5I5JA

Shewanella denitrificans nitrous oxide reductase, reduced apo form
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
573
structure length
531
Chain Sequence
SAVVHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNRDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIANFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWRGRMLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
total genus 163
structure length 531
sequence length 573
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5jA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5jA01
2PM9B 4JSNC 2AQ5A 2DYRB 3NSCA 4FWWA 2XVBA 4F7KA 1NICA 2BW4A 3AW5A 3UVMA 3MBWB 1ZV2A 1MDAA 2J57A 2QPEB 4ZOZA 3DSMA 4MK0B 4QQEA 3V9FA 1JZIA 3AZUA 4GP8B 4FA9D 4AX3A 2P9KC 4PCYA 1PNCA 4P5RA 5B1KA 2BBKH 3PAZA 3MXXA 4PXWA 3EI3A 4GQ1A 4P5SA 2HX8A 1V55B 2O9KA 5AMSA 3BG0A 5B1AB 1F56A 1SDDA 2EIJB 2H47A 1GR7A 4A09A 1GYCA 3JAMg 2I7SA 5B7MA 2P9SC 4CZVA 3EWEA 3V9CA 2EIMB 2HKRA 2GHZA 3HEIB 1N6FA 2H13A 3DM0A 4YL4A 4FA7B 4XYHA 1SFDA 5FKTA 3UABA 3UVKA 3W15A 4W1TA 1OMWB 1ZIBA 5A7EA 1KCWA 1E65A 1NIEA 2UXGA 2YAOA 1GW0A 2YAPA 2YAMA 3GFCA 2DWSA 3EH4B 3ABKB 5B7EA 1BXVA 5I26A 3OKTA 2HXCA 4GQBB 3RLMD 2TSAA 3RN0D 4A08A 4QLWA 1ET7A 1IBYA 6PCYA 5CXCB 1GXRA 1SF5A 3EI4A 3SHFA 2XUWA 4X63B 5IJ7E 1TYQC 3P4FA 2OV0A 4E5ZA 1JMXB 3S8GB 4X61B 1ETJA 1GS7A 2OK4A 2AH1A 2FNWA 4A68A 1P22A 1ASQA 1WA1X 1MDAH 3I7OA 5B1JC 4OZUA 1WS8A 1NIBA 4D6VA 1WA2X 2Y1AA 5FKRA 3WI9A 4PC0A 4BDVA 2QXVA 4F2EA 5I6MA 5FKQA 4E9WA 5I28A 2QC5A 5EAMA 3WKQA 1MG2A 3FSAA 3JPXA 4XYIA 3X1NA 3K26A 2TRCB 3IIYA 4ERQA 1E5ZA 4A2LA 5FLXg 2XYIA 2XV2A 1XIPA 1OLZA 1JZHA 4GQ2P 4L1QD 4BXSV 2PP9A 2YARA 4G7QB 3SQRA 3I8EA 3ULEC 3UADA 2I0SA 5HE2B 1EZLA 3GXUB 4A11B 2FTAA 4L9OA 4HHGA 4A2HA 4CY3A 3J81g 2ZOOA 1BYOA 5F7AA 2B4EA 1SHWA 4AKPA 3S3BB 3FT0A 2B5MA 3DWLC 4A2EA 1OV8A 3JTBA 4DP8X 3JB9L 1PZAA 3FQ2A 2BP0B 3CVDA 4PAZA 2OIZA 2YXWA 3FYIB 5IGOA 4A7JA 4WTQA 1PZCA 3EI3B 1ERJA 3X1GA 3QPKA 2HLEB 2UZYB 2PCYA 4CSZA 2YAEA 4J8GA 4X60B 3NSDA 5IC7A 5THAA 2IAAC 2OVQB 3UKRC 4HCFA 4LG8A 5AKRA 5EALA 2VW6A 4YSDA 4E54B 3NJGA 2BCJB 4H5IA 3WIAA 3DTUB 3ZWLB 1J9TA 1L9SA 4A08B 2P9IC 1ILUA 1QNIA 2HKMA 4JD2C 2BO0A 4GM8A 2H9NA 1OOWA 4K3ID 4QT8A 3SMRA 4CI8A 3JT2A 5I6KA 2J5WA 5I6NA 1WS7A 3AG2B 3FSWA 2W8CA 2PM9A 5EMJB 2OVRB 5K19A 3I7PA 3FSZA 4KNUA 4ERZA 2XL2A 3WKPA 3ORVD 1MG3A 1W8EA 1TEGA 3U4YA 4DP2X 1AANA 5I5MA 2H6QA 3OTTA 2HXAA 5B1JA 2IDTA 4IMMA 3ODTA 2XL3A 3OKYB 3FS9A 4UAHA 2XV3A 1T5KA 3FM0A 3I7LA 4FAVD 3EI1A 1SF3A 1ZIAA 1PAZA 4G7SB 3JZHA 4HZ1A 3ABGA 2JXMA 1AG6A 3V7DB 2PLTA 1GG2B 1NWPA 3ZIYA 1NIAA 2AGZA 2Q9OA 3GYRA 3IN0A 4GGDA 3EG6A 2R7EA 1XB6A 2FQDA 3I89A 4DP5X 1QHQA 4J78A 4CY1A 2UXTA 2IH9A 1RZPA 3H4HA 3MKSB 3SXTD 1PZBA 4D0KA 5I6PA 4FAAB 1PY0A 4GMBA 3ASNB 1HAUA 1N6EA 4UANA 3KW8A 3OD3A 3T6ZA 2IDQA 2FQGA 2EIKB 3FYEB 3NVNA 4R7AB 5HE3B 4J77A 3RSEC 4A11A 3U25A 1E67A 2HX7A 4J81A 1L9TA 3PXLA 5H14A 4NERA 2AZUA 1AS6A 3FQ1A 3FSVA 4A2DA 4A0AA 1S4UX 2CUAA 3ZBMA 3N0EA 2PP8A 1B9YA 2XU9A 4BXVA 3IJ0A 3KRXB 2PPFA 3N2JA 2JKWA 3TBCA 4FHLA 1A4AA 4E9SA 3AG1B 3FPXA 4ZOYA 3FU9A 4OWRA 3HB3B 3T6XA 4U7AA 1E30A 1KDJA 2UX6A 4N8UA 2Q7QA 2CNXA 3K27A 3PXWD 3ZX1A 5CXBB 3IIWA 4ESGA 1L9OA 2XV0A 3BQVA 3CVBA 1CYXA 1A65A 1JJUB 2G9AA 3SVWD 1SJMA 2H9PA 1JVLA 2IDUA 4HHWA 1ILSA 3C5MA 2YAQA 3S3DB 2CO0C 2VW4A 2BP8A 2I0TA 2YQBA 3X1BA 2Y69B 1J9SA 1YLBB 1KGYE 4A0AB 4FA5D 3OL2A 2DYSB 1KBWA 5E9NA 4AZUA 3SFZA 1UATA 2CALA 2P80A 2QDVA 2W88A 4YVUA 3C99A 2UXVA 3CVCA 3A0FA 1SHXA 1XB3A 1N70A 1R1CA 2PBIB 3PXTD 5FA5B 4ZOVA 3BG1A 1PF3A 7PCYA 5CXCA 5KDOB 2PPEA 1V54B 5GMKn 1JXDA 1WA0X 2FT6A 4KNTA 2ZWNA 3NJHA 6PAZA 2HX9A 1L9RA 1ZDSA 5HYNB 1OE3A 3UAEA 4GM3A 3SLED 3L4OD 2CBPA 4NB7A 1GP2B 2HZHA 1KYAA 2H47C 2E86A 2YNOA 1MZZA 4J8BA 5FKSA 4BWUA 5TK4A 1CC3A 2N0MA 3NJIA 4G7RB 1IBZA 1EHKB 4E9VA 2Z2NA 3JROA 5AJAA 1AR1B 4GP5B 2RACA 4A09B 3RYMA 1NTDA 4G72B 4CY5A 3CG8A 3G5WA 4H5JA 2DV6A 2WO3B 4BWWA 1TKWA 4KFMB 3JZNA 2I85A 5EARA 3FPYA 4JKNA 5TK2A 2GC4A 2IDFA 4HCIA 4HAKA 5FXYA 3T9WA 3EI2B 5TDHB 1NPNA 3AL9A 1PLBA 2QPDB 1AS7A 1PLCA 1PGUA 4PSXB 1RI6A 3JRPA 3EH3B 4Q8BA 3ASOB 2XX1A 5I5IA 2BW5A 2H9LA 2PM6B 1L9PA 2W18A 4LG9A 4U1EI 3I7NA 4TZ4A 4HALA 3MZLA 4YVDA 1J9RA 4YVNA 2MTAA 4FAND 3CZUB 3CDZB 3D12B 4AOWA 4JSPC 2GI0A 1E5YA 2FJSA 4DPAX 5IGQA 1ET5A 4AKOA 2WO2B 1JOIA 2TSBA 4JT6C 1MZYA 1HAWA 1XMEB 3NP3A 3BWSA 4JHUA 1AS8A 1AZCA 4DPBX 3DXKC 3IJ1A 2J56A 3MMYA 1U4CA 3EH5B 2XX0A 3SN6B 2AGXA 1XHMA 4K3JB 3RMZD 1BQ5A 4K9JA 2OK6A 5A2Qg 2IUQA 5D4HA 3OM3B 2HRGA 2HYEA 1SDDB 3MZKA 4J0WA 2J55A 3GDCA 4J0XA 3DIVA 4O45A 4CY2A 1L0QA 3PXSD 4HIPA 3T71A 3IJCA 2FQEA 1PLAA 1KV7A 1KBVA 2MTAH 1KDIA 3S8FB 2H3XA 4GYBA 5H17A 5EMKB 4BDVB 2YAHA 1CYWA 3WNJA 1VLXA 2IDSA 1X9UA 2X87A 1GY2A 3NSFA 3QJQB 1J5CA 2P9UC 2YMUA 4O3UB 5HE1B 3RFGA 3CFVA 3VH0A 3F3FA 4A2FA 4GM9A 5HQGA 2VSKB 3H4FA 4GGCA 3S3CB 3SWSD 5C9ZB 3FGBA 4YSQA 1OF0A 4GZ8A 2BZ7A 1JMZB 2H6NA 4AEZA 4W9ZA 1A0RB 2I3TA 1V10A 4G71B 3CIKB 3QJRB 4N14A 4Z8LA 2VW7A 1OCZB 1AOZA 4G56B 4J73A 4Y7RA 1M9WA 1CURA 2I7OA 2XYBA 1MG3C 1RZQA 4DP7X 4DP4X 3C75H 3FQYA 4CI3A 1BQKA 3I2NA 3ABLB 1BEXA 2GC4C 2GC7C 2X88A 3IEAA 4CSPA 1SFHA 4JXMA 2HESX 4YSEA 5CYKB 1AAJA 3I7KA 2CJ3A 4IA9A 2J55H 2Z2PA 3PVUB 1A4BA 4GGAA 1QLEB 3AG4B 3V9EA 1AG0A 3UR4A 1R5MA 4ERYA 3QJSB 5D4JA 1ADWA 2QDWA 2VM4A 3L45A 2H5UA 4YSTA 4A66A 3EMHA 1PI6A 2B5NA 4A0BA 1J9QA 1OCOB 3UACA 3UVLA 3MX0B 4CC9A 4J87A 1OE2A 3IE9A 1FWXA 5HE0B 1TEFA 3F3GA 4BH6A 1JZGA 3IBOA 1ET8A 3FU7A 4JT5C 5GSAA 5IJ8E 4YSPA 2VN3A 5LDUA 3OW8A 2IH8A 2I3SA 1AZBA 2B08A 1L9QA 1SQ9A 5D4IA 3TU6A 1NINA 3I8CA 4O9DA 3DKHA 2ZXWB 4G70B 4E9QA 1AZNA 1ASPA 4F2FA 1GS6X 3OKWA 1OCRB 4O3TB 3RN1D 3VA6A 4EWRA 4CI1A 4J84A 3GREA 1JXFA 3UVOA 2P9PC 1XB8A 4YSRA 4CI2A 1JZJA 1FA4A 1RKRA 1U2VC 4ZOXA 1WAEA 1JZFA 2GB2A 1IUZA 2P80D 3RRMC 5B1BB 5IY5B 3AG3B 4X4KA 3OMIB 3PLYA 1NIFA 2BHFA 4M3HA 5FC9A 9PCYA 2R7EB 2YNNA 4PBYA 4A67A 2AFNA 1ZDQA 2IWKA 3B7FA 3ZDWA 4YSCA 3F3PA 1URIA 1B9XA 1DYZA 1SQJA 4FA1D 4Q89A 1XKSA 3E0CA 2AZAA 2XXFA 2JFCA 7PAZA 5TEFA 1DZ0A 3T6WA 5EHFA 8PAZA 5AFAA 2PPAA 1JZEA 5IT9g 3OKYA 2CE8A 3NJMA 1JVOA 1TU2A 4KO6A 3NT0A 3IKOA 3JZGA 1ZPUA 1ASOA 2AGLA 2J57G 4CZXA 2PM7B 3CFSB 4M4RB 5F7BA 3SBQA 4UI9R 4Y5RD 4PBZA 1M57B 3QJTB 2DY2A 4KO7A 1ID2A 5PAZA 4EF3A 5EMMB 3SBRA 1NZRA 2P9LC 3N0DA 3X1EA 1SNRA 2YNPA 3NVQA 5PCYA 3PSLA 4FB1D 2UX7A 4L3HD 3H56A 5I6OA 2IWEA 3PE7A 2BP8B 1TBGA 3NVXA 3PCYA 1I53A 4GP4B 3UAAA 3J80g 1GOTB 2AGYA 4DPCX 2BWDA 4YSAA 2FWLB 1A4CA 1B3IA 3NJKA 1IC0A 3PAVA 5I5JA 2CO0A 3EI2A 4E9TA 4ENZA 2FT7A 3KW7A 2AH0A 4GXFA 2A3TA 3N55A 1K8KC 5FQDA 2UXFA 5ANHA 3I7HA 3T6VA 3PPSA 4BUJC 2FQFA 1KCBA 2EINB 3HFQA 2QT6A 1RCYA 3TASA 4HCGA 2GC7A 1A3ZA 1W6WA 3X2QB 1BXUA 4AKQA 1AACA 2G99A 4QRJA 4ES0A 4O1QD 2BZCA 2GSMB 3EF4A 2CAKA 3QJUB 2OVPB 3WNIA 2IAAA 3AFCA 4J82A 5CXBA 2CCWA 4X3EA 3NJLA 3C9CA 2FT8A 1OE1A 1FFTB 5EM2A 5AFU3 1NR0A 5B4WA 3NSYA 1JOFA 2MRYA 5GXHA 3AL8B 1JERA 3NJNA 5GXIA 3EU7A 3PAUA 3V5WB 4KO5A 4BL0A 3UKUC 2ZONA 2GNQA 3EHBB 5CYKA 4XEIC 3QJVB 2YXVA 3AL8A 1CUOA 3IN2A 5B7FA 1YFQA 2H68A 1NWOA 3UVNA 1J5DA 2WSDA 2CE9A 3L4MD 3PSCB 2VMJA 2H6KA 5C2VB 2YBAA 2AGWA 2IUVA 3WG7B 2B5LA 2GBAA 4CZYA 1X9RA 4NAJA 2B3IA 1GY1A 2OJ1A 3FU7B 2Q5BA 1M56B 2XXGA 3FU8A 3NJJA 3OMNB 2BP0A 1A8ZA 1N6DA 4A2GA 3CDZA 2VM3A 3KRWB 3OQRA 4FA4D 4E5ZB 3ABMB 4L3GD 1AZRA 2DWTA 3EI4B 1HFUA 3PVWB 1BAWA 4YSOA 2IWFA 3C75A 5SXMA 2AANA 2YAFA 2UZXB 4AI7A 4PNKB 4YSUA 1PCSA 2BWIA 2VSMB 3SCYA 5TEEA 3SBPA 2PPDA 3TBBA 4I79A 4JHVA 2PCFA 4QL1A 4BK5C 4HDJA 1NDTA 2I0RA 5EMLB 2YB8B 3AH8B 4QKTA 4A2MA 4DP9X 5EM2B 2GIMA 4E54A 2XWZA 1IKOP 2HJ4A 4WKXA 5AZUA 1PBYB 4J79A 5JWZA 2OCCB 4YSSA 4KO9A 4J86A 4LGNA 3ERXA 1AQ8A 1VYHC 4E9RA 4MFHA 2Z2OA 2H9MA 5K1CC 2IURA 4KNSA 1NIDA 4ZN4A 5B3SB 4PSWB 2H3XC 4A0BB 1MG2C 1OCCB 3RFHA 1NEXB 4KOBA 2PP7A 1BYPA 1PMYA 5I6LA 1SHYB 1BXAA 1PNDA 3SJLD 4RH4A 4DP0X 2NRDA 1W6LA 4UF7C 4E9YA 2PPCA 2J56H 4ZK8A 3TA4D 3OMAB 2HRHA 4N4YB 4E9XA 3VGZA 2HJBA 2EILB 1GS8A 5EAPA 3X1FA 3FRXA 5C2WB 2XLLA 1K32A 3NP4A 4GY4A 3BVDB 1Q47A 2CN2A 2EBSA 3EI1B 3NJFA 4DP6X 4NSXA 5TF2A 4KOCA 2H14A 1N68A 2OJYA 3NYKA 4JSXC 4DP1X 4BWTA 5H1MA 3DXMC 2IUPA 2LLNA 1JXGA 2XU7A 1GSKA 4JSVC 2AVFA 1PEVA 2P9NC 1AIZA 3AY2A 3QQXA 2CN3A 4TXVB 1AZUA 3OL2B 3UGEA 4L0PB 1BQRA 1NPJA 3MKQA
chains in the Genus database with same CATH superfamily
3QWRD 3VXQB 1GCFA 4ZTOH 3X12A 4XP9L 1EMTL 3ARFB 3DSMA 3KPQB 3V7MA 2X2IA 4XB7A 4HIQA 4B9GA 4NS0A 2X9YA 4I1RA 3T77B 1PY9A 1RL1A 3C87A 4PXWA 1YMHA 2IAMB 4B9KC 2PETA 3FONA 1SXBA 4ZFOB 2DQHH 2BS9A 2H47A 1EH9A 4A09A 3JAMg 4HZAA 4DN4L 4JHAL 1PEWA 4XYHA 4X99A 4GUQA 4UT6L 2BC4B 4WGKA 2HMID 2X1XR 1LQBC 4O02B 3VDBA 1H6UA 1LK3L 5HDOA 3ZPDA 4UUJA 2QSQA 3FF8A 3JWNC 4YAQA 4UIKL 4GUOA 4PVBA 1ZSHA 1G9MH 2IFGA 2GPZA 2WIIB 2CXKA 3TOPA 25C8L 1GJWA 1OAXH 2OP4L 3D06A 3GNMH 1N8ZA 2CUHA 3NK4A 1OAQH 1QWHA 4P9MH 3QO0A 3VFWA 3SE4C 4F9LC 1ETJA 3L7FA 3RVWD 4E41B 4ICWA 3SDDB 3EYSH 4A68A 4Y1SA 3BFWA 1ASQA 4NGHH 1IV8A 4U7KA 5EO9A 4FI6A 1RULH 3VI3B 3BAXA 3GMOA 1JZ4A 3NZHL 3VXNA 1WZLA 3JPXA 1IFHH 5GRVK 4J3OC 3RA7L 1MFBL 4PY7A 2A0LC 1HQ4A 4BFJA 5JHMA 3LRMA 4PJHA 2A73A 1BHGA 4QD2E 2V7HA 4UT7L 5IOKA 1EIBA 3MX0A 1EUUA 4HXAL 4MASA 4PJEA 2XZZA 4L9OA 2GTQA 4X2UA 4CY3A 3HS8A 1M7DA 1EXUA 3K3QA 4NWTH 4PR5A 1QSFA 5G55A 2HTKC 1DJIA 1JPFB 3TA3A 1TQTA 2CNYA 1AIFA 2ICEC 2WZAA 1ORSA 3SODB 3FTGB 3TBVB 4WDIB 5E6RB 2GJRA 2HJKA 5IT9g 4RLDA 3MFGB 1YNKL 1NCWH 3MLZL 3R18A 4N90D 4FE9A 1OZUA 1KN2H 3I85A 5IHWA 3ARQA 2VW6A 3MV9E 1MEXH 4X0NA 2UYLB 3N85L 3RWCB 5IUSA 1OM3L 3B2PA 3P2TA 3MNWB 2IG2L 5M5TA 5BQ7B 2EDFA 4ODTL 3HN3A 4PG2A 4DESA 1Z0MA 5C9JB 1KB9K 4GG8A 1JWMB 1MHPL 2C26A 4LSVH 4Y19E 2G9KA 1JUFB 1AKJA 3DETC 2J72A 4FFYL 5HVGB 2H6QA 3BE1L 2N1KA 3HE7B 4KI5F 1IFHL 4F1ZA 4MLSA 3TIEA 4JDTH 2I24N 5CUSL 3FZUC 3QHYB 2R2HB 4GKSB 1R3LB 5JLZA 4RRPM 3EHBD 2NY2B 5EULV 3BVNB 4HZ1A 3UH8A 3ABGA 4MAYA 1IM3B 1PAMA 2R1WB 2ZCLL 4QHPA 1CF8H 3EYSL 3AM8C 3PWLA 4A55A 4W70A 4Y16D 4NHUA 1RZPA 3HI5H 3BKJL 4IRJB 4X9GA 2IMMA 3K91A 2L7UA 5MENE 1KYDA 1U92A 25C8H 1V7NH 2JJTC 3CTTA 3MQIA 1XGUA 2XTLA 2DTSA 4FFVD 3IKCA 4HQQL 4QAMB 2FATH 3AG1B 3ZKQD 3F7KA 4OZHA 4GW4A 4IKKA 5CJ5A 1L0XA 5AOLA 3WTYA 4XCNA 2ZX8A 1RIHH 3VH8G 2OZ4H 3ZTJH 3BN9D 1AMXA 3PXWD 4PJIF 4QT5A 1L0YA 1JJUB 3L9RA 4GKLA 3GC3B 2FAUA 3KR3L 4OB5L 3UTSB 3MRKB 4GI6A 3DPDA 1JK8A 4NZRH 4ODHH 4RRPA 3GSUA 3GPSA 1OGAB 3IDNB 3QFJA 4S1SH 4XGZA 3W9DA 2BHUA 5E9NA 1ES0A 5DI8B 2DJ4A 2HT3C 1IAII 4NN7B 4B7LA 5JIPA 3AS2A 3CC5B 2V5YA 1P9MA 1NAKH 2BVOB 4HIHB 3WJLA 3PXTD 5FO9A 3CXHJ 1NCJA 3V0WL 1O6VA 4C55A 4PJIA 1F5WA 2YD6A 1D5MB 2ZWNA 5SWSB 3U7YH 2VLKD 4NQDD 4AIZB 3HAEG 4OI8A 3FQUB 3TA3B 2E47A 4PJXF 1A4JA 2HU8A 3BAYA 2WWKT 4OZGB 3TO4C 1HI6A 3BRFA 3CPLB 1OSZB 4FL4B 1FRGH 4KHXL 4GP5B 4A09B 2A1WL 2FX7H 3WE1A 5DJ8A 3KWTA 3DGDA 3O11A 3CFQA 3B3IB 2FR4B 3RGVB 4JR9H 3CN2A 5EOQH 3GJFB 4HCIA 4M03A 3SN6N 4RGMC 1EVUA 4IGBB 3W81A 4ZD3H 5IBTL 3BXNB 4JN2A 4Q8BA 1X44A 4HP5A 4U1LA 2E6JA 2X7LA 2B59A 3GXMA 3LIZL 3JYCA 4H8UA 3PFQA 3FB8A 4ZW7A 1KJ2B 3JVFC 4ZMYA 3LYRA 1JOIA 2W60B 3KH3A 5DD6A 3MKGA 4TNEA 3HMXH 2BOLA 1N6QH 5CEXA 3PL6D 1U4CA 5DC0A 1FE8L 5A2Qg 1ZWIB 1IM3A 2H2SD 5AVUB 1U8OB 2IUQA 2I26N 4OCXL 1ZOXA 3QCVL 5DS8B 1WWWX 3SDAB 3WLBA 4WK0A 1XGZA 2ZUQC 3H9SE 5J0BA 3NIFF 2X3CA 1D5IL 4POZC 1KDIA 4OV5B 1HE7A 2AV7A 2CKBA 4GXVH 3LIZA 1FYTD 3NSFA 1X9UA 4PY7B 1FNSH 1ZE3C 4O02A 1NEZA 5BZWB 3V0WH 4JFOB 1FVEA 3MOBH 3EJJX 1G4RA 3LPWA 3BH8A 1TZIA 3BQUA 2GTZA 3KXFB 2VDKH 1A0RB 5GGRA 3RB7A 2WQXA 7FABL 2I3TA 3MRGA 3D0VA 4YNYB 4AQEB 1RUPH 3C60D 1H6TA 3ZE0A 1KG0A 3ZE1E 1M7IB 1T22B 4U6XB 2B77A 4LLVB 1AI1H 4YSEA 3ELAT 5L2JB 1VFUA 2F53D 2PCPB 2PNDA 4OZGF 5KOMC 5FUCE 4JKWA 2WLHA 4OU3A 5JDSA 2GITB 2DWDB 5FX3A 3ZQ9A 3ZRSA 3ZL4L 4TQEL 2QDWA 3KGSA 5D7JD 4LHJB 4WI0B 3GSXB 3T5WA 5CAYB 3G5XB 5JW3H 3RDTA 4H0LC 4RFOH 1TEFA 5HE0B 1HL9A 2VDLH 1JZGA 2MOVA 2WBJC 4WU7B 3ZQWA 4NQCD 2WJ7A 2WAHA 4PYHA 4LAQL 4DJMA 1J18A 1F3DH 1GOHA 1OP5K 3JV5A 3LDBC 4U1GB 2EJ1A 3V4PH 1L9QA 4CC4C 3B9AA 4KZDL 2ICCA 5MENA 5C6WH 2G2RA 2XJKA 4Y8AA 3VI4F 1N7MH 4U6XA 4E9QA 1Z9LA 4NFBA 3L3OC 4FQPA 1U3ZA 4PBVC 1AO7E 1TTGA 4WWPA 2EH7H 1B9KA 4D0CA 1JZFA 2GB2A 2NNXA 3WJMB 4OD3H 1UOPA 3BZEB 3CZGA 1B0GA 2IWKA 3QUZD 2VH5H 4Q6IC 5EB9A 5GZND 5LXGL 2COVD 2QR5A 2ZG2A 5A3IC 5F3BA 3MOAL 5F0PB 5KVEE 4U1MB 2GY5A 3LKPB 1IGIL 1BV8A 5F1OB 4KJYA 3D2UB 1KJ2H 1WZKA 3FTVA 3OZ9H 4OJFH 4XWGL 5DEZA 5I15H 3KBEA 4C56E 3HOGA 4QHMA 3ZTNL 3BWUF 4OF3A 3WY1A 2PM7B 3CFSB 3WHXB 1WZAA 1JYVA 2HVKB 1LEKA 1U8OA 4ENEC 4ZAKC 3UOAB 1OAUH 1E3ZA 3NCJL 3SBRA 1I8MA 4HDIA 2XICA 3NAAL 5ALCH 4D0DB 2OXGA 1F97A 3IPFA 3WJMA 3ILPA 4DK6A 3WFCH 1TBGA 3NVXA 1AC6A 4LLMA 4L2LA 3UAAA 5ELIA 2IBZY 3CX2A 4PW4A 3HE7C 3TBWB 5LUMA 2GABA 4WUKL 4H0IA 1TZ8A 5I5JA 3ZE2B 1GCYA 4R90L 4NNPH 3X12B 4GRLD 1E9QB 5GGRB 4XBEL 2NR6C 4TQEH 1RCYA 5DUBA 4ZZKA 3HFQA 1PKQE 2GC7A 5LBVA 5TH2B 3RWIA 3WO3B 5HXMA 5CIPB 4LSTH 1YEKL 2BZCA 3M8OL 1DZBA 1H8OA 4X6CA 5DMGD 5CEZD 3SGEH 4XCCL 5SWSE 3N5AA 1UZGA 3JBG7 4AYBA 5DK3A 1OGTA 3QIUA 3CLFH 3OKNB 3ZO0A 3C9CA 1XF3B 2F58L 3EGXB 3HAEA 1ZT4B 4FFZH 5GXIA 2Y5TA 3K5SA 3FSOA 4LCCB 2WXOA 1MRFL 3GSWB 1AGDA 1UGNA 2WKLA 1AYRA 3GIVA 5EUOA 3TVMA 5KJ7E 1O75A 4YHLH 2IUVA 2H8PB 5JXEC 1J5OH 4APXA 3FDWA 1EAJA 2RALA 3D6GA 4PGCA 3UZEA 3KPRD 4PRNA 2OJ1A 5KYYB 3QDMD 4UDUB 2L7QA 5MP6L 2Z91B 5IVZB 3A0OA 1XGYH 4M61A 4MS6A 4RRPG 1JNHB 3SPVA 4AGQA 4LARL 3DUSB 1NANI 4MJIA 3Q43A 4C56B 3R06A 2EBSA 3EI4B 3VUAA 2RQ8A 2BS8A 1XBDA 5ALCL 2DL2A 2OR9H 2ADFL 2Q6WA 3SBPA 3TC9A 2F54B 3VH8A 4OCYL 2XFXA 2PCFA 4JO4H 1P5VB 5M5VA 5SX5K 2RH0A 2B9BA 5L6YL 4W9DC 5DCCA 4DP9X 2ZKMX 4X9YA 1RIVL 1DQDL 4HJ0D 1TCRB 1AO7A 1TJHH 3GFUA 5E8NB 2QHRH 4YSSA 4J86A 2CA4A 1CE1H 2H6UA 5AW8B 1A7RL 1FCCA 3KLQA 2YJQA 4W9IC 4ZTOL 4LU5L 4PSWB 3F7VB 3VGAC 5C0CA 1G7PA 1T7XA 1KBBA 3RFHA 1XCXA 5D2NC 2CLZA 2ICEA 3VFPB 3EADA 2ZUWA 3PV7A 2NRDA 1W6LA 3U6XA 1F41A 3ZYJA 4E9YA 1P4BH 1IKNA 4UBDD 1R47A 4CA4A 1Y6NR 2B1OA 3APDA 2XTJC 2H26A 2GW5A 2HJLB 1I1RA 3NP4A 4TM9A 2GIXA 2AK4E 2YZ1A 2YSTA 3BKML 4X9IA 4Z7UA 4P49A 3OKOB 4DP6X 2DJUA 5TF2A 4EVNB 2CIIB 3DXMC 1JXGA 1KJMA 3M1CA 4UM9D 2CDEA 2XWTA 1ZHNB 5K39B 4DK3A 4UWQB 3UEZA 2CN3A 3FT1A 1NQBA 3LS4L 5A6LA 2DLFH 3CCHA 4H20L 3VNYA 1IVTA 3WGVB 1DR9A 4FERA 4UU9B 5KJRH 3SD2A 3U9UB 2P5EE 3QYCA 2CBMA 4OZHB 1UWEL 4P2YA 5HJBA 1W2KT 4H40A 1ED3A 1IQWL 4AX3A 4Z3HA 5DHYB 5GS3A 4APQC 4ZW5A 3PAZA 4JHPC 1KIPA 1XSKA 4MDJB 5DHDA 2P5PA 3VYPA 3ZR6A 3BDXA 1DVFC 1WHOA 1SDDA 3IMUA 5B22A 3TN0D 3VG0L 5FFOA 1QZ1A 2VIRB 1SEQL 4U2YA 4U6VH 5B7MA 3KS0J 5HDBE 3EFOB 4JFDB 4IIQC 4Z7QB 1HJBC 4J39A 2APWA 3EWEA 1D9KC 1DVSA 3S2AA 1N6FA 2R39A 2WGNB 4XVUC 2BJML 3UABA 4A7SA 5HPMB 3Q6GL 2KKQA 1R75A 2KERA 2X41A 4RZKA 12E8H 3MUGA 2IFFH 5KBKA 1MW3A 1PZ5A 1JHKH 3P11L 1S7RB 4K7FA 4OZFH 4JQXA 5F9JB 2XKSA 2NY3B 4YDZA 3R8BB 1FHNA 1N0LB 2OSLB 4MDIA 1QABA 3GHEH 1TNMA 4TPRL 3ARFA 1RUMH 2XUWA 4H5SA 1BVNT 1YJDL 5T5FL 1VFBB 3VXSD 2DMCA 5L4MA 5JPNA 1S3RA 1BG1A 3LEYL 2ZCLH 4XN7A 5E2TH 3N04A 3VU2A 4DERA 5A2JH 1S9KC 2ZKHH 3ES6B 4AVHA 3NIGA 3VMPA 1YVLA 1T6VN 2OQJA 4LEOB 15C8H 3WKQA 2XZAL 4M6NL 4BV1A 3DRTA 3Q5OA 3B9KC 4UMSA 1AR1D 1X5MA 5C71A 3A6BL 1KELH 3LQAC 2K1MA 2PP9A 3P0YH 4FLSA 4IBSA 4X7TB 1OP3K 5FGCE 4LXFA 5E5MA 5IBTH 1IGJB 3LN4B 5TDOA 5C7XH 3OGOE 1C1EH 1CI5A 2KZKA 1JHTB 5CGTA 1JK9B 2KZ1B 3QNXA 2B5MA 1J1PL 1JUFA 2GI7A 3CHRA 5IW3A 5GZOD 1PZAA 2ZJSH 3UJTH 4EXPX 1KPUA 1T5WB 4IQHA 2AEPL 4XAKD 1E5CA 1I7RA 3IU4L 3K6OA 32C2A 3QQ4A 3ULUC 5HHVH 3UKRC 4HCFA 2EVGA 1YECH 2HSIA 5EALA 5DMJB 4E54B 3FT4B 3QUZA 4PJXE 1S3KH 1CLOH 1RUQL 1QNZH 4ADIA 4MXVF 2RGSA 3VI3E 1S7UA 1QNIA 2DYPA 2WZ0A 3I3DA 4Y1AD 1S9VA 5SWQA 3EHBC 5BS0A 2FIKA 2LOEA 2V9UA 1U58B 1BMWA 5DUPL 2DEXX 2PM9A 1OSYA 1IGYB 1OT2A 4XVSL 5JO5B 2A9NH 1RD6A 3L54A 5KANI 3BW9A 4I1PA 1R3JB 5IEHA 3D07A 4TUJB 1RUKH 1XIWB 3D8MA 3HBQA 3ODTA 5GJSH 2Z1PA 4NQCA 4P4RA 4A39A 2HT4C 3DPBA 3TX4A 3CSFA 4KKPA 1U8KA 3KR3H 4F9LA 5IJCC 5IBLC 3FT4A 1O7VA 1PYWA 1NWPA 1RHHB 3GLDA 3T4AC 2DKUA 1UEMA 3IVKA 4MTMA 4NAMA 4FABL 4J78A 2W91A 4GKZA 1MNUH 5K69A 4JVPA 4GQQA 5CMAA 1RP8A 1D6VH 5AAMA 1MJ8H 3TN0C 5FO7A 5LBSH 1AGFA 1KB5B 4OT1L 4WHTB 5H14A 4W9EC 4JFHE 3N0EA 3IJ0A 1MLCB 4W9FC 5I6XC 2NXYC 4HUXA 3HA0A 1ZA6A 4HHAA 5J3HD 3GSVB 2XA8L 5DDHA 1KENH 3JTTB 2BVQA 4ECNA 3RUGA 5CXBB 3KNBB 3BMVA 1UA7A 2NX5D 3KVQA 2IDUA 4LCWB 3KS0H 3HNVL 3RWJA 1E9OA 4J4PC 4PJXA 4F24A 5FW7A 3VD2A 1ZRUA 1YYLL 3QUYC 3U6XS 2MNUA 1MCHA 4HS3A 5T5NG 3QORA 3P77B 4L8SA 2A74A 3ZZ1A 1F58L 5DTFB 5DUPH 1NBYB 1T4KB 4PJ5B 3MZGB 5CGYC 3INOA 3WXVL 2X70B 2BHZA 2CJUL 5GGTA 4QRPA 3SO3B 4KNTA 4PJAB 4Y2OB 3GSVA 3PGFL 5MEPB 2X6AA 3SQOL 3TEUA 1KYAA 3P40A 5DHVH 2E9WA 4QHNB 3T0EB 4J8BA 1Z2KA 5FYJH 3DXAB 1FI8C 3SY0A 4X7EC 4UIMB 4XNBA 2AEPH 3EFOA 3MV7B 4JFDA 4JFXB 1B88A 2QSCH 1WIUA 3N9GL 2ZJSL 3UJTL 4KFMB 4J6IA 4F7EA 5KSBE 3RBGA 4PSRA 4AWJC 1TVHA 4FHKA 5E6IA 5DTFA 4UZSA 3BFOA 2IJ0C 2WJ5A 3TZVA 3D39E 4P5TB 2UY7A 4OCSL 1NLBH 2MSPA 3DO4A 1NCCH 1HESA 1KY7A 3BAEH 3UBXG 1ZS2A 2W92A 4CILA 5JHDB 1H2ZA 1UB5B 4PB9L 3T0AA 5KVEL 2GI0A 1ZLSL 1MFBH 3L8QA 4PRIE 4LCYB 1DBMH 5J9PB 3BWSA 1N67A 3MMYA 3SN6B 3PU7A 3GLAA 4K7PY 4QYAA 3MRBA 5D1ZB 4ZW6A 4LKCB 1GVIA 4M1CC 4F3FB 4IOIB 2P26A 5C1MB 3PXSD 3B4NA 3T4AA 2ZUVA 1PLAA 3MOQA 3WNJA 2WMPA 2IDSA 5D1XD 2MNJB 4I0CC 2D0GA 4H88L 3ZKMC 2K45A 2FYYB 1OAXL 3GNML 2A6IB 4X6BA 3O41A 4KJWC 3W38A 1Z9OA 3H4FA 4BE6A 3ZDYA 2H9GA 1SQ2N 3WTUA 2ESVD 4Z8FH 4Z3IA 4DGUA 5AW3B 2QLYA 4ZDHB 1TYEB 1DJWA 3CIKB 4ZQTA 1I75A 4Y7RA 1ZANH 1IM9A 1UGKA 3PHQB 3IYLW 3FQYA 4HX1B 3I2NA 5JQHC 2DTML 3W0WD 4HK3J 3RY6A 3IEAA 5B4MC 3VRIA 5DJDA 1PQZA 3DX4A 1A25A 2WLYA 3COOA 5GGUA 5I24A 4PJCB 4S1QL 2OQJB 2OPCA 3AQDA 2IPTL 4JFFA 4LB8A 1R5MA 4MCYB 4LVHB 1W0WB 1LDSA 5HHXH 2P24B 1BM3H 4TSCL 3SZKC 3DSNA 1PDKA 4RMTA 1SJEB 1T0PB 4OVVA 2I07B 4PHZA 3NSXA 5GRZA 4YHMH 2A6DB 2HVBA 3GMNA 3NCMA 4X6EB 4YQXH 2VC2A 3O8XA 2CKNA 1ZGLA 2RR3A 3F83A 2ZUQB 3BO8A 2NQ3A 1JZJA 3C2SA 3D34A 1Y1DA 1J1XL 5IVXF 1EO7A 3PLYA 5DLML 3B83A 4U33A 3GZKA 2JB6A 1QFWL 1H15A 4RQQB 1OAZL 3HLAA 5KZCD 3HMWH 3NEXA 3C5SA 7PAZA 2GSIA 3GGWB 2GUOB 3KPSE 2NNRA 1D6EB 3DXAD 1JZEA 1G87A 4ABWA 2LHAA 3U4EA 1UACL 1ZVHA 4JN1H 4XHJC 2DQGH 2O61A 4R2GC 2NDGA 4EF3A 3DJSA 4MQTB 2KMWA 4GH7B 5IESH 3MA9L 3PABA 4N0FA 4FNRA 4ERSL 2Y36H 3L9RB 1AD0B 2BP8B 3FB5A 3L3OB 3OAYK 5JIDA 3L3IB 3CFKB 4YZWA 3UDWA 1BPVA 2W80C 2NUPB 4BFFA 5CCHE 4H8QA 3LV3B 3CZSA 3JT0A 5IB1B 2A3TA 3T3PF 4HJTA 4PJIB 3KPRE 4DO6A 1K8KC 4G6JH 3B1TA 4BZYA 2WANA 2V6HA 1EJFA 4OAWB 1JN6B 1TPXC 4ZDHA 2FQFA 4TNVF 4F8NA 2EINB 2I60L 2QT6A 4FZEH 5EU5A 5DO2C 4WO4D 1AFVL 4HYTB 5T3ZE 5EZOH 1MNNA 1FYTB 2AK1L 5DMKA 1MHEB 4X83A 1RJYA 3L4YA 2ZXDA 4A7QA 1CFVH 2HKHH 2JJWA 1DFBH 1TQVA 4PJAE 5GS2D 5SX4H 2XKNA 4OCYH 5IMLB 3FCUA 5CXBA 4X3EA 4M8QA 5AFU3 3AREB 4XMPL 2X4NB 3NJNA 3GEFA 1P6FA 4OCWL 5LWYH 2YXVA 3LKQA 3TFBA 4ERZA 4I1NB 4PV9B 1V05A 4NYLA 3W82A 4ELMA 1GAFL 5C0AE 2AGWA 4ZO9A 5EUKB 3DK0A 4NAJA 3ISWA 3QQ9D 3N1FC 3IDYB 5C9JA 1EGJA 1T3FB 3EBHA 1YPZB 4NKOA 5EIQA 1M56B 4M5TA 1DJYA 2EYSA 4R3SA 4GW5B 4NKQB 2OLDA 5DJ6B 1RY7B 5SXMA 3LRKA 3L5HA 4OCWH 2UZXB 5GS1A 3LDBB 3BWAA 2Z92A 4KKRA 4QRPD 3AB0C 5A2LH 3GXNA 2WD0A 3SCYA 2CG9X 4P46C 1MIML 5JXAH 2PPDA 4PRAA 4Q14A 1WD8A 1BFOB 4QL1A 3W57A 4Y4FB 3QORD 2P5WA 1ZXKA 3UBFA 3MV7A 4JFXA 3VSUA 4WKXA 4ODWB 1PZ2A 4NLHA 3UEQA 3ARDB 1UYWL 2VE6A 2CO4A 1MFMA 2PUQT 3B37A 1IGIH 5DO8A 4E9RA 4JFWA 2G60L 1XF5B 4GRWB 4ORGB 5B3SB 2A6JA 4QLRA 4HS8H 3PPEA 4JG0L 3IUJA 4A0BB 3CN4A 5K33A 4QYOB 4A63A 5MERB 4X6DA 4B3EA 3ARGC 2NOYA 2KHAA 2JELL 2Y7SA 5L88H 1YY8B 3WU1A 3QQNA 5DJZA 2DQJH 3Q44A 2VDPL 3X1FA 3ZKXB 3FRXA 4M7ZB 3MV8D 1IBGH 3MA9H 4AGLA 4PRPD 1OAUL 3NCJH 1HC1A 3AGVA 3V5DA 2V17L 1LL1A 2BY3A 1L9NA 5E6ID 2DD8H 3NTCH 2E7BA 1AIZA 4XHJD 4XE0A 4KQ4H 4YHKH 2G3XA 3BDBA 5FA3B 3S88H 1PBYA 1YO4A 5EF1A 3KDPB 4HS8L 4MJJA 2PM9B 4FXLA 3RWFB 4EKXA 4G6AC 2AQ5A 2W0PA 5HI4D 4WY7H 2BW4A 3UYRH 4PJGB 1L3NA 4K8RH 1BQSA 1ZA6B 1C7TA 4HHAB 4GP8B 1X7SA 2AEWA 1MH5A 4U1LB 1CXEA 3P4OB 4P46B 3G6AB 3VXMA 4A6YA 1NGWA 5MEQB 2IPUK 3M07A 1KJ3L 4P5RA 4UZUA 2JI2A 3SE9H 3MXXA 1UWGL 3DHMA 5L7XL 2O9KA 3LHAA 1IAKB 2LU7A 3DO7A 4Z95H 2QGDA 4O58H 1UOLA 4W9HC 4F93B 2E7HA 4GKZB 4EO5A 3BZEA 3DJZA 4BZ1L 2JKSA 2WXQA 1NC4B 4LVHC 3RVTD 1ACZA 4AK1A 5ADPL 1JTOA 2Z31A 1A6AA 4TLUA 4WHYH 3EH4B 1ZK5A 3Q06A 2PN5A 4UTCA 4ZI8A 4KJPD 4XT1C 1OARH 5CR1A 4G8GE 2DL9A 4G6ML 2VJ8A 2X89D 5DMYA 1BFTA 5GRXG 3BRGC 2FK9A 4X63B 3ATBA 2RD0A 3S36X 1HXKA 1F4XL 4G80B 3BWAB 4X61B 2X44D 3BEWB 2FNWA 3KPSB 2XQYG 2DQEH 3EGSA 1AI1L 4LEBA 2F8XC 5B1JC 3PWLB 3MV01 4YE4L 4POYA 1BREA 4P59L 2V8LA 5DD1L 4XBMA 4JZOA 3FSAA 4AEFA 3QCTH 2VDMH 1F3JA 2CA3A 3G08B 3TO2B 4PRHD 2XYIA 1MFEL 2B16A 3DYPA 1IZKA 3QARA 3ULVF 4RMUA 2JMRA 2DW5A 4G7QB 4V1DA 4WWKB 1UWXH 4OFVA 3ULEC 2P8PA 4K7FB 5HE2B 1EZLA 4HK3N 4A11B 4YPJA 1IGFL 2BERA 1UXWA 2HG5A 5D1ZC 5D9SA 4M7LH 3FT0A 5C0BB 1JGDA 1LJMA 5CCKL 5L0QB 4R2GB 4LE8A 4MRBA 4F2MB 3OR6A 5J8OA 5FYLH 1LO4H 2VNCA 3RFRA 1FN4B 5DC9B 2EO9A 2Y7OA 3US1A 4NO0D 1XEDA 1EDHA 2VB5A 4G43A 1A12A 3EAKA 2X4TB 3Q3GB 1VZ2A 3VMOA 3VFSB 3QUXC 5JW4Q 3K71A 2XVLA 3ECUA 3LXAA 1BGXH 2ITDA 2CDFA 3FH8A 3D48R 4N0CC 5GGSY 5M95B 3DXAE 2NY5C 2BO0A 4GM8A 4JM2D 2DI8A 4UTBH 1W80A 1LP9E 5K9JH 4PVLA 2OJEB 2HG5B 4MD4B 4KNUA 3VTMA 4Y5YB 5IQ9B 1CGTA 2WXFA 4U4BA 4G6KH 2DWEB 1MELA 4DFIA 3KGTA 3OTTA 1NCIA 5JOPD 1J0JA 4KX8A 2XV3A 1CBVH 1GHFL 5EFIB 3MRRB 2VQTA 3EI1A 4OLVH 4U3HA 4A7GF 1FCGA 5ID0B 4HD5A 2FZ3A 4N3UA 1TKWB 4UT9A 3T4AB 4HIIB 2XKNB 1NAMA 2Q9OA 5ISZE 4NQED 5KTEL 3EG6A 4XH2B 1SRDA 5CBAA 2UXTA 1JS4A 1PG7H 3FMGL 4DQOH 1QHOA 1PY0A 1P7HL 1N6EA 5LJYH 1UM6H 3U0WL 5KYWB 4AUYA 1TEYA 4I5BB 4MD4A 5DJYB 1Z5YD 1HINH 5F3HB 3W2DL 4NERA 2D4FA 1JXJA 4A7GA 3OVUB 4U1HB 1WLHA 3IJHA 3ZKSD 4EN3B 1MI5A 3ULUE 3A24A 2EXSA 1GGIL 3DWTA 3PGCA 5ADPH 3CIQA 1JIBA 5BVPL 1FF5A 1T0NB 3KEDA 2CHNA 3I6LD 3KLHD 5LLIC 2UX6A 5C09B 2R15A 4HT1L 4LHUD 4PV8A 2L8AA 4U1NB 2D3JA 5C9KA 1D5ZA 1BOYA 4H1LG 5D2NA 3FJTA 1NUNB 3U1SL 1R4XA 1O0VA 3KL0A 4N2HA 1NKOA 4RAUB 3THML 3MGOA 1ZHNA 4ZRGA 1ZTMA 3KYKH 4P2QB 1MI5D 4KTEL 1MCQA 1OWWA 4AE0A 3GMPA 3S34H 4HFWA 3S37L 3TBYA 3SOBL 1HL5A 3DGGA 1KIQB 3SDCA 4LAJH 4HV8A 1C5DA 2EYRB 2D9CA 3H3BC 4Y19D 1TJGH 4JFZH 2V4LA 1E6OH 4Y9BA 2L3BA 5BZDB 2H1XA 1OM9A 2ATKA 7PCYA 4Z7UF 4KKCC 3DBXA 3HC3L 3GBDA 1QFWI 3C5XA 5I0VA 1JZ8A 4JO3H 5EPMB 2CNZA 5FKPB 1QPXA 2ZUYA 4L5FH 3BZFB 3W39A 1DFXA 2BIIA 2CLVB 3MRJA 3L4OD 4QAMA 3S9DB 3Q6FB 2GJ6B 3B5TA 3GSQA 1MUJB 2N0MA 3HG1D 1G9NH 3GSRA 1GGCH 4Z7AA 4RESB 2Z2NA 5IOPB 3JROA 1WV7T 4WNQA 2H32B 4X99B 2AEIT 5EU6D 1A6WH 4ZO6A 1Q0YL 1XH1A 3QI9A 1OD7A 4TKWA 5I19H 3GXDA 5JDSB 5GJSL 2DIBA 5KS9B 1Q1JH 2P8MA 3CX5J 3GBNL 3U48A 4JQVA 1NPNA 3QA3B 1K5NA 1JZDC 2D03L 2R0LH 4NM4L 4ELKB 3RWDB 2RFXA 1QHPA 4UT7H 4FDWA 4ZUTB 1P4LB 2BVPA 5JMRA 4L2YA 1OTTC 1OB1A 1J8SA 1U41A 2K0RA 2KPWA 4QXUL 2N1TE 5C6PB 4JSPC 4HWEL 4F9PA 1SXAA 4BK5A 5JR1L 1A3LH 1MREH 4Y5XC 3QZWG 4I2XB 5IJVB 2BZDA 5E9AA 3WD5H 1JF5A 1UOKA 2HFFA 2J56A 2EDKA 2WCSA 2B39A 3ARXA 2R0WL 4HGWB 5KSUB 4Z7NA 3ARFC 5D1QD 1AXSB 3OSKA 3LKRA 1UT9A 1UKTA 3IU4H 3EOBA 2CK2A 2RQEA 1TTRA 1U95A 4JDEB 4GI9A 5HYJB 5EMKB 3PGFH 2QZPA 4PS7A 1MQ8A 2XZCH 3QDGE 3TCTA 4AQOA 4L4VB 4U1HA 1I9IL 4TN9A 4NKOB 3PG2A 4GGCA 3GM8A 3ARBC 3DV6B 2BVUA 3SB3A 4AIXA 4G8IA 1JMZB 1L5GA 1VACB 1QTPA 4Z7NF 3QNYB 3IGAB 3F65A 3D2TA 4QKXB 1MWAL 3JTTA 4KC3B 4ZMOA 2I69A 1M9WA 3CFBB 2XYBA 4X5LA 4C83A 4EI5B 5AEAA 3U30B 1BQKA 4X8CA 3U1SH 5CCJA 4ISVB 3ZDXF 2GC4C 1ZLVH 4Q4EA 4LIQL 5HHQB 1YC8A 1S2EA 4WI3A 3ZDYE 1YEIH 1JHLH 3NABH 4JGUA 4PJGE 2ZXEB 2XG4A 1RERA 3UR4A 3WTSA 3O6LH 3ZKNC 2NQCA 4U3SB 1RFDH 1MCPL 3IU3A 4A0BA 3OWRA 1OCOB 1UB6A 4K0OA 3QIUD 1OTSC 5HI3D 4O5LH 1TOXA 1ITCA 3IMRA 1OSEA 3I50L 5KAQG 1ET8A 5L0QC 2WY3B 4X4ZA 2XWBA 1BF5A 2ZXGA 4K7PL 1A7NL 3DPBB 4NUJA 4IRZL 3VAEA 35C8H 4KV5F 3BVNA 1NGQH 2EDRA 4EWRA 1BFOA 1KT2A 4GS7C 3U79A 3OR6B 2VAAB 4IK6A 3JUYA 4JHAH 5ICYA 3VTTA 1DJSA 2AP2A 3L16A 1U2VC 1NCDL 4G3YL 1WAEA 3P2BA 4AITA 2PKDA 2CHXA 4YOKA 1XH2A 2JKXA 3T0ED 2CUMA 2V8MA 1VKXB 3BUDA 2LABA 3TWCH 1DSFH 4JL2A 2AZAA 1GRWA 1TZAA 4I3RL 4NI6A 2X0UA 1DSFL 8PAZA 1AXTL 2WM0A 4DUXA 2XPGA 2ZAIA 4IS6B 4XCNB 3C5ZA 3L17A 4WU7A 4KRPD 2AGLA 2J57G 3TURA 5IMMB 2NZ1A 3PGCB 1S3KL 4XVOA 4OD2B 4Y5RD 4P2AA 1TJIL 3CK0L 4JE0A 5I1HL 1Q9LA 1ID2A 3NA9H 4FG6C 5LGKA 3MLSL 5DJ0A 3P3RA 5KSBB 3BO8B 3ESPA 3UTPD 4BFKA 1F18A 2IWEA 1MJUL 1FZMA 4JM2F 3NIDB 1E6JH 1J12A 1DANU 3AWFA 5DEFA 5CBAB 1P7BA 4U6YA 4J1UB 1N6UA 4P5TD 2XT1B 4TL5A 1UA6H 3I50H 2QL1A 1YN7A 2IEPA 3KW7A 3UBGA 4ENED 4G5ZL 3NCBB 1WCBA 3GB7B 3QFJD 4YL9A 3KJ6H 3EH1A 5F1IA 1LD9A 3IM1A 3CFEA 1DQQA 2H3NA 2V7NB 4GKNA 4G2AA 4OBSA 1SJXA 1T1ZB 4GFXA 4HS6B 1F6LL 5C8JB 2QQKL 1AKJB 2G99A 1XF1A 3B6SB 1KB5L 2OVPB 1BVKA 1DUYB 1D5ZB 3FUJA 3HR6A 3V4VL 2DTMH 3JTSA 3MLXL 1PX4A 3EU7A 5SWZE 4WWID 4KO5A 4YUEL 4TS6A 5CSGA 3EJYC 4X4XA 1CTMA 4PCSA 2P5WB 1AMYA 1JV2B 3W5NA 2H68A 4F57L 3MJ7B 2WQWA 1YN7B 4HH9A 2AQQA 2QSTA 4K8RD 3B2DC 2H6KA 4RWYH 3ZHKA 4RBPK 2B5LA 3FRPG 5EBLA 4FFWD 5F3FA 3N44B 2YUXA 2ZD0A 5EZJA 2YNOA 2WQAA 3O4LD 4MSWB 1JF1B 4ZS6C 2ZWZA 5JHBA 1M7DB 2JCCA 3P9LB 2IWFA 3RL1A 5J1AA 4YSUA 1NAML 4DT2A 5T1LA 4IBUA 2VN5A 2WKOF 4WFGD 5LNEA 3ZZSA 3CZLA 4MB5A 4YN3A 5CP7A 2EXYD 2AJUH 4HPOH 5IHUL 1ZE3H 2O6EA 3MRBB 4HKXA 4K73A 1BZ9A 4HOMA 5AZUA 2RAMA 3CCHB 3VXNB 3RFZB 3BVUA 3IK2A 4M6MH 3PQYB 5D72H 1EO8L 2OJEA 4AMKL 1HHHA 1OAJA 3SPJA 1CDIA 5KSBF 4OR1A 1CF1A 1IBHA 4JREB 2VDNB 4JRYB 3PJSA 1MG2C 1OCCB 4QOKB 4YGVA 3VRLE 2F7QA 1UZ8A 2Z91A 1BYPA 5GS1C 5IVZA 4ZAKB 1BAFH 5I6LA 3RPIA 1SHYB 2AVGA 3HHRB 4M9OA 3G6AA 3VXMB 1IEAB 3BSZL 2IPKB 3N9GH 3G6JB 5DD3L 3KYAA 4XN9A 3WUWA 4PJ7B 4G43B 2ATPB 3NAAH 3VXPB 5LGJA 1IM9B 4GIOA 2QQLL 1F8TL 2LLNA 5DK2A 3QUKB 1UC6A 3MUUA 3U4KA 3WKNA 4GG6F 3AY2A 3S5ZA 1AZUA 1T2XA 2UWEB 4ZUUB 1U30A 1PVHA 5DYFA 4X7CC 5CM1A 5EORH 4F7KA 3MBWB 1KCSH 2GEEA 2H6PA 4R5TA 4NKDA 1EUTA 5AVTB 1CE1L 1P7QB 1ODAA 3ULSB 1E5TA 1JZIA 1B0RB 4DEPC 2J8HA 4XZ4A 4JFTA 2AW2A 3SGEI 3QHFH 4X6DB 2CO7B 4NHCH 4GQ1A 3ULVH 5ANME 3J2PA 5C08A 2BHYA 3V0GA 4QTIL 1G1KA 2ZAHA 4LIQH 3ZTJG 3EO0B 1UXLA 3EYQC 2DMBA 4U0QB 5D7JC 2R2CA 4M8QB 4Z7VE 5CD5D 4XC3L 2EIMB 4U1IA 4Y9EA 1UXMA 1OIOA 2AQNA 4MNQB 1NL0H 5JNYA 2Y23A 5I76A 3NUKA 4LARH 4AL8C 2DRUA 4GSQA 4NN6C 1E65A 3GFCA 1CXFA 4R2GD 2MQ3A 3DURB 3VD5A 1S5IH 4ZUVA 2O5YH 4ONFH 5GRUL 2FJHA 3WNNA 2ZSWA 1G4MA 4JPWH 5CXCB 1HXMB 5GZNA 3ZL4H 1IILE 4M7ZC 5DJ6A 5IHBA 1F1GA 1IGCL 1JPST 1N4XL 2J25A 2FJGA 5KW9H 3CBKB 4TVPE 2WWMC 5IM7A 4AGNA 1JD9A 2BNRA 4OKVA 3RURA 5I1IL 1QFOA 4BFOA 1LK2B 1V3LA 4DSYA 1AHWC 1J10A 2R27A 2O61B 1CGYA 4LKXB 5TGBB 2C7FA 2EDMA 4J7RA 3MRCA 5FB8A 4Z78A 3C08L 5J11B 4J3OG 1AFVH 4JY4B 5GGUB 3X1NA 2KQMA 3UPCA 4X9FA 3RWDA 3EBGA 3FF7A 2UV3A 4L0ZA 1KGIA 2WYZA 3UYPB 3FT2A 4LDCA 4NNPL 3IJYA 5DVOA 3TP4A 4RE5A 5CILL 4JO8A 3ZE2A 4JG1H 1FP5A 1EXUB 2YGPA 4OJDH 4P2OB 4CADB 4UTBL 1YQVH 4MKTA 1E2ZA 4KPHH 1SHWA 3VI4B 4FYSA 4A2EA 4BKTC 4J3TA 2NXZC 4HC1A 3Q1SH 4BZ2H 4PAZA 5DK0B 2YXWA 3Q2VA 4HZLA 3QI9C 3TVMD 4Y88A 5H4ZA 2CXGA 3T2NL 2YAEA 4YMPA 2VLRE 3AGWA 2R0ZH 1DP0A 1FE8H 2AV1B 4I88A 4JNXA 4NZUH 5EU3A 3WXWH 4ACPA 4ANVA 3HMXL 3C6SB 4H5IA 3ARGB 4MWFB 3VFNA 3EO1B 3N43F 4IGBC 5C0JB 4L5FL 5DQ9A 2Q7YA 3RE0A 1V8HA 4M7LL 1SN2A 4CI8A 2YUWA 5CJXC 2QZ5A 2J73A 3HC4L 3VXQA 2Y24A 4OJEH 2ARWA 3FSZA 1HWHB 1X4ZA 4CN1A 4D9SA 1KELL 3QAQA 3TNNB 1R24B 3MCKA 4UT6A 4KTEH 1X6LA 1I1YA 5DD5L 4Y16A 1T5KA 2LT9A 4HOWA 4D8PA 4PRDA 5I23A 4QHMB 2BSRA 1ZIAA 4U1NA 1PAZA 4G7SB 4LCUA 3VDCA 4RX4A 2EC9T 4POUB 5D7JA 1NIAA 3EOBB 2BCKB 4P3WA 4JPKH 2R7EA 5DHEA 4WK0B 4CY1A 1QHQA 4ZT1A 1DN2A 3FQRB 4K4KA 5E1GA 3H3PL 5DVLA 3V4VB 1RUML 4JO1L 3KPTA 5E0QA 2NY5L 2YPLB 3EYQD 3TCLB 5JW3L 3U25A 3EJQA 3UCRA 1CLCA 2NW3A 1OANA 3FQ1A 1OARL 3NOIA 2CLRB 3KPRB 1PSKH 1WZ1L 2D7TH 3TBCA 4M1DH 3FPXA 2R0KL 4OWRA 2Z0BA 2F53E 4JFEB 3T8XA 4LRIC 1PU0A 5TFSL 5HHNA 2F15A 4XOAA 5D1ZA 4FNLH 3MRGB 1QLRA 3HG2A 1PW3A 5FIEA 2HWZH 4LKXA 4IOIA 3KWUA 3GD1I 3QWOA 2H9PA 2ENJA 2X4PA 3QJZA 1RSYA 3S3DB 4KKCD 4PJHF 2HWZL 4HCRL 1EHNA 2K7PA 3EOYG 4KKBD 5SWZA 3TYFA 3BPOC 1KBWA 3BPNB 2VDKL 1XF4B 2R0KH 4I9XA 3TZVB 5AL0A 2XVKA 1R5WA 4JREC 1BD2D 4U3XA 2Z35A 5JIHA 3P4NA 3GUTA 4F58H 1A7QH 4HU2A 1SYVA 2FT6A 2PXYC 1WGOA 4JGMA 2FO4B 4TV3A 4YHKL 5JHLA 3NIDF 3FUFA 1HQRB 2YOAA 5FKSA 4L05A 4X8GA 5IJVA 1SJHB 1CICC 4BH7A 2OMUA 5AJAA 5AUMA 3T2NH 4EDXA 2DJMA 3QZWB 1NTDA 1BQHA 2VERN 4DVBA 3NPZB 3CG8A 1ETZB 1UVQB 1FC2D 3DLQR 4W81A 2WQUA 4KJQC 1BJMA 2BMKB 1WBYB 2XY1A 3SDDC 1U33A 4TVUA 4BSVA 5F9WC 4MJ5B 1PLCA 3VD1A 2B4CL 4NYLB 1SY6A 3BPCB 4L8SB 4JG0H 3VYOA 2OMYA 4X6FA 2OX5A 2CLZB 2ICEB 2DWEA 4F91B 3MZLA 3PJNA 5I73B 1BECA 4OQTH 5JIIA 4Y2DD 2VKXA 3DV6A 4G8GA 5JW4M 2VDML 4M3JA 1OM3H 3BW9B 4YDJA 4QNPF 4AKOA 4EDWH 5EBWB 4D0BA 3FQXB 1C7SA 3EGSB 1H6FA 4JXMA 1AS8A 3BC9A 3BX7C 2L7JA 4PJDE 4N87A 3AXIA 1XHMA 4XX1G 2NSXA 1IO4C 2ZUTA 5D4HA 4H8WC 1MIMH 5JXAL 3NZ8A 1QUPA 4EJ1C 1A6UH 3KBPA 4PU2A 4KKZA 1EHAA 2YSSA 2NY3D 2J12B 2Q3XA 3S8FB 1U2CA 2GUYA 4KFMA 1F13A 3EYFB 3L2LA 5J1TC 4G6MH 4NENA 1P4IH 5LGYA 3TH3T 1KB5A 4WHTA 4NUPA 1UTDA 1A0QH 3NFSH 4UDUA 4ZOAA 2BH0A 1CXHA 3KBFA 5A2AA 3RDTD 5I1EH 4NOFA 4HC1H 4BZ2A 4JFYA 2VLMD 2FJGB 2I7OA 4DP7X 4LL1A 2FUQA 4CI3A 4YC2C 1Q1PA 5HI3C 5CZXD 2NX5E 4N8VB 2ITDB 5D6DA 2YSSB 3KYOB 4NJAH 1A3QA 3MRLB 2E4FA 5IFHH 4PRID 1YEKH 2G0LA 1FFNA 5C0CD 2LR4A 2VDNL 5JQ6H 3V6ZB 3QIBD 4WI0A 2G4EA 2XWDA 4XNZB 3ZDZB 2VXSH 2DQCL 4G9DA 4LF3A 5D7IB 1PI6A 2K4AA 2QSVA 1I8IA 2E6PA 4XTRD 4JB9L 3GMRB 5I8OL 2OK0H 1FVDA 2X9WA 4WW2C 3EUDA 3BLPX 2WWKO 2DQFA 1XGPA 2V5TA 1QI3A 3BP7B 3JSSA 5EFIA 5CEZH 5MEPA 4PJDA 5C0CE 1KG0B 4NIYE 3T0EC 4JJOA 2YPLE 3ARYA 5I9QB 2HU7A 2BM3A 4Q6YA 1T1YB 3L13A 4CJ0A 5I30H 3GI9H 4MD0A 1J7VR 4R8WH 2Q6WB 1M1XB 4R84A 3SO3C 1AC0A 1FA4A 5E1QA 1RKRA 2OAAA 5IBUG 1OALA 5DHXB 3QEQE 4JKMA 1RUKL 2Q7AA 4ZUUA 3T0VA 1JDAA 2F68X 2YXMA 4FFTA 4K3HA 4X7TA 5LBGA 4NC1C 2BVYA 1SQJA 2WB7A 1JWSA 2PCXA 1IGJA 3LN4A 1XKSA 2HRLA 5C0FB 2ZX7A 1DZ0A 1BJ1H 3VXRD 1VSCA 1MVUB 2EVJA 1I9RH 2VDOB 3KLAA 3HG1B 3NT0A 3L4UA 5AAWA 3GKWH 1BFVH 2ZCHL 4IRSC 3IJ7A 1XIWD 5DHVB 1BVZA 3HFFA 4JHNA 4N2OA 4QO1A 3QDJA 4KO7A 3UTQA 5LN8A 4U1IB 3QS2A 4MB3A 5AVZB 3SGJC 1TQSA 5A2CA 3UIZA 3X11B 4Z76B 5I1KL 6CGTA 1SNRA 1CFMA 2IWGA 3HI6H 4NN5C 5ICXB 3N91A 5FF6A 1A6TA 3H56A 3O2VH 4QGYA 4IOSA 5ACMA 4AN0A 4GEJA 1MLBB 3HN8A 4YQXL 1TITA 4Y1TA 4RMVA 2C9UA 4JFPA 5AYUL 3PAVA 4UTAL 1PLGL 1MY5A 1I7UB 4G5AA 4UTBA 4LDLB 1JZ6A 3EI2A 2FT7A 1ZLEA 2CWRA 2ADGA 2P5ED 3A6BH 2VR8A 2CD0A 1E27A 4PY8I 5IQ7L 2CLRA 1TJMA 3KPRA 1W6WA 3N1GC 4MA7L 3X2QB 3HI1B 5J13B 2OMXB 3LNHA 3UTQB 5IVXB 1BX2A 3PWJA 1TYJA 1CK0L 4R5XA 4XBGA 5HGAA 2ZP9A 3WCYA 4JRXD 3A22A 4L4VD 3JV4A 1I8KB 4YDNA 4CSTA 4J82A 1Q9LB 4LSPH 4YFLI 4DEUA 3L4CA 1NAMH 1AGDB 3V6ZA 4NJ9H 3ZDZF 3N42B 3V5WB 4CDHA 3Q1EA 2V3EA 4KHTL 2ZONA 2EDTA 3RDTC 4W68A 2JKTM 3QDMA 1FFPB 3QJVB 2WAQA 4E5XA 2VMJA 4BSVB 3C8HA 2K3TA 5IVXE 4BCXA 3BUQA 2G5BB 1RZ7L 5C3IA 3S5LA 4XX1E 5BUGA 1UENA 3OSVA 3EG9B 5HHPB 3MRFA 4P4KC 3O8XC 1N6DA 4F27A 2BP0A 1LK3H 4A2GA 4F57H 5I0WA 4JE4B 1JZ7A 1Z5LA 1LE9B 1MOEA 2FWUA 2YAFA 2YXFA 3LHPL 4YFEA 4PNKB 4TRPL 5C09A 2AS5M 3ESMA 1FG2B 1SEQH 1SVBA 1WAAA 1M7XA 3NA9L 3QQ9C 4OI9A 2YB8B 1T66D 3BOVA 3WLBB 2HJKB 2QHLA 3B2UD 2G3MA 3WMSA 4W6YB 1BLNA 3VWJB 3EDEA 1PBYB 3D9AL 2ISDA 5I8CB 4J3SA 1G84A 4J23A 1B4TA 3QPXH 4XP9H 2FJFA 4QHKI 2VLJE 1GGUA 2N3JA 3D0LA 3MJ8A 3ZMRA 5K1CC 4MFHA 4CUCA 3T04D 2CHDA 2H9MA 3QDME 4P48A 3QE5A 5DEGB 3CLEL 1PLGH 5J6GA 4UTAH 3QORC 5KBPA 2D4DA 1BXAA 2EDXA 2HTLC 1CE6A 5JLZB 3K81A 5FYLE 3N44F 4L4TE 1CDGA 5EAPA 1HN1A 3VWKD 2K4WA 4O2FB 1HHKA 4MCZB 1JTDB 4BFIA 5DJ8B 2CN2A 1JP5A 3B2VH 1JV5A 1N68A 2F8VA 2MTPA 2K6ZA 3F58L 1YEJH 3NFPB 4C83B 2WKGA 4LSQH 3RL2A 3RP1A 2OL3A 1BFVL 2ZCHH 3QUMA 3WS3B 4NQVA 1QG3A 4K7PH 5F7HA 4XMXA 5FS5A 1M42A 3TCLA 5JUEH 3QDAA 3O6FD 4F37K 5KSAA 5CMAB 5CKGA 1B90A 3EYFA 3SJVB 4TTDD 1LD9B 3NSCA 4BCZA 5DWPA 4ELKA 3E3QE 4NPKA 1EHLH 1MDAA 1F58H 4MXWH 3WOVA 4XMTA 5CSBA 3ZUCA 5ICZA 5E6IC 3T3MB 4OF8A 2J7LA 4PIBA 4XNXL 1Q38A 5GQBA 1KPRA 4P5SA 4ELMF 1NKRA 4KKAC 3MRPA 1P5UB 4DUWA 5CBEA 3X13B 1H2WA 3D7PA 4CN4A 4J8GA 1X9QA 3B43A 3O6FA 1KENL 2E7DA 4TUOB 5E2WH 5SX4I 3ZO9A 3SIKA 2OZ4L 5ITBL 4P2OD 1SLXA 1P7KB 3VWKA 1YPZE 2YAPA 2FYYA 5HGHB 3QBTB 2R29L 3UG4A 3QQDA 4ONOA 3O4JA 3V0JA 1YNTF 1ORQB 2NCMA 3LMJH 3CFCH 1MN4A 1G7LA 1V27A 1F2XK 2H2PC 3IRPX 2BDNH 3P9LA 1P7QA 3NCEB 2WLZA 4NKIL 2J2ZB 3HVDA 3Q2NA 1MNUL 1U8PB 2CZNA 4BH7B 1YEIL 5ANMA 3BP5B 5BOJA 1QLEL 5DK0A 1QBAA 4N68A 5KSBA 3I7OA 3RWEB 4MKMA 1IBDA 2O30A 1F11B 1XWVA 2X12A 3CPLA 4PC0A 1T89C 2C8NA 3WD5L 4Q74A 1S7XA 2WXHA 4JDTL 4FP8H 4B5ZA 4KXAA 1F0LA 3BPCA 1H8SA 4KZCA 3S4SG 4BXSV 2XHNA 5E6IB 4WWKC 1DBKH 4ODUA 5GHWH 1A1MB 4J8RB 2AGJH 4ZXBB 2VDQL 3GXUB 4F33B 3F64A 2FTAA 3UERA 3CFIC 3VFTA 2EIDA 1KJ2A 1M3JA 1WC7B 1QR4A 3W56A 2QGBA 4DP8X 3JTBA 5HYQA 4NLAA 2OL3L 1U8NB 2NY6D 3QUML 4KUCF 1AE6H 5F97E 2VLRD 4P5MA 2N01B 3STBA 4UZGA 4QRFA 4P2RD 3NFPA 5DFVD 5IC7A 5GS0L 2E9JA 1RSFA 1URLA 3EGDB 2HP4A 3NIDE 3NJGA 3PE9A 4FF9A 4P2RB 3SYOA 1S7TB 1KIUB 1A9EA 5E4EC 1INEL 1N0XL 1AE6L 1PL3A 1G0YR 5I75C 4A08B 2FD6H 4QT8A 3QH3A 1BF2A 4DETA 2AEQH 3GSNA 4QXUH 1E8MA 4G42B 1HHIB 5EBGA 5TE4H 4XP6L 2MH4A 1BBDH 1CYGA 2WUCL 5K19A 5ICUA 5M7QA 1UB6B 4JO2L 2OTUB 2VH5L 3H42H 3A5VA 3LZQA 3TJHC 4OD3L 2YQ3A 1RZGB 3C5ZB 3BD5A 4XPTL 2EH7L 4OIIH 1SF3A 1HH9A 2XIDA 3NCFB 1RMFH 1WFOA 3ZZQA 1HT6A 3GMOB 3V7DB 5ITFA 5AW6B 1GG2B 3J07A 4GGDA 1QLEH 2DQTL 2FQDA 4PWGA 3S37X 4AH2A 2AJSL 1SJVA 4HV8B 3F85A 5I1CL 2BXZA 4FZ8L 4U49A 3T6ZA 4JFFB 2IALA 2A83B 1DVZA 1I7ZA 1NGPL 4NQCE 5F8RC 2AQPA 3NN8B 4ZUTA 4PJDF 3W2DH 3SCMB 3P30H 1MXDA 1JTTA 1PIFA 1MW0A 2R29H 5GPRA 1G94A 4RMRA 1KCVL 4JPSA 2Q8BL 3MLPA 1SBSH 3TTSA 1T21B 1QFUL 2ATPA 1WWBX 5L2KE 2FWSA 4XMLL 3ZX1A 4N8VG 3AU1A 4AJVA 4U7SA 5I74B 5C0AA 2I9TB 2KS0A 1S78C 3LKNA 2IANA 3IDMA 2C4XA 2H2PD 3VWJC 4UINL 2F1BA 3N41B 1J9SA 3LPGA 1YLBB 3LQZA 2CRMA 1S7SA 3I84A 2QEJA 2XIBA 4WEMB 2FSEA 4XH2A 2X4OA 4KITB 1UATA 2DQUL 1DEEB 5GGRY 3LNGA 4FL4C 4Z18A 1GKEA 1YUKB 3LTVA 4IGBA 5FYKE 3WBDA 2GK2A 3E80A 5EA0H 6FABL 4WWKA 2DLGA 4DW2H 5C0IB 3KL5A 5CJXA 1L7IH 1F00I 1Q9WA 4PJ8D 4KVNH 1X5FA 3E6HB 4N8PA 4P4KB 3QEHA 1VEPA 3I75B 4FQIL 2YLHA 2H47C 1A7PH 3CSBA 5EU4A 3RL1B 5JHAA 3BP4B 1T5WA 3LKNB 4R7DA 5FO8A 1P5UA 1LEKB 2HVKA 2VUYA 2W9EL 3QR1A 4NIKB 4FQQA 3FTZA 4NAQA 4MMZC 1X4YA 4PRPB 4YBQD 4BSWA 3NIGE 4BWWA 2JLLA 4ACTA 5FXYA 3QH3B 4W9KC 1OPGL 1MFDH 3RTQD 1HOCA 1HXYB 4HIJB 4BZ1A 4M93C 1YEEL 4AM0Q 4LG9A 2FX8L 3TNNA 2XWBB 3O3EA 5G2NA 3QIWD 5E5LA 5E8EB 5TDNB 3RZCB 3I9PA 1UZ8B 5EBMB 2JKJA 2M1KA 3I6KB 1UT1A 1U8JA 1MAJA 2J2ZA 3DXKC 3GC3A 2E27H 3II1A 4AQZA 4Y4HC 2IDCA 5AL8A 2PR4H 4GJTB 5IM7B 5E2VL 4E68A 1AHWA 1Y6MR 3MZKA 3VX0A 5DJXB 5C09D 2W07A 3PRZA 3PP3K 5D2LA 2Q86B 3TJHD 1XZWA 2Q0ZX 4FNSA 4HEPG 2H3XA 3GINA 3Q1SL 1HH6B 1GJUA 5EU7C 1CYWA 4EUPB 1O6TA 2OYLA 1OXYA 3L3JB 4NM8H 5HE1B 2NY7L 3F2LA 4PJGA 5GGSA 1WEJH 3PNWA 5EA0L 2BPBA 4JLRB 5MP6H 1JI1A 2EUXA 5IHZA 2NYZA 3BSZA 3VD9A 2WSPA 1IEBB 5GS0C 1LGVA 3RU8H 1MFEH 1F1DA 43CAA 1TTFA 4BIKA 3AC0A 4Z8LA 2WBXA 4N14A 1NCAL 3GHBL 4PVMA 3TZVD 3OJDB 3QYNA 4G56B 1DQKA 1MXGA 3CBJB 4NZTL 5MHSE 4B9ZA 2IPKA 3VFSA 4JFFD 3K6SB 1WICA 3DVNB 3OGCA 2EABA 5KVGH 1RAMA 1SFHA 2Z3FA 3B34A 2F7PA 4LRNH 4MD5B 1KJ3H 3SE9L 2YPLD 1A4BA 2Z31B 1DCLA 4ZUWB 2VZVA 4MA7H 1ZSDB 3O6MH 5DQJB 4L1HA 5D4JA 2Y5EA 4WI7A 1X5YA 3NRPA 4BE5A 1TMQA 3S5LB 3K6DA 5L8JB 3UVLA 3IVMA 4QMEA 4XPBL 1U91B 3AQYA 3FO1A 4R90H 1EEYA 3GUFA 4HS6A 2DLFL 3DX0A 1ND0A 4WEBH 4YSPA 5FDWB 2E56A 3IUQA 2ZQKA 3OW8A 3SE8H 1S9YB 1Y0LA 4YZFE 3V5HB 4Z5RA 4Z7IA 5D4IA 2B1HL 2P9RA 2VDQB 3NCYP 3SKNB 3BUBA 3ZRFC 3FRUB 4NRZB 4Z95L 3GXPA 1OTSD 3GREA 5HDBF 5C07E 1Y7VA 4HJUA 5T1LD 4O2CB 4MQXD 4UDTA 4XPHL 1E3XA 5B1BB 2JB6B 3EOTH 5C2UB 4GSDL 2J8UB 3BLBA 1BWWA 4K5NA 1C8QA 4U1KB 1SHSA 4YBHA 3CQFA 1IE4A 2A73B 2CRYA 3V6FA 3HJEA 3L3HB 4XAWH 5IMOB 1E90A 3GQFA 2PPAA 1OTUD 1UYWH 3NJMA 1V3JA 1LXMA 2XFGB 2Z7WA 1T20B 3SHSA 1LMIA 3UFIA 2ATAA 3EOTL 3D39A 1UH4A 4MNHA 1MJJA 5E2UL 1BOGA 1NEPA 4GBXB 3WEAA 1VESA 4QGTA 2WINA 2NNAA 4E41D 2ADFH 4RMWA 5D8JH 1YRKA 3JWNE 3CDFA 4EI5D 4JFDE 1KTCA 2OZNA 3F7YB 4V11A 4YSAA 1GGYA 1FFPA 5F0MB 2HFTA 1RVFL 3NJKA 2HH0L 4AIOA 3WSQL 3ZUNC 4ENZA 3IAGC 2VM9A 1NGYA 3WUZA 2BRQA 5FQDA 2FWOB 4Y5YC 5T1DH 1I8UA 4S0SD 1OY3B 2OM5A 1DLHB 1ETA1 2CK0L 5AKTA 3T3PE 1MCJA 1NOFA 1AGCA 4NBZB 2VXSL 2FL5B 2HVJA 1BXUA 5IT2L 5D1XC 3UJIL 4UM9A 4QRJA 2H4EA 3LKSA 3WEBA 3EYUH 1JGEA 5DGRA 4NJAL 4DOHE 3WNIA 4N0FB 4Y5XA 3TNMB 3R4DA 1QTSA 4YXHL 1XGQA 1K8DA 5F9WB 2ALWA 3MBEA 3MBXH 3IDJA 1MFAL 2KYIA 4Z6AT 3LKQB 4NZTH 1P5VA 3G04B 4ZNEE 4AW7A 1UH2A 5DVMA 2FECI 4WTZA 5D6CA 5T33L 2B5IB 3SDXF 2WN3A 4JPWL 3N1MC 2YBAA 3WG7B 4GO8A 2XWCA 3ATDA 3U0PB 1KYOK 4Z7QF 1JNLH 3FKUS 2WSKA 2Z8VC 3FN0H 1QSFB 1A8ZA 1DBBL 2ZZUT 3AMLA 4BCCA 4LL4A 5D1XB 2AABL 2AANA 2D9QB 2R69L 4G8GB 3V95A 3HUJA 1FV1A 3NJXA 1N5AB 3BGFB 1FZJB 3OHXB 4LSUH 4NUQA 5LGHH 3RX9A 4KZ0A 5T1MA 5F9AC 3E2HB 4EI0A 5HYJA 5E0FA 4ZFGL 4O4YL 1IAIM 3KCWA 2Q86A 5D2LB 5E4OA 2JJVA 1ADQA 1Y18B 3NFNB 3P9MB 4OJFL 5I15L 2NT1A 5I8KH 3V0VA 3R1GL 4LGNA 1K4CB 3I3EA 2XN0A 4TYUA 4ZPTB 4X7SH 1VKXA 2VKWA 1NIDA 5IBLD 4D8OA 1H19A 3ARFD 1TDQA 4LOVA 4XO3A 5E95B 3KYMA 3QXAA 3HS0B 5J6HB 5B1CA 3ZDZE 1NA8A 1COBA 2QR0A 4Y7MA 1MCFA 4NQEE 4BH8B 3ARRA 3QIWA 4PEEA 1TO5A 1KGWA 1QLFA 5DLLA 2V2TA 1GZPB 4GY4A 4AYFB 4ODVH 3PUCA 4IBYA 4LCCA 2XG5A 4HWNA 3IFOB 3WY3A 3UBXB 5J3HC 4LPCA 5D7IA 5TF1L 2PYEB 3FBQA 3LIUA 3FO0H 1VHPA 4L0PB 5E8PA 2K9UA 1NCNA 3RDJA 3D18A 3IDIB 4FCHA 4TSCH 4EUPA 2GITA 5I1DB 1T80A 4PJHB 3K80A 5IWLA 2QTVA 5KEZA 4XP1L 3GD1C 3FCTA 2UUDH 3O2WL 1WG3A 4JRWA 5DMIH 5AZEH 3D9AH 2XWJA 5JHDE 5DLMH 4GOSA 4QUOA 4PG2C 3EI3A 1CFTB 1W0VA 2EIZA 5IFAL 4X6EA 3KYNA 4PJ8A 3U4BL 4NQQA 2O26U 1R3KB 3O4LB 4HU8A 4J5VA 5TGBA 3IAPA 4XAKE 1WCQA 4PD4K 1ZHBB 1HL8A 2GCYA 1S7SB 3H9SA 3HB3D 2YMOA 1ZANL 2Z31C 5EEVA 4QHUB 1I9EA 3CSPA 3AMKA 1A7NH 3HZYA 5L4JA 5DRXB 4YWGH 4IJ3C 5D5ME 1RJLA 3EBAA 4JRXB 1FAKT 1NEZB 2FHBA 1V7NL 4PN6A 4QLWA 1R34A 3GBML 4ZMAT 1IBYA 2WWOA 4FQCH 5IF0B 1P2CB 4MQ7B 2OJZH 3SJVE 3JWNG 4W93A 4AOFA 5T3XE 5ICZB 2ICWI 3L81A 3LZRA 4K3JH 4UOZA 1N18A 1D7CA 3HUJB 4OKDA 4YUEH 3SD5A 3P4FA 5BV7H 1ZLUH 4CU8A 4LOUC 3GSQB 1JMXA 3C6LB 1K4DA 4YXLL 3WIIL 1NIBA 2NZIA 2IAMC 4HUUA 3O6KL 3PS6A 1FLRL 2YD2A 4WFFD 4J3BA 1KCLA 5JIKA 2V3DA 2Q7YB 3WFDH 4MLIA 5GRJH 4BUHA 4LCWE 3MREB 4FFYH 3BXNA 4X5XA 4ERQA 2XV2A 3BAEL 2V5MA 4AV4A 4KVCL 2A9CA 4WJG3 2ZCKL 1PDKB 3T2LA 3TIDA 4WAFA 1JRHI 3C2AL 1RZJC 5EU6B 4LGSB 4R9HA 5AYUH 3KEHA 1OQXA 4LCYA 4HUMB 5F7AA 2CJTA 3T4YA 1U8MA 4G7VL 1OV8A 3FQ2A 4J28A 4A7JA 3VFUB 3FUIA 2ZKWA 2X89A 5JOFB 2GJ6A 3BLKA 3X1GA 2ESVB 5E2JA 5FYJL 3OX8A 4V2BA 1UQSB 2A9MH 4EN2A 4M6AA 2EUVA 2WQRA 4F7PA 1AXSA 3MROA 5HYIA 3DTUB 1TF4A 1A3LL 1MREL 1J9TA 1WF5A 4Q4IA 4KXCA 1DVYA 3CFJB 4Z7UE 2H9NA 3QDGA 4K3ID 4OZIB 2J5WA 1WS7A 2AJVH 1P84K 4MNGE 3KXFA 2V9QA 3BEVA 5JPNC 4JFQA 1W8EA 1T3FA 5T1KB 1CFTA 1W0VB 2EIZB 1LNUB 1SEBB 4KVPA 1G6RA 1NFIB 1T7ZA 2HXAA 4FTVA 4NT6B 5BNXD 4S1SL 2XL3A 4GT0A 1FNHA 4X50A 4X5WA 5CZVH 1YY9D 2IQAA 1TNNA 3FFDA 5AB0A 2VXQA 1AO7D 4AX4A 3J27A 2L4OA 4HX1A 3ARPA 3GYRA 5I1IH 1E42A 1XB6A 1RPQA 2OXGB 3H7BB 1YZZA 3LX9A 1I1FB 3DHUA 3LRGA 3QULA 4F15C 4QXTA 4MB4A 3L1GA 3SQOH 2MCAA 4OGYH 1WAAE 2XWRA 5HE3B 4JO3L 1EEZB 3FU3A 4GQPH 2VGLM 2QZQA 3BIKA 3PWVB 1L9TA 3PXLA 5GSVA 2FJFB 5FV2A 1MCPH 1QW9A 4A2DA 2CUAA 1MJ8L 1I7TA 4PBDA 4FQHA 3DJTA 3LD8C 4NQDB 4ZOYA 1IKNC 5I1GH 3HB3B 4X5WB 1JHLL 1FFOB 3NABL 3T6XA 4AEEA 2B8OT 2JK5B 1HCZA 3DRQB 2DQTH 4JRFA 1U3HD 4N8UA 3D3VA 3OZKA 1CYXA 3PP4L 3RX5A 3U9PL 2AXFA 1U8LB 3LNDA 4L9LA 1KXVC 3TBSA 2W5PA 2ITCA 1Q4NX 2E9IA 3CBRA 1BBJB 2DYSB 5EU3B 2EYTA 2VLKA 2CALA 2P80A 3OLIA 2W88A 3ZY7A 1LMKA 4LSVL 2AV7B 2CKBB 2VQ4A 3LCYA 3O4LE 1RQ5A 5EUOB 1N8OE 1I9IH 3I9IA 3AAZA 1L6ZA 4AT6B 3BG1A 3QFDB 4JRYD 3U4EB 5GXBB 3CSYB 4NX0A 5KANG 2WNKA 1PKQA 3VD7A 3ZLQC 1FFOA 1NLDH 4DGIH 2FSDA 2WBJA 4LOFA 5ABAA 2GUOA 3DX9B 3IJSB 5HY9B 1RK1A 3ABZA 4PJHE 2ENSA 5C0EA 4QIRA 3H55A 3VGDA 4KK6D 4FFWC 1DO5A 4LCIL 5CZVL 4LHUA 3TPUB 3D05A 4WO4C 1ZGLM 3RFZA 4M7JL 3W11C 3QCUH 1R5IA 5DRZA 5TDHB 4X5RA 4JHZA 1I8AA 1PGUA 3PGDA 4BEIA 1GZHA 4HFUL 3BUTA 1YDPA 1F4WL 1VGEH 1S7RA 4WI5A 3PWUB 3PUUA 5IKCA 3M7FB 3NCXA 3MR9A 1G6RB 2BXYA 4AK2A 8CGTA 1DVUA 4FP8L 5D5MF 2J5LC 4YHYB 2M2DA 1I9JH 4DIXA 2F7RA 1BGXL 2X6VA 5L2KB 1WIOA 1RULL 2RTTA 1FYTA 3BEWA 4WWKD 4JM4L 1DQJA 3PXJA 2ORBH 4RISH 4J0XA 1FFNB 1QFHA 3BGMA 2G2PA 3QEQA 2LU3A 3PHOB 4OFKA 4LEOA 4FG0A 3RVUC 3UPRA 4B9PA 5EF2A 4MS8C 1VLXA 4CMMA 3CMGA 1FO0A 2WWMD 1IGMH 3DRTB 1AZZC 1GOGA 5T3XL 4FQCL 3RVWC 3PJLA 3LMJL 4NP4L 5HQGA 5C0AD 2Z65C 4G82A 5DRWA 3AROA 1FNAA 3O3UN 1HEJC 3RIAK 3LZPA 4AEZA 3MV11 4PWHA 3FH7A 1WSST 4TLTA 1IT9H 5C08B 5HSFA 3H3KA 2OMZA 5BQDA 1MF2H 2EP6A 2PO6D 2SEBA 4N5UA 4Y9CA 1KXTA 3Q05A 4Q0XL 3V7AE 4I0PB 4NJ9L 4CJ1A 4MD0B 3WKYA 1QLRB 5DT1L 1YNTB 3ZHFA 4WUUD 1IMHC 1BEXA 3WIIH 2X88A 5CYKB 3TA3D 5LHDA 4QAWA 1RU9H 5IVNA 3PVUB 2YBRB 1Y6KR 1QLEB 4M1DL 1S5HB 1MCDA 4S2SB 1U8HB 3C8DA 2BRRH