A 1JZGA 1KDJA 4PC0A 3UVNA 5JWZA 3SN6B 4JXMA 3EI1A 2BZ7A 1PLAA 1SHYB 3C9CA 3PVUB 3NP3A 3QJQB 1AANA 4HCGA 2E86A 4A0BA 1JOFA 4IMMA 4E5ZB 2X88A 2IUVA 2IDUA 5AMSA 5CYKB 5I6OA 2PCFA 2YMUA 4ZOXA 3EH4B 4E9RA 4PXWA 3IE9A 3OD3A 5I5MA 3IBOA 4WTQA 1ZDSA 5B1JA 4CSPA 2BCJB 1KDIA 2MTAH 3EI4A 3PAVA 3MKQA 4OZUA 2I7SA 1R1CA 3EH3B 5F7BA 2H3XA 4J78A 3RN0D 3X2QB 4K3ID 4UI9R 4ZOYA 2XU9A 2OJYA 4AEZA 1OCZB 2Y1AA 2FQDA 3WNIA 4AZUA 2IDFA 4DPAX 3WKPA 4DP4X 1JZIA 1MDAH 2XYIA 3I2NA 3ZWLB 4CI1A 2YAQA 4HAKA 4Y5RD 2PP7A 2FTAA 3EMHA 2EINB 2IWKA 3KW8A 4YSUA 4N14A 2BWDA 1JZFA 1J9SA 3J81g 3MZLA 3AG3B 1N6DA 4FAND 3EI2A 5HYNB 4D6VA 4PNKB 4KNUA 4XEIC 4J79A 2HX8A 3SFZA 3OKTA 5C2WB 2HESX 2PM6B 2FJSA 3ASNB 3OM3B 5D4HA 2JKWA 3N2JA 1JMXB 2J55H 4J8BA 4A09A 4GGDA 4A09B 1N6FA 6PCYA 3OKYA 2XV2A 3MKSB 1TKWA 4YSCA 4M3HA 2EIMB 2CN3A 3I8EA 2EIKB 2ZOOA 3OMNB 4KO6A 3BG1A 1DYZA 5B1AB 2W88A 4L3HD 3FSWA 4L1QD 2OVQB 1NWOA 3UAAA 3T6ZA 1PGUA 1S4UX 3FQ2A 2GC4A 2AZUA 4YSAA 3X1EA 4LG9A 3KW7A 1SF3A 2WO2B 3H4FA 3UR4A 1OCCB 4W1TA 1ERJA 4A2DA 2Z2PA 3V7DB 2QC5A 3WI9A 2PPAA 1GXRA 2EILB 1NPNA 1NWPA 4GQBB 1TEGA 3KRXB 1SF5A 1ZIBA 1B9XA 3SMRA 4KO7A 1PZAA 2B08A 1AOZA 4J73A 5AZUA 4A7JA 1VYHC 2CAKA 4YVUA 4O3TB 5H1MA 2AGXA 5A7EA 1IBZA 5FC9A 1JZHA 1FA4A 3PXWD 4FA9D 4EWRA 3JAMg 5TK4A 2H6NA 2UX6A 2YQBA 3MX0B 5EMLB 2GC7A 2LLNA 5TDHB 3PE7A 2H5UA 5TF2A 3SJLD 3S3CB 4BUJC 3NYKA 4A0AA 5HE1B 1GY2A 1EZLA 5ANHA 2B5LA 1GOTB 2GSMB 2QXVA 4YSQA 1AS6A 3VGZA 4A2FA 1OCOB 3IJ1A 3PLYA 1A65A 2UXVA 1N70A 5FXYA 5I6PA 1CUOA 3C75H 2CCWA 1E30A 1J5DA 1JZEA 1I53A 1A0RB 4X60B 3JB9L 1ZDQA 5TK2A 1IUZA 4A67A 2H14A 5TEFA 2IH8A 2GNQA 2J56A 1EHKB 2PBIB 2HXCA 4X63B 3QQXA 2CUAA 4KO9A 4UF7C 5CXCA 3VA6A 4E54A 3OMIB 5E9NA 3S3DB 2B3IA 3I89A 3HFQA 2VW6A 2AFNA 1SHXA 1GS8A 2TSAA 2H47C 4FA7B 2PM9A 3VH0A 2AZAA 2VM3A 3UAEA 2IUPA 4QT8A 4L3GD 5I6MA 3T6WA 1CYWA 4J0WA 3NSFA 3UVKA 1J9QA 3GXUB 2J57G 2ZXWB 2WSDA 4TZ4A 2P9SC 3RLMD 2YNOA 3EI3A 3QJUB 4JSPC 5C9ZB 3C5MA 3FRXA 1NICA 2OCCB 5B7FA 2NRDA 3WNJA 4U7AA 1CYXA 1GYCA 1V54B 2BO0A 4JSNC 2TSBA 4QLWA 3H56A 1PEVA 4AOWA 3AG4B 3WG7B 5EMMB 1JOIA 1L9OA 2HRGA 1R5MA 3EH5B 3N0EA 3PSLA 5EALA 2P80A 1W6LA 1KV7A 4ZN4A 1P22A 3ORVD 3FQ1A 3NT0A 1CC3A 5FKSA 1NIAA 3ABKB 2YAHA 4KO5A 2YNNA 3QJSB 4YSRA 5AFAA 4BXSV 4J82A 4GP8B 1B3IA 1BYOA 1AG0A 3UABA 1XB6A 2W8CA 3T6XA 2DY2A 1L9SA 1WS7A 1NIDA 2I0RA 4O3UB 4JT5C 1MG3C 1JJUB 1PLCA 5I6NA 4JT6C 1NINA 3TASA 2R7EB 1JXFA 1U4CA 4J8GA 4JHVA 2TRCB 3TA4D 3ZX1A 5IY5B 1SQJA 3FU8A 1GS7A 3RFHA 3AL9A 5GSAA 4NSXA 5PAZA 2EBSA 3QJRB 3OQRA 1HAWA 3CDZA 1BXVA 4GYBA 1NIEA 2UXTA 2I7OA 2H9LA 5GXHA 4JSVC 3FQYA 1L9PA 2GHZA 3JZGA 2GC7C 2PM7B 4N8UA 2X87A 3AG1B 3OTTA 2H9PA 4D0KA 4ERYA 3GDCA 1PCSA 2IDQA 4E5ZA 4YVDA 2QDWA 3NJIA 5CYKA 3UKUC 2IUQA 5AFU3 3AW5A 3SLED 3PVWB 1JZJA 4JHUA 2HXAA 4UAHA 3RYMA 4FA1D 2GI0A 3SVWD 3IEAA 4DP5X 1J9TA 2AQ5A 4FA4D 3QJTB 3EHBB 1BQRA 5KDOB 2GBAA 4FAVD 1JXGA 3FYEB 3FPXA 1GP2B 1ASOA 2OVRB 4OWRA 2IWFA 5IGOA 4YSTA 3ZBMA 5FKQA 1NDTA 4HIPA 2H47A 1BYPA 1GW0A 1Q47A 4L0PB 2XUWA 5I26A 3ZDWA 2ZONA 3ABGA 5AJAA 2MTAA 4KNSA 1NPJA 1KCWA 5K19A 3NP4A 3PAUA 4DP6X 1W6WA 8PAZA 3MMYA 4GZ8A 5CXBB 2FT8A 4BDVB 3NJKA 5IJ7E 3FSVA 1BXUA 2A3TA 1OCRB 2XVBA 2CNXA 3PPSA 4YSOA 1PAZA 4E9SA 1MDAA 1ZIAA 1SJMA 3SBQA 3PAZA 1BEXA 3QPKA 5HE2B 2CALA 5IT9g 1JXDA 3X1GA 4G72B 1DZ0A 2I0TA 3PSCB 1AS7A 2CE9A 3AL8B 3I7NA 1GY1A 2J5WA 3BG0A 1AZCA 2YARA 2CJ3A 2MRYA 1MZZA 3UGEA 2YAEA 3FPYA 4DP7X 2XX0A 3ABLB 3CVCA 3D12B 3SBRA 4G71B 2Q7QA 1E5ZA 1SHWA 3NJHA 4M4RB 4W9ZA 1MG2A 3NJLA 4A2LA 1M9WA 2XWZA 4HHWA 4A11B 2PPDA 3ERXA 1A4BA 3GYRA 3GREA 4R7AB 1L0QA 1MZYA 2HJ4A 2QPEB 3FU7B 4ZOZA 1MG3A 2J55A 1ILUA 1V55B 3FM0A 3FU7A 1IC0A 3TU6A 1SFHA 5FA5B 2G99A 4A2GA 4BXVA 5SXMA 5HQGA 1V10A 3PCYA 2B5NA 2IAAC
chains in the Genus database with same CATH superfamily
3R18A 4PJ8B 5C1MB 3IUJA 1BVLB 4LIQL 3HJ0A 3PNWA 5ESVB 2HU8A 2AJYL 5AVTB 4IBUA 4GW1A 3ATEA 4XGZA 2VDRA 3HVDA 1ULVA 4IIQC 2ZSVA 4M5ZL 2GJPA 3SYAA 2DTSA 3ULUH 2ZX9A 4JGMA 1NTDA 3E2HC 4CBPA 1CDGA 2IV9A 4JFFA 2Z91B 4GRLA 4X9IA 2DWDB 5HY9A 4GRWB 5KSAB 3UYOD 2IBZX 2QVFB 3UVOA 4PFEA 2XPGA 2UV3A 1PBYB 4XAKD 1DJXA 4DW2H 3L9RB 1VGEL 2X2UA 4U1NB 2BVOA 5FHAL 5E8PB 4XCEB 3VXMA 3GFCA 2G4EA 3QPXL 5EIVA 1M2VB 3B8SA 1FRGL 3X13A 4ONGH 2YB8B 4LRIC 4HJTA 1J10A 4WY7L 3KCWA 3SDCB 1AZVA 2UX7A 3BC9A 2ITCB 2VH5H 3FULA 1QTSA 4G8GB 4JPWH 5GS1C 5ABZA 4FNLL 4PBYA 4Y16A 4R8WH 3FW6A 4MX7B 3ZKQD 4JKLA 3T2NH 2AJSL 1MCNA 4I1PA 3MLTB 3N40P 2W0KA 2B8OT 2PP8A 2VLRB 1IAOB 4NZRH 5E99L 3RRQA 4ANVA 4Z77B 3EFDH 1YQVH 3MRGB 4YHPB 3US0A 2HRHA 2PYED 2IPUG 2XWDA 2LT9A 4GEJA 1S7WB 4BELD 2O5YL 3FU3A 2FQFA 1X9QA 4QD2E 3RVTC 1I8MB 3QFDA 1QX1A 2BSBA 2X0UA 1UJTA 3L5XH 1OM3L 3T04D 1X5HA 3SDDA 2PXYB 4U0RC 3FBKA 5I71B 2LV4A 5L2KB 1ROWA 2VSDA 4QIRA 4JFDB 4TLSA 5FFOA 3SBWA 4ZOCA 2VC2A 4QR7A 2FNWA 3MV7A 4E2OA 2X3AA 4CDGC 5KN5A 1DQDL 3H54A 4OZFG 3TEUA 4ZUSA 3CVHH 1CYGA 3S48A 1T0NA 3HG2A 1UM4L 2CJTA 4L4VE 5EORL 1UD4A 1EHAA 1AI1L 3NJNA 1M56B 4F2ME 3IKCB 1TTRA 3U6RA 4CMHB 5GGTA 2D4FA 2ZXEB 4Z7OA 1Z3GL 1NBZA 4AENA 2WXGA 3QNFA 5B4WA 4U1JA 4CILA 4CSTA 2ENPA 1N5AB 3O3BA 2LU4A 4XPAL 5DYOA 3PV6B 2QQKL 2Y36L 4MJ5A 4MSWB 4P2OD 2X4UA 1ED3B 2EDDA 4X61B 4O2EB 4DTGH 5T1DL 4LGNA 1T0OA 3O4LB 1BQUA 1UZ8B 2R1YA 2IPKA 1U8NB 4U7MA 2C34A 3DWLC 5L4IA 4WI6A 1YLBB 3LYRA 1CGSH 1YAZA 1U92B 2D03H 1WBYB 1Z9MA 3TN0C 3T3MF 5IFJA 1R3JB 2I0SA 4NQED 3H1ZA 5F6HI 4XMTA 3PGFL 5LG1A 2XNAB 5A6LA 3BEVB 2E8ZA 4G7VH 3WBDA 1EUTA 1JK8A 2H9NA 3ZGIA 1VE6A 5AOJA 1IGJA 4PJ8D 2X53A 1K8IB 3V4PB 2H9GB 4AC4A 5D6DA 3RL2A 3VGAB 1SMAA 1NZRA 3HR6A 4W93A 5CNHA 4RWYL 5KSVA 2PO6B 5I28A 2MCMA 4HIEB 3CHXA 1I9IL 3LIZA 3RN1D 1U91A 3KCPA 4Q58C 3G08A 1KGXA 2A6KB 2K4WA 1P2CB 5EBLB 1J0KA 4YXHL 5J13B 3NEOA 4KXAA 1USZA 2P8LA 1UCBL 2AJUL 2L4OA 5CJOL 2B9AA 3BIAX 3DBXB 5ETUB 1BG1A 1FCCA 1DP0A 3KH3A 4PRNB 4PW9A 2HU7A 3ZDXA 2WXJA 5AAMC 2B14A 1QR1A 3OKYB 3AT9A 1HCVA 4N4YB 1FIEA 2XTSA 1YNLL 3FQRA 2WJ5A 5IVZA 5GIRB 5L9DL 3NIFA 4DEWA 2FX9L 4OKVA 3RQ3A 5LDUA 4NRZB 4BKLA 3L4MD 3SDAA 3UTZB 2YMTA 5HYEA 2DM3A 3DO3A 2EDKA 3KLLA 4M7ZB 2LVEA 2XG4A 1AQKH 1GIGL 3SDCD 1M7IA 4G8GD 5FKRA 5K1CC 5EUKB 3OPZL 5I2IB 3MUOA 4X6BB 3GIZH 4X4XB 3VVVA 1A4CA 3GMMA 3BPLB 3W0WB 4EKXA 2G3NA 2A77H 1S7XA 2VLRD 3F5WB 3IJSB 1NGYB 3MRLB 4O9HL 1JGEB 5DD0L 1DQJB 1VFAB 1FIGH 4P59L 1C9IA 3EYQD 2WWNA 2JELL 3FF7A 4GXVH 5ENWB 3BWUC 4DPRA 2YJQA 4RMRA 4RE5A 4AQEB 3O3DA 4NZTL 2AGJH 3GLEA 3LHAA 2PXYD 3MJ9L 1MWAL 5L2KD 1HWGB 2GHWB 4JFDD 1SJEA 1T7YA 4NO3B 1CD8A 3CX5K 3Q0HA 3SKOA 1O7DC 3ZMRA 5IMLA 2DQCL 4WSJA 3NACH 2LFGA 3VJ6A 4S0TD 2Q8BL 4FD0A 1YPZB 5E1AB 3C5JA 1RZGB 3BUYB 3FHAA 4KXZH 5F0LB 4P5KA 5L6YH 4DO5A 5TFSH 3RGVA 4U31A 4OGYH 4L1TA 3DXAB 2PCPA 3U2SA 1XVSA 1IGYA 1A9EA 3RSEC 5D2LB 1N3NA 1DR9A 1MHHA 2MTPA 4PB0L 4OCYL 1RVFH 2EABA 1AMXA 1E5BA 2CMRH 2OMBA 1RJCA 1TR7A 4PCYA 3O4LD 1TITA 3RFZA 1WISA 4P9HL 1MFEH 4A68A 4K2UL 3SCMC 3DX6A 1OF2A 4AQ1B 5LG6A 3B7YA 4YIQA 1J5CA 1WC7B 1Q72H 3L3JA 1NQBA 4KOBA 3SZ6A 5DFVD 3U1PA 4F33A 5EAPA 2ZWNA 4F3FB 4JPIB 3N55A 4NDMB 3RDTC 3ZKSD 2HT2C 4LF3A 4UILH 3ZO9A 3U4BL 4LVOB 4PD4J 2D0HA 1AZBA 5DD6B 1HZKA 4MS6A 4QHUB 2QFRA 3ECBB 3O6LL 4JLRB 2GUYA 4JL1A 4AX3A 4U3XA 5TH2B 3R06A 4FMKA 5TTRA 2WLZA 4IIQB 2PO6D 4PJBF 4M6AA 4PTTA 4TVPD 2BZ7A 2ZXBA 2OMWB 5MENA 4Z8FL 1SQ2N 2QMJA 2DQHL 3ARZA 3ARUA 3UTTA 4L2LA 4AVIA 1KCSH 2A0LC 3T09A 2BCJB 1PZSA 1UM5L 3MKQA 1A9VA 4KV5F 3FU0A 1IE4A 3IKKA 3RUGE 2ADGA 1RAMA 4X5WA 1J0ZA 3X2QB 3QRGH 3K91A 4WFFE 4EBQH 3IJ8A 4ZOYA 3V6BR 3MMEA 3S35H 1CD1B 1K3ZA 2IDFA 2VDOL 5ICUA 2NXZC 3SPHA 1JPSH 1LK3H 2ZAIA 4MNGA 1W16A 4CKVX 4EAEA 3L3OC 2B4CC 5GS1B 3GK8H 1CTOA 4PEEA 4ZX5A 3UZVA 2OXHA 3PQYA 3AGWA 3MUNA 2A4ZA 2VZVA 5C8JB 3G6JB 3VXUB 4YHMH 3W9DB 3JZYA 2JKWA 3L95B 3N2JA 1WFIA 3GIVA 4GGDA 3W0WD 2I27N 4XWGL 1QW9A 2OW6A 4MQ7B 5EU6E 1AGFA 2GK0A 1FYTB 5DQ9B 2XG5A 1T4KA 3GDBA 3U7WH 4ADIA 5K9QG 3MO1B 3VFWB 1XF4B 2EIBA 1LO0H 5B1AB 3CN3A 4Y1AA 4PH8A 2OMVB 5D5ME 3S36H 3BQUC 3D69B 4XAWL 4YSAA 3MNWB 1T1YA 1MJJA 2QV4A 4U6VL 4L4VA 4WV1C 1OCCB 4FQJL 4W1TA 1KSRA 1PKQA 2CBMA 3HBZA 4RNRA 4TVUA 3RWEB 4X7EC 3N44B 1CXEA 3HE6B 3B1UA 1KTCA 3FUDA 4Y1TA 3O3UN 4WI5A 3PJNA 3TJHD 1AOZA 3B83A 2R56L 2Y5TA 1TZIA 2GI7A 1FZMA 4XI5D 5CBAB 4UQCA 5KSBE 5F21B 4CW1B 1J1XH 1RK0B 3X12B 4PGEA 1AGBA 3PE7A 1SXSA 4F15B 5E03A 3NYKA 4OVUA 4OVVA 3PGCA 4P23A 5ANHA 4CADA 4FMVA 4YSQA 2E7CA 5F1OB 4A2FA 3ZZQA 4B3EA 3OMZA 1AGCA 2P7TB 4HIQA 4AX4A 3ARFD 1A65A 1HZHH 3DXAD 5GRVL 5FXYA 1JGDB 1JZEA 1J5DA 5D7KD 3H0TB 3T77A 5AW0B 4MD5B 3WL9A 3F7YA 2JXMB 4YH6A 3M7FB 1CE1H 3ESVF 4NC2B 3DMMC 3FT2A 4NM8H 2UZXA 3QI0A 2G3XA 2WBWB 2DIEA 4B27A 5DJYB 3ZDYB 4QXUL 1FL6B 2PM9A 1ETZA 4ZW5A 2B2XH 1KXQE 3BAXA 4C83A 1CYWA 4Y4FB 3GBMH 1OAUH 2HKAA 3R1GL 1O6SB 2HJKB 2VDQA 2CIKB 3LEYH 2CXKA 3WNJA 2FLRT 1MY5A 4FI6A 4F24A 5CCGE 5C9KA 2GJ6B 1TZ8A 2Y7QB 1VZHA 2XJLA 1SEBA 2CRZA 3D18A 1QPPA 5CEZH 1JYXA 4ERZA 1I1AC 1KIQB 1T21A 2GTWA 3QFJB 3TFKC 2YK1H 3K6IA 3QH3B 1NFKA 2YQ3A 1P84J 1U8QB 1YSOA 5FW6A 1CXKA 4PJDF 3WUZA 4DVRH 2PW1A 5AFAA 4P49A 3IYLW 4GP8B 4MXVE 1AG0A 4DNVA 5T3XH 5LNGA 3T8XB 2UZYA 2J1XA 3O4OB 4HWUA 4XP4H 4IKKA 1GRWA 4QRSA 5IQNA 2V0AA 1B2YA 4GQZA 1H9VA 4QNPF 3HZVB 2GIXA 3EGDA 2KZKA 3RWJA 1HAWA 1NDGA 1KIPA 4KJQC 3CXFA 2VABA 3GKZA 1ML0A 5FKAB 5LKNA 4OJAA 3OZ9H 2ZCKH 4N8UA 2H32H 5HHQB 2HFEB 2FYYB 4H5SB 4X5XA 5DEFB 1HDMB 3S4SB 3O2WL 4IK6A 4F93B 2V2TA 4OGAC 4Z7UA 5EOCH 4YWGL 3RYMA 2FEDC 3VD2A 1D5BB 2HFFB 3WHE0 1G0YR 3VXUD 5IB2A 3K6OA 3L3IB 4FA1D 4YHKH 4FDWA 3VXSE 4ZTEA 4AMWA 3ZDZB 3RVVC 3TGXA 4JZJB 4ABWA 3QUKB 3UZQA 1CFVL 2AXHA 1FYTD 3ZBMA 5DMGC 2ILLA 1ZLSH 4BCYA 1I85A 1FO0H 3RVTD 1V8HA 4R4BA 4LCWD 3NABL 1PAMA 4PP1C 4UAOC 3ETSA 5C09B 4GUPB 1JL8A 1P4LA 3WNNA 1PJWA 5JYLA 4PJXF 1U4FA 1SOQA 4BBWA 4G8FA 4RAUA 4RMQA 3OC8A 3BOVA 3SBQA 3HE6D 3AY4C 2W65B 3W5MA 1GHFH 4O4YH 2X4NB 5DUJA 4DZBB 5I23A 2YUZA 5GJTL 1BFVL 4LE8A 1S9WA 3ESMA 1I8KA 3GSQA 2DMGA 1ZEAH 3DHPA 4LSTL 3BGAA 5GGVL 5IZ7A 1A4BA 1MZYA 2LLLA 4XZUA 1ANUA 2X4RA 3NIDB 3KM1A 4L5FL 1OT4A 1V55B 5IF0A 1CS6A 2OYPA 5AOZA 1FZKA 3QJHB 5ID1A 4GUOA 2G99A 1S7TB 5AKSA 1SUHA 4PRIA 3OL2B 3K74B 2DQFB 1NCWL 4ELME 2V7HB 4J1UA 1H2ZA 2FQEA 5JW4N 1RJLA 2I07A 4MNQA 1N4XL 4PWKA 4AYBA 1ZKAA 2P43B 4OZIE 4YHZH 1H19A 2SEBA 3HFML 5E95B 1ADWA 1WBXB 3EJYC 4AQAA 4QUOA 4X6EB 5D6CB 1KELH 4A7QA 4IBLT 4Y4FD 4AKOA 2Y2YA 4IRJB 4QO1A 4F37F 4PJAF 1XIPA 3QIWB 2W38A 5HYJA 3FO1A 4PY8J 3M8OH 5D7IA 3AAZA 2GJ6D 3RWFB 3L4ZA 3K6SB 3ZL4L 1MF2H 3QFJD 1T2XA 5D1ZA 9CGTA 2HA1A 4K9EC 4NERA 3CFKB 4CBZA 3OB0H 5IW6B 3Q5YA 4I89A 1WE5A 2EIJB 3UAJA 2BY0A 3IDUA 5BRZD 4O2CB 4FQQB 4LAQH 1RU9H 3GM8A 3S8FB 1G7QA 4MD4B 1X5AA 1A1OA 1M1XA 1QLEB 3CPLA 5IM7B 1ZGLB 2CBPA 3PWLA 1IKFL 1RZ7H 2IQ9H 5F3BA 2XFGB 4DOHE 1RJYB 4POUB 2IGTA 2F53E 3JZHA 2XPZA 1MG2C 5DCCA 4WNQA 4R7DA 3KH4A 4KI5E 5AW6B 1V7NL 3MV9B 5CEXA 4XC3L 3B9EA 4UTAA 3THMH 4I18B 4DKTA 3C09C 4XP1L 3GRWH 2AKRA 4WNJA 1QSEA 3FQUA 3C6SA 3VVWA 2UXGA 1BXAA 2NT0A 4ZX6A 4HUCA 4YK4C 1OB1B 5IB3B 2K6YA 4K0OA 1CK0H 1KC5L 1MIML 1A6ZB 1WD8A 5CU5A 2FJUB 1X5GA 3V9CA 4G9FE 4HWNA 1DLFL 2JCCE 3NFNA 2AXJA 4JN1H 2AMGA 4U1MA 2OCJA 3AWFA 4UQ2B 1JNNL 1F97A 3DHUA 4PJFF 3DO7A 3EOTL 5D1XE 3CIKB 5HYQA 1ID2A 4UT6L 3UIZA 1OAXL 5IROC 3ZSTA 5GGQL 1IL1A 1NCHA 3IDYC 1U95A 3ORJA 4GKLA 4FNSA 2FJFA 3VQLA 1JCVA 3F04A 3VI3B 4TSAH 4RX4A 9PCYA 3OKMA 3K71A 4TUOA 4X2UA 5KG9B 2QV2A 3LOWA 1XGRB 5I75C 2D8KA 3I50H 1BVKB 3U4EA 3Q5TA 2QL1A 4AUJA 1U8MB 4X9FA 4XNMA 3VFUB 1RPQA 2V5YA 5CIPA 1XCTB 2BW4A 2EZ0D 3DMMB 4HF5L 4M03A 4L3CA 4PJ9A 4P2QB 1LEIA 2R0LL 2IBZY 2OL3B 4JFOA 1G7MA 4KKQA 1RUQH 1IFHL 3I7PA 3FRUA 3A6OA 3CFJA 4AM0Q 1FNEB 2EDFA 4N26A 4OZGB 3L08A 4Y8AA 4J6IA 3FUNA 1RHFA 1UWYA 2C7UB 4YO0A 2WOYA 2YXVA 4XN9A 4X6CB 4IGBC 3MRCB 3RDTD 1TVBB 5AW2B 2IPUK 2KYIA 2R0ZL 1II4E 2CJSA 4B7IA 4IRJD 4XAKE 5D8JL 4YZFE 2B77A 2J1ZA 3QIWD 1L9NA 4FFVD 2DWSA 3PWNB 4HZAA 4MMYB 5E0QA 2E7LA 3UYPB 5K39B 3AFCA 4EQ2A 1MFNA 4FQLL 4YDVA 2DWTA 2C3WA 4MDJA 3AQXA 1LYQA 1X9LA 3C60C 1ZRUA 2ICCA 3BUPA 4UV7H 3MRPB 4NQCB 4UYPA 2JQMA 4DP0X 2YS4A 3OKKA 2WUCL 4FHKA 5EU7C 4NKMB 4GG6E 3BT0A 3ULVE 2A0LD 4PJEB 4GS7B 3TA3B 4NCC1 3WFCL 3G5XB 4R4ND 5E6IA 2VWEE 4MFHA 3F3PA 4M5TA 1NLBH 5FQDA 1IAKB 2EJ1A 2VDPH 2JI1A 2PYEE 2WIMA 4M3KB 4PI0A 4Z76A 3LS4L 3PP3K 3II3A 4YDIH 2NXZD 5FYKU 5GRWA 3MBEC 2N59A 4LSRL 4R83A 4K8RL 4V1DA 3HMXH 1U8HA 2EAEA 3MLZL 2XC8A 4D8OA 4NC1C 1A6VH 2W81C 1TZAA 3MRFA 5D1QC 5DRXA 4YHLL 4DAGL 1OHQA 3APCA 4Q6IB 3QEHA 1JV5B 4JBSA 3EYSH 4IMKC 2Z4QB 2B1HL 1LMKA 1CJYA 1FNSL 1GPOH 5F1IA 1AO7B 2ENQA 3RPIA 4POZD 2PCXA 2X7LB 3P4LA 3TBVA 4AGOA 1AHWC 5I6KA 1BDYA 5AVZB 4R2GB 3BQUD 4BKTC 3MRMA 3U9UA 2NW3A 2L7QA 3O9WC 4PRHB 3S96A 4XCNA 3TVMA 1CXHA 3ABZA 1NIFA 2ARJA 4YEEA 2E76C 3GC3B 3MLWH 5FIEA 5ECGA 3LMJH 4R96B 5JXEA 2RR3A 3ULUL 5B38G 3ZTEA 1HHHA 2YC1A 2F7QA 4PYGA 2ZX5A 5CP7B 1AP2B 2WVVB 1OGTB 3H9YA 4BWUA 2R1WB 1SN5A 3C8DA 3GMOB 4NQEE 5CUSH 1DBJH 2E9GA 4HVBA 1Z32X 4P4KB 3U0TA 2IWEA 4JREC 4DW2L 3FRPA 1FFRA 3KNBA 2OTUA 2CG9X 3O8XA 5I18H 4APQB 2FO1A 4XP9H 1XMWA 4WK2B 3HAEG 4ONGL 4RGNB 4GB9A 2VM9A 3DMMD 1E67A 2JK5A 2QFPA 3MR9A 4JPWL 4P2QD 2VH5L 5JPMA 3B9AA 5CCKH 1F4XH 3MUJA 4OBRA 1MY7A 4NLHA 4R8WL 3HR5A 4M1DH 3VGEA 1I7UA 1A9BB 5HGAA 5KVFE 3T2NL 5J9PA 3B37A 2BERA 2WQUA 4NZRL 3FOLB 1W0VA 5AW3B 4KQ0A 3EFDL 4GRWE 1YQVL 4JKPH 4UT9A 3IDJB 3F8UB 3RB5A 1MCEA 4P9HC 1EX0A 5EV7A 1ROCA 2G60H 1K2DB 4E41D 1IM9A 3L5XL 4J78A 4K3ID 3OGOE 4WWKC 5IR1A 4GSQA 4F27A 1YUHA 5CKAA 1JZIA 3OZKA 4GQRA 2YBRA 5HI3C 5I19H 1MWOA 4G8GE 5DJZA 4E68A 3CVHL 3C6LB 2L8AA 3HS0C 4HWZB 4H8UA 4OGZA 2BRRH 4CA4A 3EI2A 4CU8A 5HYNB 5HHNB 4UB0H 2F0CA 4NFDA 4HAGA 1SXZA 3K2KA 2VLRE 2RCSH 1J5IA 4KH2A 2ZUWA 1AYOA 2XRAH 3OM3B 4JRWA 4HJUA 4NQXB 5D4HA 3UP6A 1OGAA 3DX8A 4U1SA 1UA7A 3HI1A 3LD8B 6PCYA 2W0PA 2WD0A 1KJMB 4DTGL 4K5MA 1KB5A 5L2KE 1FC2D 4YR6B 4JFDE 1PGUA 4I5BB 3MRJA 3P0VH 3WDJA 5M5RA 1XZ0A 1EZVX 1N64H 4L18A 4RAVA 2FEDD 2VDRH 1KENH 1CTMA 3GUFA 3DGCR 1KB3A 1CGSL 3FUFA 4YK4B 2D03L 3EFOA 4WJ5B 4P4RB 5KYNA 1AQDA 2MKLC 3QRBA 3RVVD 2Z4TA 1B9XA 3GS0A 1AO7D 1NBVH 4JM2F 4G7VL 5DMGD 5KBNC 3JAMg 3K1KC 2WTRA 4B53A 3BP6A 2DWEA 2ZP0T 1FFPB 3VFTA 3KBHE 4A0AA 5K9OB 2DAVA 4PRHD 5E0FA 2GSMB 3FHEA 4BZ1A 3C12A 2A9AA 3D4ZA 3QPQD 3LIUA 3IS0X 4QTHA 3O4LE 3TCTA 2H0PA 5IQ7H 1B2WH 3VGZA 4LRNH 3P9MB 1E3ZA 1WAAE 4UM8B 5F7LB 3MRNB 1GXEA 1A3RH 4BK4A 1A7NH 2R23A 3G5VA 3QWRD 4WW2C 1JN6A 1QSFA 4J4PC 4B97A 2GABA 5I75B 4FNUA 4GKZB 4YGAB 4CVXA 4P4KD 1BD2B 3DTDA 2FO4A 2CM6A 2C3VB 4XE0A 4BFIB 2IADA 3H3KA 4APQD 2ZXWB 2GEEA 3WNOA 4WI9A 1NUNB 1S7SA 2NXYC 5FDYA 3INOA 3AXIA 4RGND 4G80B 4TVPE 2ITDB 1AQKL 3OAZH 1YUKB 3IJHA 5B8CA 2QQQA 3WAJA 1QEWA 1L0XA 2VC2H 3GIZL 5E5LA 3QYMA 2P80A 3QNXB 3EJYD 5C0BA 3QJOA 5C3LD 3L6FB 4WUUA 3ARXA 2BSRB 4OV6F 3AS1A 1AE6H 2A77L 3H53A 3QJSB 2AXWA 5DVKA 4AN0A 2OSLA 3OHXC 2WTPA 3OAYH 1FIGL 2CLZB 1MFAH 3FTGA 4J3XA 4GXVL 4KY1H 3L3HA 5GGTH 1O6VA 3SKNB 1E4WH 3F7VB 3LZPA 3UTSB 1FVEB 1UVQB 4FJYA 3TA4D 2VXQA 4NYLA 2AGJL 1F45A 5DJ6B 2AMUA 4XXDB 3MRKB 3U46B 1CMOA 5J3HD 4LLDB 4UM9A 1BFOB 2CCLA 1ZSDA 3MU3A 2VRQA 1KCVH 1EIBA 3IRPX 4I0PC 4WVRA 2VLKA 1HWHB 2GHZA 1HQRB 4MMXB 1UG9A 2BNQB 3C6LD 3MUZ1 3E0GA 5DA4A 4KVCH 3LRKA 3L1FA 3NACL 3LKOA 1AD0A 4QJ4B 2QDWA 2WB1A 3W0WE 4M8QA 4TNGA 5L6YL 1JZJA 4N6RB 1D6EB 1C5BH 5AD0B 4CNIB 1CBJA 3NIGB 4LHUA 5TFSL 4OGYL 4QRQB 4OLUH 2CO7A 2VKWA 1BLNA 3MBEB 5J12B 4X0KB 2R4SH 4EUPB 2CH8A 2OVRB 1YEFH 5IHWA 3LVEA 1RVFL 4XNQA 5GPRA 3FFCB 2CMRL 3OJDB 3AQDA 4FG6C 1Q47A 3ZDWA 3WFBH 5AJAA 2MTAA 3JV6A 4JPQA 1MFEL 1EAJA 8PAZA 1OPGH 3MMYA 3QIBA 5L0QC 1JHLH 3LIZH 4WHYG 4JRXA 4H4NA 5D7LA 1Q72L 3A4EA 3LX9A 4RZKA 4OI9A 5BQDA 5F6IB 4LSPH 4QJ5B 1YPZE 3G04A 5E2TH 5BVPH 1AHWB 4UILL 4W9IC 3QEUB 4XVUC 4FTVB 4IOSD 4AGLA 2Q76A 3BGMB 5FFGA 3DXAE 1NGPH 1XZWA 4W9ZA 5D7KE 2D31B 4XMPH 1F42A 5D2LE 1Q0XH 2ZYHA 3GREA 5FECB 2A74A 1QUNB 1J8SA 3N3EA 4JM2C 5D70H 3K1DA 3TU6A 2EE6A 3HPLA 3D3VD 3IDGB 3GNMH 2OYKA 1A6AA 1LNUB 1TLKA 3EDEA 1KCSL 4PV1C 1HC1A 1M3JA 3SGKC 1M7DB 4PGCB 1MWAB 2JTYA 2BVEA 5LCVA 2OV0A 3MLXH 3EDDA 4EBQL 3QRGL 5D93B 1L7TH 3SOTA 4ZOVA 1XMEB 4N2BA 3S35L 4WFGD 4DZ8B 1BD2D 1IE5A 5DZ9A 1T3FB 1HILB 2AXGA 4AQ8A 1JPSL 1LK3L 4E36A 1F56A 1KPRA 1KFAH 4C4KO 4MJ6B 3D30A 3GK8L 3UC2A 1E3XA 3ZSSA 2DWDA 1MQ8A 2Q5BA 3KXFA 3K7UA 3MYJB 4J6RH 1MEXH 3VWKA 4YHML 1X7QA 4BA8A 2LTQC 3RVWC 2WP3O 3A5VA 3OKWA 4QHMA 3ZLQC 1N18A 2Y24A 5HYSB 4UQ9A 4GMBA 3U7WL 1HSBB 2RACA 1IEAA 1M7UA 1OSYA 1KBPA 2UVEA 4XT1C 1LO0L 3A4DA 3M46A 4K94H 4TPRH 3S36L 2P24A 5DLMH 3PHSA 1GKEA 5EU5B 5ELIA 5KS9F 2IANB 1YZZA 5BPPA 3UTSD 5EC1B 4MYPA 3VXOA 1NFAA 5GGSA 1GMIA 3D8MA 4OUUA 3C60D 4PQXA 4K7FA 3N0AA 3JWOH 3T0WA 4FABH 4JZNA 4LEXH 1JZ7A 1T7VA 3NFPA 4E42A 2R2HA 1W91A 2WKGA 2BNQD 3G6JE 3VXUE 2AQQA 1I8MA 1J1XL 3T6VA 3HAEB 2H45A 1ACYH 1RUAH 5DC4B 1XHMA 1ZHLA 1EXGA 1FYTE 2ZXCA 1JJUA 1HH6A 2CLRA 2ZUVA 5C97A 4NAQA 1LE9A 4GM9A 3LRGA 4Y88A 1HZHL 5C2UB 4Z7NA 3HI5H 3UYRH 3MBED 5E94A 1HVXA 3M86A 3ZE0A 2FH6A 1SJHA 3OG4B 1CE1L 4NM8L 5D1QD 4RRPG 5DI8B 3EFFB 5JHBA 4PWGA 1WSST 1IRAY 3OSKA 2N0MA 2EICA 1ETJA 1NIBA 1WFJA 3KHOA 2VDOB 3KYNA 3T2OA 5GXBB 3MBWB 3N40F 2VLMD 3D2UB 2KHAA 2L7JA 5A2KH 3TBTB 5ECJE 2X70B 3LN4B 1RZPA 3WO4C 4PJ7B 3O2DA 2A6DB 2B2XL 3ARGA 1C5CH 2GUOB 1TFHA 3FO2B 3GBML 3V0VA 3V6FA 5KTEH 1OAUL 3QORB 1PDKA 2YD9A 3LEYL 2CBTA 5E9AA 4FTVD 4TQ8A 4V33A 4Y9CA 1KJVB 5EOCJ 3RY6C 3VXRB 4Y9FA 4E9XA 4LP8A 4ZXBC 5CEZL 2OFQA 2YK1L 2APSA 1HK6A 2EO9A 5BVJB 5CXBA 2IC2A 4CVUA 4DVRL 1EJFA 4LSUH 3G5ZB 4IBVA 5T3XL 4X99A 1Q9KA 3ZDYE 3CVDA 5AFU3 4U1IB 3L3DA 4F7KA 4JKWA 4WW2B 5IMOB 1J87A 4XP4L 4ZS7H 3E3QE 5F3HA 3OKEB 5AEAA 4KNQA 1EH9A 5TDPB 1FV1B 5D7IF 3L7EB 3HTLX 3SOBH 4GI9A 1MCRA 1FNLA 2PUQT 3PDDA 2WINB 4C56A 1EXUB 1YMHB 2GJ6E 1USQA 4EMZA 5CCJA 2ATAA 1PX8A 1MW0A 3MLYH 3OZ9L 4QHNA 1Q38A 2BOCA 2YAFA 1EK3A 2ZCKL 3FFDA 3QFJE 4U6YB 2VQ4A 4PSWB 4JRYA 3SGJC 3S8WA 3KYMB 5EUOA 3ZL1A 1CDIA 2CXGA 1BOGB 5DJ8A 3L9EA 5EOCL 1KF9B 2R4RH 3D08A 3U83A 3V0EA 2AEIT 3DRTB 2HH0H 4JMNA 4YHKL 3ECQA 3BJ91 1L6ZA 4PR5A 4HGMA 2KH2B 4KKBC 4M1GH 4KZEH 4Z7QA 3REVB 1ZLVH 1ZLSL 4DP8X 4F8NA 2FGWH 4LOVA 1Q9OB 1LO2H 4M8VA 1FO0L 2R0KH 2BNUB 3B2UD 4MZ2A 4YAQB 4YBLB 3FB5B 2FECL 4S10A 4QL1A 1I8IB 2D73A 2IAND 3PWUA 4N86A 1RZFH 4NM4H 2MCAA 4I0PB 5I15H 1JNHA 2WK2A 4W9DC 5TDNA 5HI3D 3IF1B 4X3EA 4NI3A 1CIUA 5FA3B 1GHFL 4O4YL 4XXCC 1NGXB 1B4LA 1FLTX 3PL6C 3D52A 1AZNA 2AQ1A 1C08B 2I9LA 4A66A 5ILTH 3NSYA 3LB6C 3P1VA 1AQHA 1ZEAL 3ZDZE 3OW8A 3K27A 1JMZA 5DLLA 2BP8A 2R9HC 4DQOH 2N0KA 2Z35A 3VXPB 1A7RH 2DBJA 4X8GA 4OCSH 2VDQH 3P4FA 3V5DB 4BFFA 5C09E 2WLNA 1YMMB 4XMLH 5TQ2H 3H9HB 2P1YA 3BSZH 4J3OF 4BCZA 2DIJA 1KCBA 4H8VA 4ETYA 3CSYA 5EIIG 4ZQKB 4YHZL 1DE4A 5EU4A 3FH7A 4FNPA 4FFZH 2P5WB 4K8RC 4NQSA 3LH8A 1MSPA 1KELL 3BH9B 3OKDA 3QQDB 2GAZA 2BDNH 3QORD 4Z1PA 1PX3A 4OLVH 1G7PA 4NQDB 5FB8A 4KKLC 3M8OL 4Q8BA 3NIDE 3EJTA 3RHWF 4MNHA 5E08H 5LJYH 3DURB 1MF2L 4I88A 3PAYA 1RP9A 2W07A 3F64A 3GJFB 2WWOA 2X44D 4WDIB 3Q8EA 2ITFA 4BCXA 4X7CC 1OT2A 5DU7A 1EO8H 1AACA 1M71A 5J6HB 4LAQL 1RU9L 1TO4A 3GXMA 2Z9TA 3CDZB 1HHIA 1WO2A 3SE4A 2RMNA 3IVMA 2PTTA 4JHWH 3VCLA 5TH2A 4PBVC 1HQ4A 1RZ7L 2IQ9L 2KLSA 3DJSA 4XPGH 3WS6A 4HPOH 1S4IA 1TVHA 1C8PA 3NPZB 4W6WB 5IMKB 2DEWX 5C0CB 5LO7A 4IEFA 4WCYH 3THML 4JQIA 1OK8A 1F13A 1TETH 3GRWL 3DWTA 1QWNA 2MNUA 4ONHA 4DPAX 3DUHA 3D06A 3WY3A 1ZA6A 4HAKA 1INQB 1NKRA 1CK0L 4WTWA 4LGPB 2BX5A 1NOFA 3V6ZA 4NKDA 2VR4A 3BZDA 2WAHA 5HGBA 1QLFA 1A3LH 1ONQB 3MREB 4G6FB 4JN1L 4BKSC 2J43A 1A2YA 3MRDB 4NXKA 3IRZA 4PM1A 2J8UB 4JMXA 4EIZC 2E6PA 4FX5A 3R7QA 5J8OA 3MNZA 4J8BA 1P5UB 4JQVC 2WLIB 4I0PD 1N59B 4LOFA 4NS0A 4A6YA 3LZNA 5A3IC 1BHGA 1FPTH 3CZFA 5CN3A 3MKSB 2VLLA 3MV9E 3MCKA 5C0EA 3NEXA 3B9DA 4Y2DC 3V10A 1FZJA 4L1QD 1VADA 5FR3A 2X38A 1S4UX 4TSAL 3P73B 3TZVB 3ZKNC 3QWOA 1E27B 1QI5A 1ERJA 3I50L 1NPNA 4APXA 1N0LB 1UCTA 4Y5VC 3RWEA 3NN8B 2DEYX 2ZOKB 4O3TB 2CZNA 4L4TA 2ZXAA 4ODUB 1GGIH 2AEQH 3IU3B 2JWYA 4PJIA 2V33A 2YQBA 4LP4A 1RUQL 5IBUB 4WO4C 3N06B 4HFUH 3ML9A 2EDBA 5F72S 1EZLA 3X11B 4XX1G 2QXVA 1B9KA 1EEYA 1OCOB 3EO9H 1JF1B 3BHBB 2VDKH 2F9BT 5JHAA 2CA4A 2P5WD 5JHMA 4WO0A 3ILDA 3MRBB 1JIBA 3VI3E 2H14A 3BLKA 3H0TA 3K0WA 1EHKB 3WTVA 3ZU8A 4KO9A 4E54A 4BYHA 1EHNA 4HZLB 4NQDD 4NAMA 1FJ1B 3P69A 3VB8A 3UPCA 4OTXH 3C2SA 1BF5A 1TZGH 4P3DA 5ALCH 4M9PA 1PQZA 1O6TA 3FT4B 3NZHH 4UV7L 3LRSA 4P2QE 3T6WA 3UVKA 3E38A 2X4OA 3GT6A 3WIFA 4PP2B 4WGKA 1KTRL 4OZGE 4NSKA 3V6OE 3VE0B 5AB0A 3OXRA 1HT6A 4HUXB 4OQTA 2J6EH 2HRGA 4X6CE 1NLBL 2Q86B 3TH4T 1W6LA 2VDPL 1MQKH 2PTUA 4AQOA 4NLAA 1GZPA 5F6HJ 3HPJA 3W39B 2YAHA 4CAGA 2K0RA 2OMXA 4YDIL 5F3FA 3KDPB 1BZQK 1B3IA 4CN6A 1KXTA 4X8JA 2W8CA 3HMXL 2YN5A 1NIDA 3GXTA 1A6VL 2EDRA 2MIZA 2DLHA 1VFOA 2MFNA 2R7EB 5C0CD 2X2YA 2ZUQB 4TNVF 2RD0A 4NQCE 2K7QA 3EYSL 4NSXA 1LQBC 3RVWD 3HN3A 4KKNA 1UOVA 4XWOC 4PJEE 1G9EA 1U8KB 4EI5B 1GPOL 2I7OA 4J3OH 3DDUA 1IQWH 1K4DB 3TJPA 4L1BA 2Q2EB 4GT7A 1TYRA 5GRVK 5IWLA 2H9PA 2D3JA 3OXSB 4M7KH 1EZVY 1PCSA 2PR9A 2VDLH 3F12A 4QY8A 2X1PA 4H5SA 4UINH 1HDMA 4N8PA 3SE3C 2F58H 3EADA 5KJRH 2H3KA 3HC3H 1NFIA 1RJZB 3MLWL 1F18A 4FXGC 2CDGB 1JXKA 4FNQA 3LMJL 5CIPH 5E6UB 1ASOA 1K9TA 1R47A 1FBIH 1CL7H 1D9KB 3Q6GH 4FYQA 1BYPA 5C07B 1WWWX 3DUUA 4OD1H 1E43A 5CUSL 4L4JA 3I6GA 2X9ZA 3TZVD 1DBJL 4GZ8A 1AO7E 3FSVA 3CCHA 2CDEB 4W9KC 2YEZB 3QRFM 2CNXA 2R27A 2VZSA 4DFHA 5F9WB 4NRXB 4K3GA 2H3NA 4X4YA 1Q0YH 1R6VA 3HVNA 5I18L 3BH8A 1PY9A 5DA0B 3RX7A 1WTLA 4XP9L 1JMXA 3VB9A 1XF3B 4HLEA 3IETA 4PRHE 3IFOA 4OZHA 2PW2A 2YARA 4DP7X 1KULA 1QA9A 2OQJB 2Z65C 5CCKL 3L4WA 1F4XL 1ZT1B 4RZCB 1MXGA 1X5XA 3JWNE 2XWZA 4M1DL 5E51A 4CU7A 4I4WA 1H3XA 2XZAH 4Y9EA 2HUEA 1IC0A 3KGRA 1F41A 2BNRB 3LEXB 3L4YA 3EYVB 5F9JB 3DRQB 1PG7X 1SYSA 4JKPL 3F7KA 4A2GA 1B0GB 3CFCH 1V3LA 3VFGH 5MEQB 2IOIA 2G60L 2HG5A 5CFAA 3BISA 3E6HB 2BY2A 35C8H 4ZXBD 2EP6A 2PWDA 3VG0H 4OB5H 3HNSH 5I1JH 1MI5A 4AE1A 3D05A 4RGNE 2OIZA 1WBXA 3M88A 3V7AE 3GS7A 4E0RA 1T2JA 1J18A 3ESUF 5I19L 4HS6B 2AJXH 1AJ7H 4AEFA 1DUYA 1M6OB 5D6CA 2BRRL 2YN3A 4X4MA 4XOEA 2FWLB 3MQIA 1EZSA 5ACZA 2DI9A 4UB0L 3QHFH 2XDWA 4NXSA 1T1XA 1IO4C 5ACLA 4FA5D 2RCSL 1N12A 2XRAL 1RI6A 1XF1A 1BQKA 4RSVA 4TUJB 1QQDB 1JK9B 4BWWA 4Z7IA 1B0RA 3G6DH 3BP7A 3BIKB 2B9BA 2E27H 1E90A 2AVGA 1ZE3C 3NA9H 3EAKA 4KJYA 5I1IH 3IRCA 4YN3A 3P0VL 5EEYA 1N64L 2FUQA 4M02A 2DYSB 1KENL 2VDRL 4L9LB 2JB6A 4B9KC 3I7HA 1S7RA 4AL8C 4MB4A 4W9FC 3ECVA 5CJ8A 4H0GA 4UIMA 8CGTA 4L8SB 4EI5D 3VI4B 4OY9A 1DO6A 1IFGA 1NBVL 3TIDA 4ACTA 4UQ3A 5HJ3B 2N1TE 4QWWC 1H8LA 1R33A 3WJJC 3MV9A 3ARDC 5SWQA 1DO5A 3CSFA 1L3WA 2ZNWA 4WJKB 3QUYA 3EF7A 5E24E 1MH5B 2NX5A 2C26A 3OZLA 1A3ZA 1CGXA 4UQAA 5DD5H 1YEDB 2P28B 4CVWA 5IVXB 2Z2NA 5IQ7L 1B2WL 5KVMC 4LRNL 4EE2A 4AKQA 1M57B 3KPLB 4ZDHB 1N68A 5C07D 3F6IA 4URKA 1FFQA 1A3RL 1C5DB 1A7NL 3DHMA 4OCXH 3NVXA 5I8EA 2CUIA 4OF0A 2EIZA 1G6RA 1OTTD 3DDGA 1XGQB 2OMYA 2R9HD 3FCTA 4LQFH 1JD7A 4H0IA 4AIXA 5I1AA 5DURB 1I7TA 5LGJA 2XXFA 4NJ9H 4F8QA 1IKOP 1CG9A 4UT9H 1ZCRA 2LAGB 4PJHA 4MDRA 4WGWB 4HIIB 1ECYA 1G9NC 2ZUTA 5HDBB 3ZT5A 2XN9B 3L9BA 1T5KA 4W6XB 5F7KC 2E74C 1VB9A 3GO1H 3RBSA 4Q6KA 2RHEA 1UKTA 2HN7A 5TE7H 2Q9OA 15C8H 2FEEL 1A8ZA 2VC2L 5K59E 4MXQC 5C0AD 1PZBA 4EN3C 3Q44A 3LQAH 4K8RD 1V3JA 4W68A 1AE6L 4LVNC 3V8CA 3KG5A 3Q43A 4G1EB 2BNRD 3FCUA 2KLRA 1MFAL 5DS8A 2RIKA 3AB0B 5CD5C 4WFGE 4JAMB 4KY1L 5GGTL 3R8QA 1BD2E 1E4WL 5E56A 3DGDA 2K9FB 4IOIB 5F7MC 5KAQG 4BFBD 3B7UX 3G3LA 1KCVL 4FYRA 4N0FB 4JDZA 4A11A 1EQWA 4QEGA 4QI3A 3AWEA 3LAFA 3K80A 2ICWA 1BAFH 3UXFA 5LAXB 1KB5H 1N0XH 4I3SH 1OP5H 4HIHA 4KVCL 1JPGB 4GMSH 1HU8A 1FC1A 4UDTB 4Y4KB 5EO9A 1R5WB 3LKPB 4PS7A 1E8YA 2Z0BA 1GZQB 2IH3A 1PFCA 2Y7LA 4G5ZH 3L5IA 2YKLH 4GO6B 5DD3H 2Q8AH 5K9KA 1C5BL 2E7DA 4AYDC 1R3KB 4O9DA 3ULUD 4W9GC 4OLUL 4QCIA 3O41A 5E6RB 1NA8A 2OS7A 5BZDB 2R4SL 5CMAA 1CXIA 4JG0H 5F8QC 3UTSE 1YEFL 3WTYA 4S2SA 4YJZL 3O6FC 2CBOA 5A16A 1EERB 2IG2H 4L8CA 5FO8A 4DEPB 5FO9A 3WFBL 4H8QA 2P8PA 3TA3A 2VZUA 3EG9A 4NZ8A 5EU7E 1OPGL 2PLTA 3M17B 2F8OA 4BZ1H 5I74B 1JHLL 3J07A 3LIZL 1X4ZA 2BNQE 5E5MA 3MBXH 4JY4B 3A4FA 4FQIH 5IQMA 4Y5YC 4R7LA 4LSPL 5E2TL 1O9VA 5BVPL 1TFPA 3LN5B 5E9DB 4QRRB 4UANA 4FXKC 5GSRA 1WS8A 1KPVB 4Z7NF 3NIGE 4P2RB 5MERB 2Z2OA 1H5BB 1NGPL 4MMZC 3HNTH 3MZTA 5AW8B 4XMPL 1P1ZA 1Q0XL 4Q6IA 1E9QA 1G9MH 1WAEA 1WBZB 1DEEB 2FX8H 2GG1A 3D5OF 4KK8C 5HDOA 1F00I 4AVKA 3FFCE 3HEIB 1BYNA 4NQQA 1G84A 5D70L 4M61A 5ICXA 43C9A 5A3ID 1KLUA 3KPSB 3L3KB 3FC8A 3GNML 3GSVB 4K7PX 5C08B 5I8OH 2VLME 2J5LC 2AH1A 2X4PA 4U6XA 2M83A 3VQ1C 1XH2A 2AANA 4EDXA 4X4KA 2YSSB 1OE2A 1A4AA 4MJHA 3FO9A 3MLXL 2GJRA 2BVPB 4IHBA 1L7TL 1FVDB 4NN7C 4MBOA 1EAQA 5JIIA 1MPAH 5EZPA 4LLVA 2Y7MA 4ZW8A 4LGSB 4KMQA 4FTVE 4G56B 1SYVB 1XD1A 3LPOA 4X80H 5FGBA 4AGMA 5M5VA 3PFUA 4A2MA 3K5SA 2D0GA 3T1FB 3X3GH 2V37A 2XLLA 3CN2A 4XBMA 1KFAL 4Q9BA 2BSTB 5CP7A 1U21A 3B5HA 1TCMA 2VXQH 4WO4D 4DUXA 2QKIA 3ULVH 4Y4HC 3M6DA 1XSJA 2AAVA 3CC5B 4HEME 4J6RL 1S5IH 4ZS6C 1MEXL 4DERA 3FQTA 4DKDC 1NGZA 4E9YA 4EIGB 4KHXH 3H7BA 1H3UA 4ISVA 3CFDB 1KYOJ 3PHOB 1HNGA 2E9WA 3ES6B 5E2UH 3RZCB 5T5FA 4HUKB 4PG9A 1DVFA 3DYMA 4K94L 4TPRL 4XVOA 3WLBA 5DLML 2WZ0A 2CO0A 5I16A 5TF1H 3W5NA 3QXTA 3VRJB 5K5YA 1M4KA 1AIFA 2KKQA 2WBJB 3VD4A 2EEBA 5MEOA 1KDJA 1IM3B 1N7MH 1DQTA 5EUOF 3JWOL 4BFRA 2IDUA 4GSXA 3UG3A 4LEXL 4B9JA 4FABL 5CYKB 1HKFA 4WSGA 3IDJA 1QI3A 2MTAH 3BYYA 4FKEA 4Y4KD 4S1DC 4AYFA 3DSNA 3U0PA 5F89A 1K2DA 3HE7A 1ACYL 1RUAL 2BSED 4HJGB 3BD3A 4UI9R 1EUUA 2DIAA 1HNFA 4HGWA 5K1VA 3RWIA 3VD7A 3HI5L 3UYRL 2J6WA 3STLA 2IANE 2NR6A 1JUFB 2FJHB 4PBXA 3J81g 2ZKMX 2E47A 4GMTH 1FGVH 5CHNA 4GAYB 3HRZB 4QRFA 4XEIC 5HHNA 4MWFB 3SFZA 3WS3A 1FL3B 2FLBT 3M07A 3CZLA 3QHYB 3UEQA 4LEEA 1BBJA 5HHVH 4HKZB 2VDNA 1C5CL 4XYIA 3UG4A 2DZEA 4LBAA 4WEUD 3LV3B 4PY7B 5FYLE 5KTEL 3I8EA 1OD9A 3DVIA 2ZOOA 3V5HA 2VL4A 1KJMA 3HUJF 2W88A 2A9MH 4QRRD 1BEYH 3F7QA 5E9DD 3T6ZA 4PJGA 4R0LB 5LCVH 3F6LA 4P2RD 2GC4A 3ARDB 3KPRB 4TSBH 5I17A 3T4AC 2ZD0A 3X1EA 3QEQB 3ZOAA 4CC4C 2X4TA 1I8LA 3FQNA 3U9PH 1INEH 1HEHC 3WI9A 4H13C 3FOMA 4MZRA 1NWPA 3SY0B 5HVGB 4KO7A 1OPOA 5KVFH 3P11H 1VJSA 4LSUL 3KPSD 3AXLB 5AW7B 5C08D 5F96H 5CLYA 4FS0A 2F1AA 5AYUH 3F65A 3STZB 3UP1A 3VSTA 5KZCD 4GRWH 3WEBA 1ZLUH 4ZS7L 4PJ7E 3S3CB 4JCWA 2A6JB 5HPMB 1CFNA 4NGHH 3IJ1A 4UOZA 2Z8VC 4HKXB 2OSXA 2WC7A 1ZPLA 5D7JA 1FZOA 3SOBL 2VL5A 1DBMH 4PLJC 4IBZA 5TK2A 2XTJC 5T3ZH 4Q56A 3VXRE 3TEWA 1TQBB 3MLYL 5CXCA 4HD5A 4D8PB 3OMIB 3S3DB 1BX2B 4BCCA 4JFXA 2VW6A 4ERSH 2AFNA 3SKMB 5T1LB 4NHCH 1Z9LA 3WE1A 1TVDA 3WD5H 3C5ZA 1Z9NA 2R4RL 1YN7A 2HH0L 3E8UH 3EGSB 3MLRH 3BFWA 1JNLH 4LVNB 4PJ5A 5F7YC 4QT8A 4XNXH 2VQ1B 3NSFA 5JA9A 1J9QA 2ZUYA 2OMNA 3RVXC 1R19A 2WSDA 3ZTJG 2E8YA 3NZ8A 4M1GL 3R7RA 5F7UA 4KZEL 2Z7UA 2FGWL 2DM7A 1LO2L 3K3QA 2R0KL 1J0YA 2BO0A 2LQRA 2DQGH 4HG4J 1TPXC 4B41A 2NLJB 1JZ4A 5DEGB 1RZFL 2WBJD 4HUNB 4NM4L 3ORVD 2W95A 1IM3D 5I15L 1PD1A 2R2EA 4E5XG 2O1AA 1JTPA 3DGGB 3S6CA 4J82A 3WAKA 1KY6A 3WFDH 1JWMB 1YEKH 1N6QH 1KEMH 2I0RA 1EEZA 4B5ZA 5DO8A 5ILTL 5FO7B 2DI8A 3DETD 1OP3H 3LKSA 5AZEH 4NBMA 4JVPA 1BJMA 3OR6A 3ZZ1A 2BS9A 3O2DH 1HHGB 1M42A 1DCLA 2WN2A 2DYPB 3ET9F 3MRKA 2Z31A 2YGOA 4PWIA 3V2AR 4DQOL 1NGWB 1GGTA 1A7RL 4J3SA 5GZND 4HYTB 5AAWC 1HSAB 1DVXA 2MCG1 3QT2A 4OCSL 3CDYA 4HK0B 2VDQL 4ZMOA 5C0FA 1KIRB 2GC7C 2LABA 3IFLH 5I1KH 3CFTA 2GFBB 3QNYB 4XMLL 5TQ2L 1JHTA 2IDQA 3I6KA 4XP6H 5JORB 1F8TH 4HUVA 3BSZL 2Z92A 2HSIA 4JHPC 4UAHA 3AJ7A 1D6EA 2LU3A 2QADC 1JYWA 3UBHA 3Q2WA 4O51A 2IQAA 3VMOA 4FFZL 4K5LA 4MAYB 2H32B 1XCWA 3IBEA 3A6BH 6CGTA 2COVD 3ZHKA 2IWFA 3VXTA 1LEGA 3EIFA 2BDNL 4Q9QH 3FFCA 4OLVL 2ZAGA 5KYYA 2AJVH 1OM9A 5KSUA 5GZOC 4DP6X 3KLHD 1X3DA 3ARDD 5E08L 2HJLA 4GW4A 5T1JA 3QEQD 2NNAA 3B2VH 4DVBA 1NM9A 4PJIF 4TTDD 3TO4C 4NC4A 3PGDA 1YMME 4OFYA 3D85A 3VWJA 3GSUA 1XSIA 3HW7A 2H8PB 5IHHA 3PJSA 5IW3A 3V4LA 1Z9OA 3BG0A 1EO8L 2ICES 2EXYD 2MRYA 4P5MB 2CIIB 2JCWA 1V27A 4ZPTB 3WNPA 2P5WE 5DJXA 1CICB 2NSMA 4A2LA 1M9WA 3T4YB 4JHWL 3S97C 3AADB 3L4XA 1G7IB 4WGVB 1E4XI 2WXQA 1ILUA 4JFZH 4LHQB 4NQDE 4XPGL 4DGUA 4PJBB 2B1AH 4HPOL 4S0HA 4U3SB 2BIMA 4LCIH 2B5NA 5C2WB 3IDNB 5FYJU 3CDGA 3V0JA 1QLRB 2HVJA 3L2NA 4UOW1 3QZWG 1OAKH 4WCYL 4H20H 3LHPH 4AM0B 1TETL 2IVFC 1I8AA 1E40A 2DKUA 2BPBA 1XIWB 1KIUB 3ZZLA 1GVIA 3RVUD 4GM3A 5CZXD 43CAA 5CD3A 3CMOH 2MEJB 2QR5A 1N6EA 4L05A 1D7DA 3VXNB 3MLVH 1D7CA 1U36A 4HHAB 3G5WA 5CD5D 5J06A 3MJ8B 2N56A 3CQPA 5I8CB 5DTFB 1A3LL 4JD2C 1DQQA 3AG2B 3EHBC 1WHPA 5EO0A 4LG8A 1DDTA 3FT3B 4MYWB 1E4HA 1F4WH 1DBBH 3TIEB 1E9PA 1ZOXA 3CU7A 5C0CE 1E5CA 1FPTL 3SYOA 4P57B 1NEZB 4NZJA 4L5FE 1ET8A 2PP9A 1QNIA 3ARWA 2OJEB 1M05B 3OR7B 4JJ5B 5TGBB 5B3JE 5CEZD 1UKSA 2V2WA 3QC6X 1KTLA 4H8WC 3QQ4A 4F7EA 5BUPA 1A1NA 1F5WA 3MI6A 1BVNP 4V11A 1G4RA 3ZPDA 4BUQA 3WN5A 2NY4B 1QBBA 2X1OA 2DYPD 5T3XD 1TZHB 1AKJB 3EQ7A 2OK4A 2AAAA 5F88A 4KRPC 4TNWF 3MNVB 4PGBA 3JROA 2J8UE 5THAA 1GGIL 1WK0A 1KB9J 2AEQL 2DQTH 2VGLM 3EO0A 3MGOB 4QYAA 5BUAA 5IHZB 4FP8H 1JVLA 3ROLA 4HFUL 5EHFA 2WLJA 5I6XC 4HOXA 1XR8A 1EAPA 4MVBC 5G4MA 5ID0A 5GISH 2IAAA 4KZDH 3EO9L 5FK9A 2VDKL 1KGYE 1TZOA 5HGDB 5DVNA 3ZRFC 4PREB 1KWKA 4MAYD 4JHNA 5CEYB 4MCNA 3BGFB 4KXBA 1UB6B 1WA0X 4XRCA 2IAMB 4NUJB 3ZQWA 4OGQC 4R4FH 3S3BB 3PHQA 5KW9H 5J6GB 1E8NA 2EECA 3P3SA 4LLYB 1A1MB 4OTXL 2N7SA 1TZGL 3LNFA 4ZUTA 4XBPB 4KK8D 1AXSB 3AREB 3D2UA 3IMRA 5ALCL 5J1AA 4XMKH 3NZHL 3AS3A 3QJXA 2HX7A 1PY0A 3S0PA 3FB6B 3TM6A 1JGIA 4MA8H 2AVFA 3AROA 4I3RH 1KGWA 4JQIH 3LRLA 4PS3A 3TTSA 4ODXA 3QUXB 5IREA 1JRHI 4YEFA 2J6EL 6TAAA 1G43A 3D4GA 3F2LA 2VMFA 1MQKL 1RD6A 1B4RA 4P5TA 2X4QB 2XKUA 4ZUUB 3NRQA 4PJDB 3KWVA 3ZE2B 3IE4A 3G5ZA 2Z0UA 3T0EB 3F6JA 3CLFH 1GOHA 2HKRA 3H9ZA 2W18A 4YHNB 1J88A 1U3HA 3HRPA 4ZS6D 1HXKA 1U8PB 2X2JA 4X6FA 4BK5A 4A6YH 3QI9C 4YSEA 5TDPA 1FV1A 2XN2A 5DT1H 3BVDB 3RI5K 3U7AA 1IQWL 1ESOA 4LESA 5JQ6H 4UNUA 1HL8A 2JV6A 3PDOA 3OAUH 2J72A 2OMUA 3SDDC 4M7KL 5IGXH 3SHFA 4DNUA 2XBTA 2CO6B 2VDLL 2R2CA 3D34A 1JPFB 1OL0A 4I1RA 3SBWC 2WVUA 4UINL 3UJIH 3ULAB 4NKOA 4YNYB 1BOGA 2F58L 2B15A 4ANWA 5KJRL 4FNTA 3HC3L 4GIOA 1FNHA 3PABB 3VH8G 2W92A 2BFVH 1FH2A 5C9JA 4M6OH 4UTBA 2YGPA 1FBIL 1CL7L 5GRYA 3Q6GL 5EM2A 2XQYA 1G1OA 4J3UA 4OD1L 4AIZB 2HTKD 4L8BB 1H2YA 1MLBB 2ADJB 4M4PA 1MDTA 3TNNB 4U2YA 4GI6A 2TRYA 3I9PA 1TTFA 1IC7H 2GSIB 2NY4D 1Q0YL 1Q1JH 1UOOA 4PJXB 1JXJA 5DS1A 5F7NC 4A08A 5DK2A 1K85A 3HA0A 5F7DB 2EQDA 1AKJD 4F8LA 1S3KH 2NZ9C 4K15A 4CVZA 1ZPUA 3QIUC 1K32A 2GTZB 1NANH 1TENA 4O45A 2VDPB 2XZCH 3VD0A 1WDAA 2P26A 4N3TA 5C0IA 4ZSOA 5B3NA 5B1JC 2XWJA 4UUJB 3IUMA 2OI9C 2XZAL 2FHCA 5C07E 4AV0A 1KXVC 3UJJH 1LE5B 1NMAH 2HVKB 4JY6B 2M2DA 4N2MA 1CDYA 4WNSA 2YBAA 3ARBB 3H7LA 4GXUN 1EZUA 4HEPA 4K9JA 3O3AB 3V0IA 3CFCL 5D6DC 1EJOH 1QFWH 1SPDA 3VFGL 3Q7JA 2IAMD 2D7NA 5E8EB 5B7EA 4XH2B 1QO3A 5D4IA 4W9HC 4OQTH 1DJSA 4WHTB 3FYIB 35C8L 3VG0L 2RTTA 4OB5L 2A7BA 4TUUA 3TO4B 2XL2A 2BWIA 1I7RB 1P6WA 3DSFH 3HNSL 3Q8CA 4UNTA 3ZTDC 5I1JL 1K5WA 1UM6H 3VTMA 2BP0A 2AJXL 2FAUA 1MVYA 1AJ7L 5L2JB 1GYVA 2I60H 1PMYA 3AH8B 2CO4A 1WUNT 2X4SB 3AABA 3QHFL 4ZPVB 1A6PA 1MCQA 3QUXD 2BNRE 5C0JB 1T20B 2QEJA 1LEKA 3OPUA 3ZHDA 1T0MB 4N2NA 1TQUA 5KBDA 4YDJB 2ENYA 5GGRB 3G6DL 1VFBB 3FTUA 1U58B 3L16A 2E27L 3NA9L 3WUWG 1CD0A 2QGEA 7PAZA 5DK3A 4WI8A 3MSPA 5I1IL 3L1OH 3WFHA 3T0ED 1HHJB 1CR9H 4PWHA 2X6CA 2QGCA 3KPQB 1NC2A 1YEHH 4PJCB 5CP3A 3WO3B 4ZI8A 4XCYA 3V4UH 5E6SB 5EC2A 1X5FA 1GCFA 5TDOB 7TAAA 4FJ6A 2E86A 3IXTB 3RVXD 5EPMB 4WI0A 4NQUA 1IAIM 3OKNB 2K7PA 3KJ4B 5HPOA 2CKBA 1ZAGA 2XV6B 3ULUE 2X89A 1U8CB 2OJYA 3AU1B 3WEOA 3DYPA 3E1ZA 4AZUA 1P7QB 3ZE1A 5AG8A 1SVCP 4HS3A 5DD5L 1OLLA 1D5RA 2NT1A 4YSUA 4K94C 1P1VA 2GEQA 2WXPA 5AL0A 4JN2B 3VSQA 2CUMA 3MZLA 3SJVB 2WM0A 4D9LH 1ICTA 1HJBC 3EJRA 1EBPA 2DQ6A 1I3RA 2P45B 3HC4H 4OCXL 5AUMA 3MUY1 2NDFA 1P53A 2FZ3A 3MRDA 5ITFB 3VI4E 3S3JA 4LQFL 4OCMC 3JWOC 1GMEA 1ZK9A 2CR3A 3LH2H 3MXWH 3QZWB 1FUNA 4PJFB 4NJ9L 1CD9B 1N6FA 1MLCB 4B3VA 3CHPA 4K7PY 4UT9L 2Y9RT 1P5VB 3ARYA 4KO6A 3WHXB 4MBRA 4TMPA 4GAFB 5JMRA 3GO1L 3OB0K 2WV3A 5I6XB 5TE7L 4WU7B 15C8L 3WEXB 2LR4A 3T65A 1DN2A 3LQAL 1YQ2A 2AV7A 5A6MA 2Y3NA 2Y1YA 4MJIA 2X28A 1PZAA 1N0LA 3NA4A 3GPEA 3NN8A 2QTEA 3ARBD 3IS1X 1JZ8A 3VYNA 4FA9D 1RFDH 4GW1B 4XGZB 4EWRA 2VDRB 2QVKA 3RWGA 4AEEA 4H8HA 4FQXA 4MZ3A 2ZSVB 2IXQA 4K3EH 4WF7A 3U2IA 1AS6A 1TQCB 3X11A 3TO4D 5HDBE 4F7TA 2XN9E 4MAUH 4P46C 4JFFB 1ZJAA 4GRLB 3LDBC 1BMGA 1QFPA 1UJ3A 3UBXI 1IAII 1I53A 5FUZH 5HY9B 1BAFL 4MLSA 2XPGB 1KB5L 3LXUX 1N0XL 3FB7A 4I3SL 4XXWC 3S5LG 3VA6A 4GMSL 4MDIA 2BMKB 4LKCA 1P7KA 3K2UH 4G5ZL 5F7FA 2BVOB 2EADA 2Z34A 1N2RA 3BPOB 3ZO0A 2YKLL 5DD3L 1GS8A 2Q8AL 5FWRA 2H47C 3ME0A 3X13B 1IGTA 2NY0C 5EF2A 2YMXH 4HAFA 1UD8A 3GXUB 4TZ4A 1WT5C 4JG0L 5IFHH 4Y16B 3QJUB 3WKNA 4B9GA 3EI3A 4JSPC 4N0CD 2IG2L 4HETA 3VM7A 4HULB 3MVSA 4ZOAA 5C86A 1BW8A 2A6IA 1EGJA 3ARRA 4EXKA 4QLWA 2F15A 4PUBH 1LJMA 4BZ1L 2CLVA 4DGYH 3R4RA 4JRLA 3MBXL 4FQIL 3WKYA 2CNYA 2V5SA 2YNNA 3QFDB 2OR9H 4Z3HA 4BH8A 4A38A 4P9MH 1H15A 4M7LH 5K69A 1WH0A 3SPJA 2VC2B 4FL4C 3MV7B 4J8GA 2BVTA 1G6RH 5KN5B 4BQ8A 3HNTL 5J57B 5JQHC 4XX1E 4NQTA 4OBSA 1T0NB 2Y22A 5T1MA 8FABA 1G9ML 3BZ4A 2FX8L 3ECUA 2RB8A 1NIEA 1P7QD 3QDJA 4WK0A 3GBLA 1U8KA 5E2WH 1NBCA 3U6RB 4JSVC 3CVIH 4L2YA 3UC0H 4Z7OB 5I8OL 1NBZB 4AENB 1EHLH 4Z7VF 1DJHA 2QQNH 5DC2A 1WEJH 3SJVD 3O3BB 2NYKA 5DYOB 2OJZH 2WLLA 4B9PA 1LP9A 1OWRM 4N85A 1M3IA 2X4UB 5TPWH 3RBGA 2WXKA 5LXVA 4PJGF 3GBEA 3VD9A 3LKQA 1MPAL 4QRRE 1F86A 1BQRA 2K6ZA 1TOXA 2R1YB 2DB8A 4X7FC 1E5TA 2IPKB 1UD3A 2CDGA 4P2RE 2ZOLA 4X80L 2FBOJ 4YSTA 3T6QC 2I69A 3WJMA 4PPTA 3X3GL 2WVTA 2G3MA 4V2CB 2OL3H 2YQGA 1ES0A 4KNSA 1LO4H 2NCEA 5IFJB 2VXQL 1NEPA 1CDHA 4RMWA 3ISYA 3RLSA 3ULVL 4HLJA 3FUIA 4JHAH 3KPSE 3IUNA 3NEEA 1S5IL 5SWZA 5C08E 3SYPA 3T1WA 1JK8B 1U8OA 4KHXL 3RUGF 4DN4H 3COOA 2YEQA 4PRBA 5E2UL 3RL2B 3NCEB 2I0TA 1SZNA 5KSVB 1XF3A 2YD4A 1U91B 3KCPB 3G08B 2OQJA 5TF1L 1R75A 4ZTPH 4OH2A 1ZT1A 3DX7A 4FQ2H 4J2XA 4FE9A 1N7ML 2J12B 2P8LB 4R26H 4ZOZA 2V8LA 1H8NA 2FWOA 4GRLD 1G4MA 3WHE1 5FA5B 2ZUSA 3LEXA 3ZDXB 1V10A 3OLGA 1QR1B 1UZGA 1GS6X 1HYRC 4QPEA 5I1GH 3FQRB 3NIFB 5IVZB 3H2WA 2NY2C 2ZWYA 3N42F 5GS0C 4OKVB 3SO3C 4Z7WA 2VN3A 4BKLB 3VXMD 4DPCX 3HG0A 3SDAB 5D5MF 1K72A 2SODB 4J0XA 2ATPA 1BV8A 2UY7A 4AE0A 2XG4B 1OE1A 4H0LC 1ORQA 3FL7A 1M7IB 2APXA 2GTQA 2WN3A 3IJCA 3UAFA 3CLEH 4Y16D 1EA9C 4Z6AT 4Q9RH 1VF5C 5LN4A 4GMTL 3V9EA 4BQ9A 1D7BA 1FGVL 4HBCH 4LZKA 4R5XA 2FHFA 3GMMB 5CAYB 3GXPA 1I3GH 4LNRA 3I85A 4TL5A 3IFNH 2LHAA 1P6FA 4D9QD 2ZX7A 5AALA 2WBXA 4UCFA 5HHVL 3J7HA 1I85C 3U9WA 3DXMC 3SDDD 4L37A 2A9ML 1BEYL 1L5GA 4DP1X 2H0EA 3ZIMA 5LCVL 1SJEB 4TSBL 4ZAKA 5KYUA 3SKOB 1X44A 3OJVC 2EIDA 4YSDA 5AW5B 3U9PL 3DNKA 5IMLB 1INEL 3ALPA 1U6AH 3HS8A 4K3JH 3VJ6B 3N1QC 3C5JB 5KVFL 3P11L 4P5KB 3RFGA 2XBZA 4G9DA 4KKAC 5F96L 3Q2CA 3MOAH 5AYUL 3RGVB 2YNPA 1TSRA 2DJMA 2PWEA 2I3SA 2C9UA 2PCPB 3U2SB 1BVZA 4HMEA 1IGYB 1A9EB 2ATKA 4XHJD 1N3NB 1NH6A 2G2NA 1MHHB 4AYID 4PAZA 4OV5A 1OOAA 3L8QA 4NGHL 4F92B 4O2WA 3Q8FA 5T5FH 3ZKMC 3RFZB 2MMXA 4X6DA 3TESA 3QJVB 1DBML 3IJ0A 3KPRE 3WIHA 1NCIA 5T3ZL 2AQNA 5E2VH 3DX6B 1OF2B 3QEQE 4P3CH 5IVXA 3NRFA 4YIQB 5AENA 5LWYH 3L3JB 1C5DA 2WTOA 2YAPA 4ERSL 4F33B 4NHCL 4N24A 3W57A 3N1FC 3WD5L 4ZNEA 2XWXA 5I5JA 3E8UL 3MLRL 3NSJA 1WA1X 1JNLL 5EBWA 3ZR6A 4F2EA 1GOGA 4XNXL 2JKXA 1P4IH 2DM4A 3RX8A 3VRLF 3R06B 1PVHA 2DMBA 1BOYA 1KZYA 1HXYA 4PTTB 5L8JB 2DQGL 3WLWC 4U33A 1OGPA 5D1ZC 3AS2A 2JKIS 1IVLA 5MENB 2IFGA 3BPNC 3RGHA 2P9PC 1BF8A 4FXLA 4LRIA 2C4XA 2UYLA 3UTTB 1WF5A 1Z2KA 2E7BA 2J1KA 3UAJC 2A9CA 1QRKA 3FH5A 3QXUA 1UB5A 2ADGB 4NOBA 3JXAA 4X5WB 3WFDL 1JE6A 3ZUNC 4F9PC 1YEKL 2Y3AA 1IIIA 1N6QL 1KEML 2WXHA 3UKRC 4N3UA 3MMEB 4QXWA 5IIEA 5IQ9A 1MHPH 4GPVA 1HCZA 5ABAA 3AXHA 5AZEL 3PWJA 4BRVA 4MNGB 5H2BA 3FU6A 3K8LA 3O2DL 3SDAD 4FZEH 2D7QA 1RY7B 1CLYH 1Y1UA 2P8MA 2YUVA 1T22A 4GLRH 1MHEA 4LCWA 3QXDA 4WU5A 4F58H 3KL5A 4U1GC 3UZVB 2OXHB 1IBFA 3PQYB 1IGFH 4ZG1A 1MFDH 2BW5A 4H40A 5LAXA 1VZ2A 3IFLL 2VR5A 3B3IB 5I1KL 2NTFA 1F3JA 4UDTA 2F8IA 1T66C 4XP6L 3GIVB 1F8TL 1LDPH 1BVOA 4D3CH 1AGFB 4H5JA 2GK0B 2XG5B 1T4KB 3AY2A 2F74A 2WNKA 5FUCE 4Y1AB 3DKHA 4Z3GA 5CEZE 3PP4H 1K6QH 3A6BL 3VG9B 2H41A 4N8VG 5JYMA 4D0BA 1T1YB 1MJJB 5ICYA 2OZNA 1KMGA 4Q9QL 5IQLA 1PKQB 4RNRB 2AJVL 2FQGA 1WIUA 4DWHA 4OJEH 2F7PA 1AGEA 1CQKA 4PVLA 5T3XE 4ENEC 1WG3A 2Y5TB 1TZIB 3B2VL 3QYCA 1CLCA 2XWBA 3V52H 1D5XA 1FZMB 4NO2A 2DMKA 4OZIF 2XWRA 4JY4A 1TCRA 4DCQA 1CO1A 4PGEB 1AGBB 5G5DA 4HHGA 2QPDB 4JY5H 1QG3A 1FLRH 2G0LA 4N28A 4P23B 4CADB 1J8HA 1WAPA 2B1OA 2OYLA 1QRNA 3TN0A 5IW1A 3RGVD 1AGCB 2HVBA 4LT7A 4L1HA 5I0ZA 3OAYK 1FCGA 3PXLA 4DN3H 1YJDH 3WY4A 3HBQA 2ZPKH 3T77B 3IURA 2WLMA 3WL9B 3GKWH 3F7YB