5I5JA

Shewanella denitrificans nitrous oxide reductase, reduced apo form
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
573
structure length
531
Chain Sequence
SAVVHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNRDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIANFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWRGRMLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
total genus 163
structure length 531
sequence length 573
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5jA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5jA01
5AKRA 3RRMC 4HALA 3B7FA 2YNNA 3EWEA 3FT0A 3NT0A 1AZCA 1RZQA 2JKWA 2YAEA 2Y69B 4GP8B 2MRYA 1PNCA 1SHYB 3CDZB 4Q8BA 4YL4A 2J57G 5K1CC 3I2NA 4JT5C 4PNKB 3KW7A 3T9WA 5ANHA 2HJBA 4HCFA 3SLED 4CZVA 1AQ8A 4ERQA 2YAOA 1ET8A 2FQDA 2GB2A 2BW4A 2MTAH 2XXFA 1OV8A 3CG8A 1TBGA 1NTDA 4YSRA 2XXGA 3NJKA 3RFHA 3PSCB 3PXTD 3OQRA 4P5RA 3V9CA 4L1QD 3UGEA 3HFQA 4G70B 4GM8A 3DKHA 1W6WA 4FAND 4CI8A 4A0AA 2DV6A 3SCYA 3IJ0A 1QLEB 5HQGA 1TYQC 1GS8A 1P22A 3AL9A 2UXVA 4K3ID 2IAAC 3IEAA 3X1FA 1A4BA 1XMEB 4GQ2P 4K3JB 4DP6X 3C99A 2PCYA 2Z2NA 1FWXA 2VSKB 3OMAB 5B3SB 1NWPA 4IMMA 2HX9A 2H9PA 4J82A 2JXMA 1MG2C 1CYXA 1BQKA 2QDVA 1URIA 2YAFA 2EILB 3I7PA 3UVKA 3FQYA 1OE2A 2XVBA 4J0WA 5IJ7E 5CXBA 5I6KA 5F7BA 3AG4B 4GQ1A 3QJQB 4GXFA 4Q89A 2UXFA 3VGZA 1RKRA 2P9SC 3SVWD 4ZN4A 1KYAA 1E5YA 3S8FB 4A2EA 1JOFA 5HE2B 2AFNA 2I7OA 3PLYA 2VM3A 3QJUB 4FA1D 5EAPA 5IC7A 3OL2A 1B3IA 4K9JA 3L4MD 2VW4A 2PM9A 3NYKA 3FYIB 2VW7A 4A2DA 4FA5D 1OCCB 3T71A 3WNJA 1J9SA 4E9RA 1A8ZA 5C2WB 3UVNA 2XUWA 4XYIA 1JVLA 1AS8A 5B1KA 3UAAA 4AX3A 1CC3A 1PLBA 4HDJA 5B7EA 3X1EA 3D12B 5AZUA 1PY0A 1X9RA 4JHVA 4F2FA 2UXGA 3QQXA 4BDVB 4G7QB 1KCWA 3SXTD 1MG3C 1OCRB 1J9RA 1PZAA 4PBZA 5EHFA 3I8CA 3OM3B 2EINB 2P9KC 1J5DA 1SFDA 4Y5RD 3UR4A 2AVFA 2CBPA 1BXVA 2PPEA 3JTBA 5EARA 5EAMA 2OVQB 4HHWA 1PI6A 4LGNA 9PCYA 2CN2A 4TZ4A 3GFCA 2IDFA 2IH9A 4X60B 2H9LA 3VH0A 4L9OA 5AFU3 2HX8A 1SFHA 3JRPA 1AG6A 2PP9A 3T6VA 1YLBB 1SQJA 1EHKB 4KO6A 4J81A 5HE1B 3X1NA 3SBPA 3MX0B 1ZPUA 4KNUA 2I7SA 3DTUB 2H47C 1U4CA 4QKTA 4AKQA 4YSUA 5AFAA 1PEVA 2GC4A 2H14A 2B5NA 3FGBA 1E65A 4BK5C 1BXUA 3NJMA 3IJ1A 3G5WA 4A2FA 5A7EA 3AG2B 5FXYA 1PF3A 2AQ5A 4A67A 3CVDA 1JZGA 3FSVA 4A2MA 1ZIBA 4GM3A 3C5MA 1ASQA 2GC7A 1GS7A 3PAUA 3I7NA 4J8BA 4O1QD 5GSAA 2ZONA 4A66A 4KNSA 5IJ8E 3I7KA 4YSSA 4KO5A 2IUVA 4MFHA 3OL2B 4H5JA 5HYNB 2FT7A 2B3IA 4GZ8A 2PM9B 4JD2C 4E9WA 4JSXC 4Y7RA 1JZEA 3PAVA 2AGZA 1L9SA 3RSEC 1OE1A 4QRJA 4O45A 2UX7A 2AH0A 4E5ZA 3IE9A 1XB8A 2OV0A 2XU7A 3UVOA 5IT9g 2R7EA 4X4KA 2PP7A 3TU6A 4BWTA 2BZCA 2B5MA 4OZUA 1SDDB 2IH8A 5I26A 1PGUA 4DP2X 3S3CB 2YNPA 4A2GA 2HKRA 2H5UA 1MZYA 4AKOA 2AGLA 1L9OA 4E9QA 1GG2B 3SMRA 3BQVA 2BP0A 4AZUA 5K19A 2HLEB 3JB9L 2UZYB 3K27A 1OLZA 5TEEA 1PMYA 1AS7A 2VM4A 3CVBA 5GXHA 4KNTA 3A0FA 3EH3B 4KFMB 1A65A 4CI2A 1TEFA 4YVUA 2YMUA 4FAVD 1JERA 2YARA 1TU2A 2CJ3A 5PCYA 2AGWA 4U1EI 1HFUA 4DP9X 3T6XA 5H17A 3ZIYA 3ULEC 5D4JA 2YAHA 3TA4D 2P9NC 2EBSA 1B9YA 4M4RB 1KDJA 2FJSA 1WS7A 3EI3A 2H6NA 3KRWB 2XLLA 5FQDA 1PCSA 1HAUA 3ZWLB 1ZDQA 4AKPA 4A11B 1BAWA 2Q5BA 1ET7A 2AH1A 3PCYA 3QJRB 1NWOA 3NSFA 1ETJA 2CE8A 1N6EA 1NIAA 4E9YA 3UABA 3AH8B 1OMWB 4XEIC 3W15A 4FA9D 2MTAA 3J81g 2BWDA 1GOTB 5EMKB 1AIZA 1TKWA 1B9XA 3OKTA 3FPXA 3FPYA 3ZDWA 2G99A 3BG0A 3IIWA 5FKQA 4AOWA 4FA4D 3PXSD 2YAMA 1RZPA 2R7EB 4J73A 1BQ5A 3UVLA 1AANA 2ZWNA 1XKSA 2DYRB 2HKMA 3OKYA 3NP3A 3X1BA 1OOWA 1M57B 3PVUB 1NIFA 1SQ9A 3NVNA 3PXWD 2HYEA 1RCYA 1QNIA 3ASNB 4HCGA 3U25A 3C9CA 2BP0B 4TXVB 1FA4A 3IIYA 4LG9A 3PAZA 4ERYA 4KOBA 5CXCA 3AL8A 3AFCA 3AZUA 4E9VA 5C9ZB 5AMSA 3SN6B 5FC9A 1E5ZA 2I3TA 1M9WA 4KO9A 4G71B 2CAKA 1JMXB 4U7AA 3SBRA 3EI1A 1JXDA 4J86A 1NEXB 2FNWA 2X87A 1N68A 4JHUA 4L3GD 2CN3A 1PZBA 3K26A 1OF0A 2Y1AA 4UAHA 2FT8A 1AZRA 4CC9A 4F2EA 5GMKn 3EI3B 2XV3A 5D4IA 1L9RA 3NSYA 4A2HA 3MKSB 2H9MA 3S8GB 4HZ1A 2CO0A 3AY2A 3H4HA 6PCYA 3ABLB 2QC5A 3NJGA 1ASOA 2PPCA 3FQ1A 3FSWA 2H47A 4J8GA 4IA9A 3CVCA 5TK4A 4A09A 1V10A 5LDUA 1ASPA 1NZRA 4LG8A 1N70A 2DWSA 5HE0B 1IC0A 2X88A 4O3TB 2WSDA 1FFTB 1BXAA 1PBYB 4HAKA 4R7AB 2DWTA 1KBVA 3X1GA 4CI1A 2QDWA 3I7OA 2GSMB 6PAZA 1WA2X 1GY2A 3OMNB 1JXFA 3JZGA 1NPNA 3HEIB 1ZIAA 2BP8A 2IWEA 4NERA 3TBBA 2B5LA 2PPFA 1BEXA 1ET5A 2YNOA 4A68A 3ORVD 3N0EA 4O3UB 5B4WA 2FQFA 1MZZA 3IKOA 2UXTA 3FS9A 4KOCA 5I5JA 3RYMA 4JT6C 5CYKA 3EF4A 3BG1A 5EMJB 4A0AB 1K32A 2GI0A 4BXSV 3CFSB 1GS6X 4ENZA 2P9LC 3AL8B 1KGYE 1OCOB 4J78A 2IUPA 2BHFA 4WTQA 3RN1D 1ILUA 1CURA 2W88A 2XV0A 4G7SB 3JZNA 4YSQA 1JZIA 3WIAA 3EI1B 3FSAA 2H68A 3ABMB 3EH4B 4YSCA 3MKQA 2XL2A 3I8EA 3FM0A 3MBWB 4GGDA 1A4CA 1KV7A 2IDTA 2YXWA 4YSOA 3UAEA 1BYPA 5CXBB 1BQRA 2XV2A 3WNIA 3QJVB 3T6WA 3N0DA 3S3BB 5B1JA 4E9XA 2OIZA 2J5WA 5FA5B 2JFCA 4EF3A 3FU7A 4CY1A 7PCYA 2VSMB 3NJJA 1A3ZA 2PPAA 4J87A 1QHQA 4JSNC 4HCIA 4X61B 4DP1X 2QPDB 3GDCA 5TF2A 4GP4B 4I79A 2J56A 1SHXA 2HRHA 4ZOYA 1NIDA 4CZYA 3FU8A 2Z2OA 3IN2A 3CZUB 1J9QA 5EMMB 2P9UC 4DPCX 2BP8B 4J79A 2OVPB 3JPXA 1TEGA 2Q9OA 2VMJA 5F7AA 2J56H 4BUJC 2O9KA 1IUZA 2PCFA 4Z8LA 5CYKB 2H6KA 4PSXB 1ILSA 1NDTA 3OD3A 3SBQA 1ZDSA 4CSPA 4YSDA 4CI3A 5KDOB 4A0BA 1JMZB 5EM2A 4A7JA 2HXAA 4MK0B 2XYIA 1KCBA 4ZK8A 2YBAA 3QJSB 4JSPC 3BVDB 3V7DB 4A2LA 5FLXg 3NJHA 4L0PB 2DYSB 4UI9R 1PZCA 3ASOB 2CNXA 3SFZA 2PM6B 5IY5B 1MDAA 1JJUB 4PAZA 3RLMD 4H5IA 2EIJB 4N4YB 3AG3B 4YVNA 4GM9A 4ZOZA 5SXMA 2HX7A 5TEFA 4D6VA 4DP0X 1KDIA 2H13A 1DZ0A 2OCCB 2UX6A 2IAAA 3I7HA 3V5WB 4QQEA 1RI6A 2RACA 1AZNA 3S3DB 3PSLA 4CY3A 2OK6A 5FKRA 3N55A 5I6NA 2I85A 1ID2A 4BWWA 1MDAH 3WI9A 3I7LA 4EWRA 2I0TA 2FQEA 3C75A 1MG2A 3MZLA 3FU7B 2GC4C 1AAJA 4G72B 1XIPA 2TSBA 3ABGA 1X9UA 3FQ2A 3TBCA 1E67A 3C75H 5PAZA 3U4YA 1GXRA 1J9TA 4E5ZB 1AZBA 3NSCA 2I3SA 3EG6A 5E9NA 3EU7A 3KRXB 2XU9A 1WA0X 4GYBA 2W18A 1JZJA 3FSZA 4KO7A 2FT6A 4F7KA 4OWRA 4G56B 2E86A 2LLNA 3E0CA 1NINA 3L4OD 4ES0A 4NAJA 3TASA 1AZUA 2P80A 2YB8B 4ERZA 4UANA 1SJMA 1NPJA 2GIMA 4QLWA 3ERXA 4ZOXA 4CY5A 1S4UX 5EM2B 4QT8A 1A4AA 3AW5A 1MG3A 5IGQA 4FA7B 3F3PA 3F3FA 3QJTB 1F56A 4GGAA 1JZHA 2BO0A 1JVOA 3DXMC 4AEZA 2AZAA 5D4HA 4JXMA 5GXIA 1GSKA 1ADWA 1W8EA 3IBOA 4DP4X 2BZ7A 2PPDA 1KBWA 1Q47A 1CYWA 4BDVA 3N2JA 5AJAA 4FB1D 3NJIA 1GY1A 1IBZA 1WAEA 2CALA 2Q7QA 4GQBB 2H3XC 2XX1A 3EHBB 1VYHC 3PE7A 1V54B 4CY2A 3I89A 4GGCA 2NRDA 3OKWA 3UKUC 2AZUA 5TDHB 2W8CA 2HXCA 4P5SA 2AGYA 1DYZA 1JOIA 1R5MA 2HJ4A 3CIKB 3MXXA 2J55A 2GHZA 1PNDA 2WO2B 2IDUA 1E30A 1EZLA 3P4FA 3X2QB 3WKQA 4PSWB 8PAZA 3NJFA 5B7MA 5TK2A 5FKTA 1GW0A 2HRGA 2XX0A 3IN0A 1J5CA 2J55H 3IJCA 2VN3A 2BWIA 3L45A 3PXLA 4CSZA 3RFGA 1JZFA 2EIMB 4NB7A 4E9SA 2AANA 2QPEB 4GMBA 1OE3A 1N6DA 2YQBA 2XL3A 3CFVA 3OKYB 4PBYA 5I5IA 1VLXA 3UVMA 5IGOA 4BH6A 2IDSA 1NIBA 3NJLA 2CUAA 3EI4A 4FWWA 1WS8A 4NSXA 3T6ZA 4YSTA 3BWSA 4YSPA 2AGXA 4FHLA 5B7FA 2B08A 1AS6A 1GYCA 4BWUA 2FQGA 5I5MA 3EMHA 3UKRC 5CXCB 3NSDA 4BL0A 1IKOP 1NIEA 4PCYA 2PM7B 5HE3B 2PLTA 3NVQA 1GP2B 4N14A 4QL1A 3FU9A 2ZXWB 1BYOA 2YXVA 1A0RB 2CCWA 3RMZD 4W9ZA 1ERJA 1IBYA 2TSAA 4HHGA 2OK4A 2HESX 3VA6A 1SDDA 5EALA 2UZXB 1AOZA 2YAQA 4DPAX 5I28A 2IUQA 3SHFA 5C2VB 1L9TA 1I53A 1OCZB 4UF7C 2TRCB 4J0XA 4RH4A 2I0RA 3F3GA 3DIVA 4GP5B 3H56A 3PPSA 3UADA 1HAWA 4DP7X 2OJ1A 1L9QA 4E9TA 3PVWB 1SF3A 1CUOA 4XYHA 4A09B 3EI2A 4PXWA 3EH5B 2P9IC 3AG1B 4E54A 1M56B 2PP8A 1SHWA 2GNQA 1N6FA 3JT2A 4DPBX 2CO0C 3DM0A 2HZHA 3FYEB 4L3HD 2QT6A 2GBAA 2CE9A 4A08A 4WKXA 4ZOVA 3V9FA 2G9AA 4YSAA 2OVRB 1L9PA 1XB3A 1ZV2A 2QXVA 1PLAA 2B4EA 3NJNA 2XYBA 3SQRA 3UACA 1XHMA 1R1CA 3EI4B 4W1TA 3FRXA 1L0QA 3GREA 4JSVC 1WA1X 4ESGA 2IWFA 2I0SA 1JXGA 5I6LA 3OTTA 2H6QA 3KW8A 3JAMg 2IURA 3OW8A 4D0KA 5I6OA 3SWSD 3HB3B 4X63B 3CDZA 3JZHA 2Z2PA 1U2VC 4J84A 4O9DA 4CZXA 2XWZA 4J77A 2ZOOA 3ZX1A 2OJYA 4JKNA 5I6MA 1UATA 3DWLC 4PC0A 4AI7A 5FKSA 5H1MA 2H9NA 2PBIB 1GR7A 2FTAA 2IDQA 3J80g 5JWZA 4GY4A 3RN0D 5A2Qg 4DP5X 4DP8X 1SF5A 3NP4A 3ZBMA 3V9EA 2J57A 3WKPA 2P80D 4YSEA 2BBKH 5B1AB 2BCJB 3MZKA 1T5KA 3OMIB 3SJLD 3DSMA 1NICA 3EI2B 2A3TA 1YFQA 3GYRA 4FAAB 4A11A 1K8KC 2H3XA 1SNRA 4E54B 2N0MA 4HIPA 7PAZA 1AACA 1PLCA 3H4FA 4M3HA 3MMYA 1V55B 2BW5A 5B1JC 2GC7C 2DY2A 3DXKC 2IWKA 1PAZA 2WO3B 4X3EA 2VW6A 5H14A 4BXVA 3NVXA 5THAA 2YAPA 4N8UA 4A08B 1AG0A 5EMLB 1XB6A 4YVDA 2EIKB 1W6LA 4G7RB 3JROA 2FWLB 1AR1B 3QPKA 1NR0A 2P9PC 3GXUB 3ODTA 3ABKB 5I6PA 4A0BB 3WG7B 5B1BB
chains in the Genus database with same CATH superfamily
4QTIL 3S48A 2NTFA 5EO0B 4Z5RB 4QRPA 4Y9CA 1AQKH 2F1EA 2OMUB 1K2DA 4G42B 4M5SA 5AW3B 1PNCA 5B3JE 4YL4A 4G8IA 4Q6KA 3EFDL 4N8CH 4LQ1A 5CEZD 3SLED 4NKIL 3SKMA 2WXRA 4GXVL 1S7TA 1KYFA 3MNZA 4PS3A 2ZXBA 3MUGA 3MOAL 1FNAA 3ARBD 2ZWLT 3SPIA 3EZJB 4CI8A 2Z0UA 1NMAH 4GUPB 4PRPD 3ZE0B 5DURD 1NC2A 5ELIA 3I6KA 1GW6A 1ZSHA 3EQ9A 3GGWA 4N0YH 4OIAA 4XAKD 3QT2A 4ADIA 3F5WA 3VFVB 5HYQB 3CK0H 5IJ7E 3WFBL 4NJ9H 5HP5A 2ADYA 1TZIB 1V27A 4JFEB 5J6HB 4PJ5A 1TZHA 2AS5M 5M5UA 1E5YA 3A47A 3HPLB 4GMTH 4ZYKB 3PG2A 3PS6A 5E8NA 2QBWA 5CMAA 1KBPA 2WXLA 3OL2A 3RP1A 4Y19B 3QWRD 4FI6A 2ZKWA 3LN9A 5JQHC 1QQDB 5C2WB 5FDWB 3UVNA 3ZTJG 2K7PA 3G6AA 2RJMA 1HHGA 2E9JA 1O7DC 4JO1H 4WTZA 2MCPH 1C1EL 4EUPH 1CDBA 1Q72H 4WFFD 2X2JA 4F91B 4WW1A 3Q0HA 5D1XB 5L7XH 3D18B 2VWEC 2NQDA 4GAGL 3EBGA 3VXUB 4WO0A 4Y4HD 1UKSA 3NIFE 4LLUA 5I73B 1ZA6B 1KEGL 3WJMB 4YPJA 1KB5A 1OTTC 2ZXQA 3X3FL 4NQXA 3L3IB 1JI2A 3B5GA 3UDWC 4HJGA 2XQ0A 2XDWA 1Y6NR 1ZPUA 3IMTA 4OF5A 1DZBA 2H47C 3BUDA 2ATAA 4M93C 4PGEA 4YHIB 4BK5C 4PJFA 2XWCA 1LNUA 4ONHB 1I7ZB 1TOXA 1DBBH 5F6HJ 3V5DB 3MLZL 4BQCA 3KYAA 1XGTB 1AYOA 5KS9F 2A9BA 4WY7H 1ASQA 2X05A 1GS7A 3CLFL 2ENJA 4L0YA 1A7RL 2XWXA 2FIKA 3MGAA 4FXLA 1FVDB 1CVRA 3GMMB 5EIIB 4ZG1A 2IGTA 1CGXA 1JZEA 3KJ4C 4CADA 2GBUA 4Y4FD 1T1YA 5JMOC 2DI9A 1FPTH 1JHLL 2OV0A 3CX5K 5H94A 5FA4A 2PP7A 2Q7YB 2FNBA 4BSJA 4M6ML 2B5MA 1E8NA 2VDLA 4A2GA 5K1VA 4F5CA 3PWVB 5AVTB 3HAEH 4TQ8A 4ELKA 4HWBL 3O2DL 2BP0A 3JB9L 4GO6B 2GKIA 2VDLH 4DKFL 3NRFA 3EYUL 1YY8A 5FOBA 2XI9A 3G3LA 4X42A 4TUOA 4Z7QE 3N9GH 1GC1C 4L5FH 2VNCA 1SBBA 3U2JA 2X1WL 3HJ0A 5C08E 1JPGA 4Q2ZB 4YEEA 2F53A 5D4JA 4DEUA 4U3SA 2VDMA 2EBSA 3AMLA 2HFGL 3C5SA 2V33A 4N20A 1F1DA 3GXNA 3P11H 3OKOB 2VQ1B 4RGMC 2Y5QA 3KXFE 5GGSY 1CLCA 1CGSL 2VDMH 1A6TB 4NM8L 5K9OA 2JJWA 4U1MA 3NSFA 2BOBB 5D1ZC 4IRJD 2FECL 4TVPH 3BUYB 4U1SA 1RFDL 2E76C 1YDPB 3CSBA 2N0KA 3V4PL 1U58B 5LXGL 3PJLA 4IS6B 1SJEB 3HBPA 4IRSD 5KG9B 2R8SH 3ENEA 1KGXA 2YAMA 1ANUA 2R7EB 1NEZB 1OGAB 1IBFA 3HHMA 4AGNA 3HC0B 3QFJA 1K5NA 1MH5B 5TE6H 1XKSA 1MIEL 5F7NC 4YQXH 1WICA 2F15A 3DUHA 3O4OB 4U4IA 4WNQA 3BMWA 2CUHA 5ANMA 1AIFB 1DO5A 2R69A 2VDKL 3W11D 5I71C 5CN3A 1BX2B 3QHTC 4IRZL 1OTSC 2ZD0A 4H7VA 2FX9H 2VKXA 4EN3A 4AGQA 4YBLC 2R69H 2XRAH 2YQ2A 1KG0A 3RKDD 4WK0A 1T20B 1NBZB 3SBRA 3G04A 5CCHE 3EI1A 3DVFA 1P6AB 3KNBA 2X87A 3L3HA 4MDIA 4XBPA 4XNUL 5DD6B 1RIHH 1EJ6A 3RL2B 3TA3B 4JFSA 4UTCA 1AZRA 5EO9B 1TTBA 2OMTB 1UQSA 2V4LA 2PXYA 1KCUH 1N10A 1TQBB 3NJGA 4X4MA 3OZLA 3T0BA 5LGHL 1I8IB 2WP3O 2CRIA 4BV1A 5CJQH 1UOLA 1MFAL 2A83A 1TCRB 5GIRB 1DFBH 1MJ7H 1BGXH 2A6IA 2HCZX 2X88A 4L1HA 3CE1A 4CI1A 1HOCB 2W1NA 1GOHA 4HUMB 1TTCA 4PREB 5EULV 5F72S 3L4TA 2J1YA 1ET5A 1QEXA 2ETWA 1S9VB 2NY2C 3C5ZD 4JFDE 3X13B 1HESA 5I0WA 4A0AB 1Z9OA 4FC3E 4L8DA 3AL8B 1MCDA 1P9MC 2EYRB 3CN2A 3LTVA 4G2AA 5C09A 1KIUA 1AGDA 1N8OE 2VXTL 3AXLB 1KN4L 1G9MH 1CD8A 2H68A 1JJUA 1E3XA 2DH2A 3TO4D 1F8TL 3I75B 2IDTA 2XNAA 2XIBA 3CFJA 2NZ1A 1QMUA 3FT4A 3HC3H 4B9PA 1ND0B 2BERA 5E6IA 1P7QA 5T3ZD 4KKPA 4E9XA 5DUPL 3O6FD 4XCEB 3BPLB 2IGFL 3MJ7A 2JE8A 1BOGB 4HPOH 3AVEA 1FGVH 1U95A 4Y5VB 5D6DA 2BWQA 3CXDL 1G7QA 4BCDA 4JQVC 1Z6JT 3CDGB 3ZYIA 4AUJA 5IMLA 3VFPB 1AE6H 3QIUA 1U8HB 4MNHA 5IHUH 4D9QE 4ECNA 2ZX9A 4GG6E 4JPIB 1C5BH 3RJQB 5IGXL 2JKJA 3T3MF 4KK8D 3W9EB 2OVPB 1KLFA 5LHDA 4J3XA 5J0BA 1USQA 5IQ7L 1S5HB 2ALWA 4QXWA 3U9UA 1VEMA 3ZHLA 2C4FT 4F58L 3C2AH 4ZNEA 4A0BA 3CPLA 3OC8A 3RUGE 4MK0B 3LMJL 5L88L 2YBAA 1E9QB 1HEHC 3MV9B 2F68X 1FNHA 3N40P 2OL3A 3NJHA 3OXRA 1PCXA 4L23A 1FFRA 2JKXA 4S1RL 1D5XA 3W3BA 1UB5A 2OL3H 4W93A 4PJGF 5JDJA 1BQLL 1F02I 1KDIA 4AGPA 2XZAH 1TTRA 4RSVA 4AEHL 1BVNT 4DVBA 3T0WA 4QQEA 3LKPB 4ELMA 3QZNA 5D7JB 5JIQA 4BA8A 2VQTA 2V7HA 3GSNA 4OBSA 3GMLB 4RRPA 4CGTA 3FU7B 1LK3L 1RJYA 1UA6L 4R2GD 3ZT6A 2CKNA 2FEEL 3GSNH 1HIML 4HUKB 5BS0E 3FU3A 3EG6A 4WFGE 4PRIE 4HIEB 1EFXB 2E4TA 4ZZFA 1I7RB 2CUMA 4X5WB 1DQKA 2YQ3A 3UIYA 1GCYA 1BAFL 2W0LA 3L3KA 1AZUA 2P80A 4J1UB 3FTVA 4L2LA 4OLUH 4GMSL 3F7LA 5DEGA 1GGBH 3MRIA 3BYTA 3A4EA 3MJ8B 4PRAA 1KF9B 2IBGA 3IU3A 4JRYB 4XN1A 3X14A 4Z3JA 3QDMA 1QI3A 2NNFA 4WTXA 5K9KB 3LKNB 4Y2NA 3RNKB 5FHBH 5LO7A 5FYLH 4JXMA 1ADWA 2RFXB 5FLXg 1KBWA 4ZUTB 4Z8FL 5CD3A 3AADB 2R23B 1DVUA 4FGMA 4MX7B 4WUKH 5DJAB 1CTMA 4EI6B 1VZIA 1YNKL 3OBAA 2EIZA 5HI4D 5SWSA 2DMBA 5DRWB 2AGYA 4JANB 1F3DJ 1R5MA 1G1KA 2WAQA 1HL4A 1T7WA 4TMPA 1H8LA 4AW7A 3ZDYA 4Y16A 3KM2A 4YPGA 3P4FA 2W59A 1I1CA 2MQ3A 3O3DA 5JW5B 4NKMA 3RTQA 3EGXA 1MF2H 1VFBA 1R3HB 4FXTA 5I1LA 1CBJA 3K1DA 3M17B 4R4BA 2EXTA 2D7TL 2D9QB 1T5WB 5LWYL 3EYQD 4NENA 2VXVL 2WBJA 3GMPA 4MA1C 1B0IA 4DCQB 3P0VL 4KZDL 3ZE1E 3GXIA 1TETH 2YQBA 4NQCA 3OKYB 3CC1A 5HJBA 3Q44A 4HOXA 4NYLA 5DRZA 4F9PA 3WKYA 4LCCC 5JPNA 3EG9B 3L17A 4K8RL 4R9HA 4KHXH 3GK8L 4ZPTA 5IMKA 3VTMA 2A6DB 2PLTA 2ITCB 5C0DA 4L3ED 1QFWL 1B6DA 1BPOA 3K6FA 2G5BA 1S8DA 2Z93A 5KEZA 5DJDA 3ZQ9A 5AVSB 3ESUF 4HHGA 2WVVA 1NCIA 1YY9D 4XP6L 5IOPB 1KULA 3FJTA 4S1QH 4DKDC 1Y18B 1T1WB 4HMDA 4LMQE 1G7PB 4JGNA 2ED6A 1ZE3C 3ARZA 1I53A 4L29A 4BQ9A 3S34L 5I66A 5IB4A 4J0XA 4ES0A 1QFWM 1HNFA 4RGNB 3HG1A 3UBXB 4PLOB 4UT6A 4DVRL 4OQTA 4NWUH 3TXAA 2A6JA 2WYTA 3LRSB 1ITBB 1VF5C 4MJ6B 4HOZA 3QPXL 3BDYL 2B4CH 5I8EA 1JDAA 2FEJA 2HFEA 3IFOB 4R90H 3JT2A 1UWXH 5DEJA 1KJVA 5EIIG 3N85H 5GRUL 5DHMC 1HYRC 4EPSA 4WSGA 2QT6A 7TAAA 5K1NA 4YFEA 4F8NA 3C6LA 5K59E 3KLQA 4JZJB 4XCCL 5EOCL 4QNPF 5TQ2H 2Z1PA 2M26A 4LLMA 1A6ZB 3FB5B 1G0DA 1G9NC 2PYEA 4A11A 1A4KA 3SQRA 3ZRFC 4RAHA 1P4BL 1DVZA 2GBTA 2IWFA 4FQXA 4GQ9L 2W65B 5C3TA 3V0IA 2IURA 4LRNL 5LXVA 2IANA 4BM7A 4PP1C 3W0WE 1F4YL 5HHQB 3K46A 5H1MA 4PC0A 4YHKH 4UM8B 2PBIB 4W9FC 2GTQA 3G5YA 1W0WA 2VDNA 4DP8X 4FYQA 4JFED 1JGLH 2X6CA 3EOTL 1OO2A 3FULA 2BCJB 1AHMA 2C5DC 5EC1B 1KBBA 2VDNH 5EEUA 3JTTB 4Y19D 4H20H 1DDTA 1AACA 5DXWA 4I85A 1L4IA 5MI0B 1FL6A 5DFTA 4EBQH 5EN2A 4FULA 4E36A 1BZ9B 1J8HB 4UTAA 1ACYH 3PUCA 4X6CE 4PJIF 5D1XD 3MGOB 2EH8L 3CHRA 3M86A 1ZLWH 1NEZG 2PCFB 4NO5B 2ZSVA 3VXUD 4FX5A 3B2UD 4UTAH 1Z9MA 3WJJC 1JF1A 5I8CB 1EJOH 1XIWB 4CU8A 3B7FA 3UTZB 1WBXA 3NT0A 3IJHA 4JR9H 3MO1A 3ZJAA 5K1CC 4RFNC 2VLRB 1XGPB 3DPBA 4WO4C 1BBJA 1XF4B 5BMFL 2YAOA 4JHPC 1BDYA 5I16B 2GB2A 2OCJA 1UH3A 3PP4L 4XH2B 3FBQA 1HXMB 2W9DL 1B4TA 2GTZA 4GRMA 5KS9B 1N64H 3EJSA 4AYID 5F1IB 3RFHA 1CGUA 3QCVL 3TP4A 3UGEA 4F92B 4LZKA 3T2NL 5K9JH 1NGYB 4P5KB 4TUKH 3GHEH 2HMID 2IGLA 3OJDB 2V37A 3FT9A 2XZCH 2IAAC 1XL6A 4KY1H 1AXTL 3BIAX 4X0KB 4F8QA 3BW9A 2WZ6A 4NHUB 4ALAL 2H9PA 5AOLA 3LPFA 4KMQA 1KTLB 3S96A 1IGML 3V4PB 1X3DA 4ZD3H 4MS8C 1KCRL 5F7WC 3NA4A 3NIFA 1HE7A 4ILDA 4DZ8B 2X4RA 4XC1H 1UEYA 3CNKA 5DHXB 1SZNA 1KYAA 1IGFL 2FDBP 3V8CA 3ZSSA 3QJUB 4KKAD 3ATDA 2VDKB 2WQSA 4TVSa 5LBSH 2VIRB 4K9JA 3DROA 4P9HH 3QRGH 3D08A 2XV6B 3MCLH 5SX5H 1M53A 1U8LA 1OP4A 3WNJA 4G1EB 1A8ZA 1AS8A 1A3QA 5GQBA 3G5VB 3TJPA 3KBHE 3HE6B 5HHPB 3ZTNH 4NOFA 2ZE0A 2A7BA 5DVKA 3ARQA 5JW4N 1KPVA 3QO0A 2AXWA 3E2HC 1N4XH 3R06B 5EHFA 1CLYH 1DJHA 4S1DD 2ZNWA 3PDOB 3HG4A 3HUJF 1AR1D 4PPTA 4Z7WF 1XXFC 1HQ4B 2WQXA 5E23A 3QIWC 3VU2A 1AOHA 1ES0B 5DZOA 4GSXA 2BNQB 4DPRA 4J3UA 4MD0B 2VJ0A 4JY6A 1K72A 3UBGA 2X53A 3T0AA 2YA1A 2FB4H 1DUZB 2DM4A 5AB2A 2HFTA 1FFNA 2GC4A 2LAGB 3IMRA 3L7FA 2FGWH 4PJAE 1BPVA 5B4MD 3RGBA 1N0LA 2IWGA 1NGZB 4XRCA 4LT7A 4WFEE 1XCWA 2JQZA 4Z7QA 1RU9L 5T1MB 1CFVL 3V7AG 1FDLH 3MLRL 4P59H 5C08A 1Z3RA 1OSZB 3E8VA 1GKEA 3PP3K 1J0YA 4O45A 2OJEA 3RBSA 4AJ0A 3DSFH 3CFEA 5DLMH 4JFYA 1X5HA 1T6BX 1KGWA 4DGIL 3QUZC 3KXFA 4F1ZA 4FFZA 2WVTA 2HTLD 4NUJA 2ICES 3CQQA 3DX2A 2IH8A 2IMMA 4ZFOL 3BSZL 4ZTPH 4TQEH 1S3KH 3LKOB 5CS7A 3OX8B 4X7TB 3AU0A 4XO8A 4XVJL 3I2CH 3C5JB 2XJLA 3BQVA 3G6JF 3MLUH 3MRNB 1QFHA 2VM4A 4LVHC 1E2ZA 3R8QA 2GUYA 3V0WL 2YMUA 3KDMA 4PTUB 4WVRA 3AT9A 3AJ7A 4MRBA 3IRPX 4DGVH 2RTTA 2WCGA 2YAHA 4O02H 1A7NL 4R84A 2IG2L 4AQZA 3HS8A 4M4RB 4X9FA 5KBPA 1B9YA 5H35B 1PZSA 4CNIA 2BVQB 2NY0C 4JX0A 5AD0A 3U9PH 3VXTB 3FO9A 2KZBA 4AIZB 2FD6H 1FI8C 4L2YA 1H2YA 1NWOA 2IH3B 5CBEA 1S78D 2Y2TA 5GS2D 2H8PB 3VMOA 1KJ3H 3UBHA 3KPLA 1H5BA 4P4RB 5C6WH 5J13C 4HU2A 3MCG1 5EMKB 4BFIB 4EIZC 4LCWB 4BBWA 2WVUA 4HIXL 4AOWA 3P4OA 3A5VA 1NH6A 2YD0A 3K8MA 4LSRL 2WLJA 4LKCB 5CJ5A 4AT6A 3UC0H 1UFUA 1ZJAA 2IOMA 2QHRL 2K4AA 2HKMA 3SY0A 1DL7L 1KGIA 1IEHA 1CR9L 3NVNA 4P07A 5D93C 1BFSA 2WIIB 4FYSA 4KK5D 4WHTA 3UYRH 3CFTA 4ERYA 4M00A 1G7JA 3F7VB 3GSVA 3SBWC 4J6RL 2F7IA 2X9YA 1TYJA 4YHZL 4D8PA 1FC2D 1U8QB 1FJ1B 1NMAL 1JXDA 1WQVT 4KX8A 3U0PB 3VFSB 2L7EA 3T3MB 3VWKD 3U1PA 1D6VL 3PHQA 4JFDA 3IM1A 2Y06L 3DRTB 2J88H 3O6MH 4JPWH 3U46B 3D4YA 5IQ9A 4ZO6A 3GB7B 3HVNA 1NFIA 3H4HA 3VMNA 3ABLB 1JHTB 2H47A 4OAWB 1NGQH 5GGTL 5IVOA 4IA9A 1F18A 4DEPB 4MLIA 1CTNA 1EZSA 1E4HA 3RU8L 3SYCA 4O3TB 3MV9D 3FB6B 1TCMA 4J3WA 1BD2B 3RWIB 2I9LA 5L9DL 4PJGB 5DUMH 4QT5A 3I7OA 2O6FA 2WLIA 5I1KL 2BOLA 3C8KA 5C0JB 1FUNA 2ZX8A 3MA7A 2UY6A 2YO3A 3N42F 5EU5B 4DNLA 4KMLB 1H8SA 4NBYB 2YNOA 4LP4A 2FQFA 3IKOA 4KOCA 5D7JD 3MPCA 5JNYB 3ARDB 3FU6A 1MLBA 3SE4C 1P7BA 5GS3A 4ZTOL 3VG9C 1WCBB 4ONFH 3UBXG 2YQGA 1QFSA 2VLLB 4MVBC 4XB8A 2GABA 4FQCH 1M7UA 3EH4B 3OGCB 4YSCA 1DSFH 2ZYHA 4HIHB 2QADC 2VN6A 1Z9NA 2GJZA 5GGRA 4APQA 1EFXD 4ZNCD 1SLUA 3RUGA 1SMDA 1DVSA 2K3HA 1BQRA 3D3VB 3ZKSD 2VRKA 3FO0H 3N0DA 4G83A 1FG2A 3P3YA 1KB5L 4OF0A 5B22A 3QI9C 5LDSA 3H6AA 4LDEB 4J2XA 1BQHA 1IGTB 4K3HA 3II2A 1A3ZA 1JRHL 1UA3A 3U7YL 1FBIH 3F12B 4GG8B 5M5VA 5EU4B 4P8QA 2CCLA 2XA8L 2DQ6A 1E27B 3GBMH 4WY7L 3ZYOA 4I79A 3T2QA 2NX5E 3RKPA 2C3VA 5DJXA 3VWJC 5JIIA 1CD0A 4LF3A 1XZ0A 2A9AA 3VRJA 2G4EA 3WE6A 4HLJA 2OSLA 2AABH 3TVMB 5F9OH 2QQNL 3SSGA 5DS8A 3MODL 4YH6A 2ROYA 4PHZA 4HK3J 5BS0A 1KNOA 2XYIA 3OG4B 2EDJA 2DMHA 3DSNA 3SO3B 1CXKA 4RMRA 3PQYE 4WV1C 5E4EC 4YDKL 1T7VA 1IQDB 5FECA 4HUUB 4CGUB 2JIXA 4LKXB 4WEMB 4RFEB 1UJ3C 3SQBB 2NNRA 4GO8A 3E8UH 3APNA 1ID2A 1UOKA 2FWUA 1MG2A 3LKRA 4IK7A 4OM1L 3X11A 1I8LC 1F0LA 1CLZH 3KBEA 1OAUH 2KUTA 4MCZB 5F89B 1DBJH 1CZ8H 4H2AA 4ODVH 5HGBB 3MLXH 2NUTB 2IPTH 3EOBB 4UUJB 5DQJA 2CA3A 4LO9A 3WNPA 5E9NA 3STLA 2EC9T 3IXTB 3IETB 2NXZC 5DQDH 3AREA 3MNDA 4XVTH 5FKAB 4F7KA 4HUWA 2D3VA 1EEQA 1NCWH 2A4EA 3QEHA 1MRCH 4QCIB 3E0CA 1MHHB 4NAJA 3TASA 3CMGA 1TJGL 4JHNA 5EBWA 1A7OH 2ICEC 4LEOA 4U33A 4ZOXA 4MCMA 2CMRH 4JFUA 3T3PE 3O3AB 1S7SB 3QJFA 4FQIH 3BVXA 5TE6L 3U4KA 5LQBL 1MG3A 3IUNA 1SOXA 1F56A 4P46B 2YJLA 3ZE1A 3DX6B 2KH2B 4C4BA 4MJJA 4FTVD 2FX9L 2PPDA 1P9MA 3MJ9L 3IGAB 3VXPB 1EO8L 4Q0XH 1ERNA 2JELH 4GH7B 4R6UA 1BFTA 5DTFA 3BQUC 5CKAA 1I1YB 2QQLH 4NC2B 4P5SA 1DBML 5J1TC 1A2YA 2W0PA 3MV8D 1UD5A 3B1TA 3ARPA 1U41A 2ZCKH 2C4FU 1DSYA 3CFCL 3P30L 4TN9A 4ZO8A 2WO2B 4ZUVB 1QPPA 1WAAF 2VR9A 4GAJL 3A6CL 3MLTB 4N25A 3NBNA 3IVKB 3MROB 2DLEA 2D03H 4Y1SA 5E6YA 2IAMB 5B7MA 1HWWA 3MRGA 5HGAB 2OK0H 2APVA 1C5DB 4I18B 4JO2H 4D8OA 3R0MA 2R0WH 2WN2A 1N6DA 2JKRM 2P49B 4HZLB 2WBWB 4D2NA 4JJ5A 4X6FA 1VEPA 3EQ7A 2FO4B 3DDUA 2CXGA 1GYCA 4HK3N 3T65A 2YPVA 5J11B 1HHJA 4G3YH 2H45A 3UKRC 4BL0A 2H2SC 4LFHG 4JFQA 2F74A 5F0MB 4Y2DA 2AEOA 5DJ0A 4JFOA 2EXYC 1ERJA 4JKWA 1QSFE 1PJ9A 5I17B 3CD4A 1ZHKA 4JLRB 4KTDL 4PJIB 2AJVH 1J8HD 1E4XI 3CN0A 3HZMB 2MKWA 3PWPB 4MDJA 1OCZB 3B5TA 4JRXE 1VZ2A 4MGXA 4NP4H 1G9ML 3FZUC 1L9QA 1BVLB 1QW9A 4U1KA 1OT4A 4WF7A 3ZQXA 3CMOL 5BV7C 1NLDH 1LP9E 1XVSA 3W0WA 3NCCB 4E54A 1BZOA 3RVWC 4BP9A 2GNQA 1T0NB 4LNVA 4LDCA 3O0RL 2VLRD 5EWIL 1H2ZA 3IMWA 4Y4KC 1KXHA 1IKFH 1EEYB 2LVEA 2D7PA 1M7IB 3S88H 2OSXA 5JHBA 2F5BL 4F8TA 5D7LB 3EI4B 3SCMC 4U0RB 4BHUI 4G8FA 1DEDA 4Y8DC 1MIMH 1WVZA 4GUCA 3SKNA 5CCGE 2YPLB 1JGUH 2JSFA 3GJEB 5DA0B 1RL1A 3ZUNC 1BIHA 3QWNA 4HJSA 2LVCA 2ROXA 4LGSB 4XCYA 3OW8A 2J6EL 4N8VA 4ZDHB 3BIKB 3JZHA 4FNTA 3CVHA 4X6CA 2F8VA 4XMWA 5FHAH 4AL8C 4M1DH 2NXYC 3PAYA 3R18A 3J80g 3ZKXB 5JYLA 3RN0D 4TLSA 1VSCA 2YR3A 1M1XB 3DTXA 3MN8A 4UT9H 3DX9B 2BBKH 4AQ8A 2B8OT 2OL3L 2JCWA 3HG2A 2K7QA 4LOFA 4Y5YC 3SD2A 1UXSA 5JYMA 3QZOA 1JYVA 2DF3A 5E00B 3WMPA 3WXWH 1S9KC 2XFGB 1LJMA 4R83A 4MKMA 4TTDC 2V9RA 1K8KC 1FG9C 4MMYA 3F6LA 2VLMD 4POUB 1D6EA 4DSYA 4DERA 1F6AB 5DMYA 3HE6D 5G4OA 3V79C 2RB8A 4U6VH 1AGBA 1YHPA 3HUJB 4H25A 4LBEB 5FW6A 4FG4A 1AO7A 3I85A 3QNYB 4P4KB 4ZFOB 2CQVA 2WXKA 1SEQL 2AQQA 3CFBB 4O5LL 1INQB 1OTUD 3B7RL 5EPMB 4LFHD 1PD1A 2VL4A 2WXGA 3Q2LA 1UCBL 4ZXBA 2VZSA 1R5VA 2Y69B 2BNQD 3ZDYF 5HHXH 5A3IC 3WKMH 4PNKB 1P5UA 1G7LA 1OPOA 3B9KB 2C7UA 3CG8A 4GRLB 3ULUC 4FFWD 3EW3B 3OQRA 1FZOB 4GM8A 3DKHA 1UTCA 3N1MC 2DV6A 4PN6A 3BDBA 5EU3A 5AVYB 1U3JA 4JL2A 2JKTM 2L04A 4GQ2P 3SYPA 1Q9LB 3NACL 4LLYA 2QLYA 3MXWL 4MMZC 3LEYH 2R0KH 5C0CE 5D2NC 4YHYB 1FNFA 3Q43A 1I7TA 4MMXC 3DX4A 2VDPA 2YEQA 1ZE3H 4CC1A 1WZ1H 1OE2A 3C09B 4IDLA 3NOIA 3NRPA 3WNKA 4G6KH 5I6KA 2YRBA 1G5AA 2UVFA 1YYMH 1E3FA 1MF2L 2VDPH 3BE1L 3POHA 1JOFA 5HE2B 5I5RA 4YK4B 3H3BC 4GQRA 1I9IL 2NTFB 3GI8L 4KVCH 1KIPA 3KPRA 4IMKC 4QRPB 3JVGC 1PFCA 1K2DB 1LO3H 2IOOA 1MNUL 3QVAA 4G8IB 4PWJA 4PJAA 5I1AA 5JDSA 1RSYA 5AVZB 2BIHA 1CMOA 1PLBA 3WIIH 2C34A 3ISWA 5EZOH 4NN7C 5AZUA 4F2FA 3SKMB 1A6VH 1S7TB 4G7QB 2Y2YA 4E41E 3MNZB 4F7CA 2E47A 3GI9H 5CZXD 3MUGB 5D2LE 5HYSG 4CVUA 3I8CA 3UR4A 4XP9L 3JTBA 5KVFE 1BECA 1JMZA 2AEQH 3O6KL 4WJKA 2LTQB 4DUVA 4S1QL 1G7MA 3I6KB 3DOSA 4OLYH 4K7FA 4PD4K 4RIRA 4N9OB 3LS5L 5KUMA 5HE1B 3I50L 2GFBB 4ODXA 3WHE0 1PW3A 1GCFA 3GIVA 4LCWD 3Q8EA 2J43A 3F5WB 4MAYC 2B5NA 4MB1A 3P1VA 4A2FA 4UT6L 4A67A 4UT7H 4PJ5B 2ZSWA 4OQTL 1TZHB 5L4JA 4BFKA 2MNJB 2AK4E 5E8NB 3ARUA 3ZDXE 5CMAB 3OL2B 1CFNB 3RI5K 4R4NC 5B3JF 2O5YL 3B3IA 4LQFL 5EB9A 3SE8L 3QHZH 4D0DA 3ES6A 3EGDA 3UJJH 4AC4A 3G6AB 1HHGB 3T8MA 2RCSH 2GCYA 3WJJA 2ODHA 2AXGA 2VQ4A 3IDXH 3C08L 4NRXA 2HKRA 4K9EL 2ZUUA 4PJDE 3VX1A 4LLUB 3P3UA 1KB5B 5I1GH 4NQXB 1RUML 3U82B 1HILA 1TEFA 4HJGB 1QX1A 1W0VA 5M95B 2X6VA 2Y9RT 2IFGA 3IDIA 3U1QA 1IGYA 1BD2D 1ODUA 5C71A 3N42B 4PGEB 3N44F 4PJFB 2DICA 1LNUB 1WS7A 2ZXCA 3HHRB 3EI3A 1JE6A 4P3CL 3VFGL 3CCHA 4FFYA 1ET7A 4LLAA 3UZQA 1MJUL 1HK6A 5C1MB 2ZOLA 2Z8WC 2FIKB 2NR6A 2J6WA 4TLKA 1WEJL 1D5BA 2BNRB 1KOAA 3UABA 2FSDA 1JGVH 4CADB 1F41A 1T1YB 1TFHA 3J81g 3VAEA 4ZSOA 1AIZA 2YWYA 2W9EH 1FFPA 4B96A 5H94B 3S0PA 4UTAL 5FA4B 1TENA 4KTEL 3SB3A 2VDLB 3NIFF 1H3PH 3BVTA 1M57B 3KLAA 4DT2A 1Q38A 5IFAH 3D3VD 4ELKB 4KI5C 3TIDA 2QPFA 1IFHH 2BP0B 4L1LA 5J4MA 1FL3B 3VFMA 1ACCA 1X9QA 2W07A 4QI3A 3WCYA 4XPFH 3SDXE 5CXCA 5FOBB 4TUOB 4UQ9A 3P2BA 4GT0A 1J5OL 1F58L 4OJEH 4U7AA 4JHAH 4K8RD 5GRWA 3OAUH 1JPGB 3QDAA 4Z7UE 2FNWA 3GHEL 3UIZA 3O81A 2VDMB 4HK0B 4FNLH 5F7YC 5GMKn 5FWRA 4F2EA 3CX2A 5FFLA 2WNGA 3AAZA 3LPGA 3RGHA 2WUCL 4LBAA 4M6OH 2EQDA 2MMXA 2CO0A 3CBKB 2PF6A 5K9OB 4U1MB 2DDQL 5DGRA 4W9LC 1V10A 4U1SB 1UM5L 3OXSB 3WGUB 1IC0A 7CGTA 1GHFL 5F6HI 4F1SA 3ILEA 2QDWA 5TF1L 5E8OA 43CAA 5HJ3A 5LAPA 4S1SH 1K5NB 2H2PD 1DJXA 4JBSA 2HT4D 4V2BA 4YDZA 2VRQA 3RYMA 3QUZA 4W6WB 1ZT1A 4Z7QF 3RVVD 4L9LB 3ZTNL 3TN0A 1K4CA 5F7LB 3UPRA 4PJCE 5C0FA 5DJ6B 2NX5A 1VGKA 2BHFA 1H3UA 1KG0B 1O6FA 4WK0B 4QOKE 4EZKA 1E5TA 4G11A 1JZIA 3G04B 3O0LA 3EI1B 3KNBB 3L3HB 4MDIB 3K8KA 4XBPB 1IX2A 1XSKA 4WDIA 4XNMA 1FSKB 1V3MA 3A67L 4XHJD 4HS8L 3ABZA 1UQSB 5F96H 3UFIA 2PXYB 4M1GL 4M8RA 4ZW7A 5JUEH 2J5WA 1UCTA 3PQYA 2ADIA 5IK3A 3PP3H 2CRZA 1TVDA 3ARBC 2A83B 2R51A 2A6IB 4HCIA 3BKYH 4QJ4B 1U3YA 4DP1X 4E5XG 4HSQA 1WO2A 4UOJA 1EGJA 4P46D 4H8WL 4EI5D 4CZYA 2J5LC 3CZUB 4O2EA 3CHQA 5C7XL 3QWQB 1JSYA 4K0OA 4N90D 3NEOA 1EGJH 4D0CA 3DSFL 3IJEA 4BINA 5JW4M 2JB5H 4JG0L 2NYZA 3ZSTA 3BVNA 1A7QH 4CSPA 5BW7C 3ZUCA 2X1XR 4W81A 2I5YL 2PCXA 3TZVC 5C09B 4WU7A 4JY5H 1KIUB 1RZKH 4TQEL 4OVUA 1AGDB 2F9BT 3BKCL 1OP9A 4DFIA 3P0YH 1D7CA 4FFZL 4N2CA 1RPUA 3SFZA 2IAMD 1JJUB 3GMQA 4GM9A 3JWDL 4YIQA 2P26A 1ZT4A 1X4XA 3THMH 5TQ0L 3K6IA 2XNAB 4NZJA 2ZOUA 3CFJB 2YGPA 5DZJA 2OK6A 2P5ED 3LQZB 2CGYA 2OBGA 3WFZA 3WI9A 5E6IB 1P7QB 1A12A 2HPOA 3MJ7B 3ARVA 3BH9A 4XC3L 4GEJA 3RE0A 2UZIL 1E40A 3EYSL 1U95B 1QHOA 1BEYH 5HJGA 2K70A 1E67A 4C55A 4IOSA 4AZ8A 4Y4HC 5ABAA 3MNVA 4L3CA 2Z31C 2ZKXA 5IMLB 1QUNA 4L9DA 2VXUH 2FD6L 2FJGA 3QIUB 1QBLH 1KLFB 4LVEA 1DQLL 3EGSA 5HHOE 3WU1A 4K5MA 3PWPD 3J7HA 4NKDA 4UANA 3U9UB 1X5GA 1MCPL 3FQ4A 3X12A 3CPLB 2Y23A 3S5YA 4XPBH 3WNNA 3FRPG 2BX5A 2ZOTA 1LTXA 3FUFA 3AW5A 3MOBH 2BHUA 3NIDA 2OL3B 2KERA 4PVBA 1KCKA 2AQ1A 4PW9A 1D5XB 2V6HA 1J1XH 1CF1A 3KGRA 3SE4A 1UB5B 4OF7A 4XXCC 3MBEA 3MJ6A 4Y4FC 3VXMA 2RIKA 3UXFA 2XX1A 3GTTA 1G84A 3T0EC 3LZFH 1PG7W 5TDHB 3VMPA 2W8CA 2V7HB 3GSNB 4M6AA 2QELA 5D7LD 4LVNB 4CMHB 3DI2B 4GQZA 3ECUA 4RNRA 1QSFA 3DA0A 3QRLA 4E0RA 3LRKA 2HH0L 5BUPA 4URTB 4GG6F 3IJYA 4JRXA 4WTWA 1Q1JL 5DD0H 3BPOB 1JAEA 1F6FB 1RD6A 2DJUA 2QPEB 4XMZA 2YIHA 3N41F 4YFLF 2DW5A 5IGOA 1GAFL 3H3KA 2EUZA 3NJLA 1A14L 3RUGF 3ARGA 1IC1A 1CJYA 4GBXA 2WQWA 2AJUH 4LSUL 3S5ZA 4BWUA 1WTLA 1MCNA 3MRIB 3GQFA 3SGJA 3IWUA 3RY6A 3X14B 5L2KD 3QDMB 2DYPB 3BKJL 4C57C 3P40A 2CCWA 2QR0A 5A40E 1QBML 2V8MA 2HRPH 1JUFA 2AXHA 2UZXB 2EC9U 3QUML 1MCLA 2AGJL 3N04A 4PG2A 2TRCB 2L7JA 4IRSC 4RH4A 3UAFA 1MI5E 2EIZB 2QKIC 3PPSA 5SWSB 4P4KD 5EZPA 1SOSA 3ZN6A 4HJ0C 5GGQH 3EI2A 4BSVA 1UJ3A 3I6LD 3ZDYB 4Y16B 4YPGB 4F93B 4LCUA 5E99H 3O3DB 3W11C 3BZ5A 3FO0L 3RTQB 1OAKH 3EGXB 1X7QA 5IJBC 1XH0A 4HS3A 5I1LB 4HW6A 1HSAA 4R4BB 2RD0A 3EJCA 4FNUA 1I8LA 3QUGA 1UH4A 2A9NL 4NENB 4A08A 1FBIL 2WBJB 3GMPB 2FBJL 3B9KD 4GRLD 3HFML 4WTZG 5SX4H 2OVRB 4NLAA 4NYLB 5DRZB 25C8H 1NBCA 4TNWF 3MCYA 5JPNB 2I0SA 2CHNA 3OTTA 4YX2H 4ESGA 4XOEA 5IMKB 4ZPTB 4QRUA 2Y07L 32C2A 5IOKA 5C0DB 2OZ4A 3K6NA 5LNDA 5EIQA 3SE3A 4UZGA 1S8DB 2D3JA 4ICWA 4UQ2A 5DJDB 2NY7L 3IDYC 4N2LA 2WVVB 4OF8A 2FVNA 2F8IA 5DD5H 5K93A 4BCXA 1LMKA 2OZ4H 2VDQL 2A4ZA 1R5WB 2KLRA 2Y7OA 3IUMA 2IDQA 4BCBA 4CW1A 5I66B 5CUSH 4L29B 2IO5A 5IB4B 2Q3AA 2AAAA 2HWZL 4H88L 5E5UB 1FQ9C 5ADPL 1XEDA 3RZCA 1OZUA 5K39A 3C5ZC 1FLTX 5I8EB 4M5ZL 2HFEB 3I6SA 4NWTL 1KJVB 2ARWA 3FUJA 3FT1A 3ZE1F 4MNGE 3C6LB 3NPSC 4NC1E 1MCCA 4LLMB 2JQAA 3TBVA 3GXUB 2PYEB 2ATPA 2XTJB 3TO4C 5D4QA 3LKSA 4FQXB 5C0CA 4R4FH 3UJIL 1XBRA 1J8KA 1O6TA 2VR3A 3ZZQA 2K8MA 4OZHA 2J57G 2C9VA 2IANB 4PV9A 3X17A 3O6FC 3I2NA 5AAMC 3CLEL 5ANHA 3APDA 4C56E 4J8RA 2QVFB 1SQMA 4AM0Q 3G5YB 2AQTA 1W0WB 3UGXA 3VE0A 1TIUA 2R29L 3DX8B 3L1OL 3PXTD 2I26N 4PJ5D 3QQ3B 1C9SA 4FAND 2ZUQC 4G55A 3DBXA 4KK8C 3L3OA 3AL9A 4U7KA 1FRGH 4XNXH 3RVTD 35C8H 4W9EC 1A4BA 2DQIH 4ZW8A 1I8MB 1QFOA 3EADA 3VD4A 1FWXA 3OLGA 2QQLL 4E41A 1FL6B 4X0NA 5K59F 5EN2B 2QDVA 2EIEA 4Q9RH 2WWOA 3NAAH 4YDLB 2ZYIA 3HN3A 1MFCH 1R33A 4I0KA 5C0IA 5CXBA 4IJ3B 1ZVNA 1ZS8B 3S3SA 2ZSVB 1I7UA 4L4JA 5BV7H 3T4AA 1CE1H 1JF1B 1QVOB 2X38A 4F7EA 2OK0L 4X7FC 4OD3L 1A1MA 4NJAH 4TNVF 4OCNC 3NYKA 3CSYA 3IJHB 3MO1B 4JM0A 3DYPA 3DPBB 1OWRM 2WWKO 2D3NA 1BBJB 3N44B 1JV5A 5B7EA 1B3JA 1Y0LA 4R2GC 1X9RA 1I1AD 5FYJL 2AK4A 4JFFE 2WPGA 4F8LA 1OCRB 2GTZB 4GRMB 5TE7H 3ZDXA 5T3XL 3FQXB 1J5DA 5E8DH 1IQWL 1JK8A 2YPVL 1DBKH 3PHAA 1JNNL 2UZYA 2CN2A 1CVSC 3SE6A 2CO3A 4QHPA 1RP9A 3UTTA 5F3FA 5IJKC 3BW9B 4M61B 3L1GA 2BNRD 4AL8H 2JTYA 1ZANL 3UZVB 4J81A 3X1NA 5F71A 1NBYA 1HN1A 2L7UA 3S96B 1EHLL 1A3RH 2VDOA 1F97A 1N8ZA 4PJDA 4X6CF 3NIFB 3FMGL 1CFMA 3QFDA 3BEWA 3NJMA 3US1A 2X4RB 3BHBA 2FLBT 3GXPA 2EXWD 3K74B 5FUCC 1Z0MA 1ZD6A 2VDOH 5E8PB 4I3SH 4Y2OA 1K3IA 5FUZH 5ICUA 4O1QD 3B9AA 1HNYA 4HAGA 3DROB 4E9WA 3TURA 3EKCA 1OE1A 1U8LB 4BEIA 5IQMA 5HI4C 4FHJA 2G3MA 4DAGL 5E4OA 1SHSA 1KPVB 3KYKH 3QO0B 4OD1L 1KPUA 3NQKA 4DTGH 4QYOA 3MLPA 3KD4A 5D7KD 3FXIC 2VC2A 4H40A 3K27A 1NJ9A 5AAPA 1O6VA 1UXLA 4CA4A 2KKQA 2VISB 3FDWA 4UU9A 3CVHL 4FAVD 4WEEA 4XAWL 1MFEL 5H8DA 1LWJA 3HOGA 3VFOB 5E2WL 3RVUD 3QQ9D 3WS6C 3ULUH 1GZPA 1A66A 3L7FB 1FE8L 4NZFA 3L5WB 3WXWL 1N0LB 3E38A 4XO5A 4PYGA 4XRCB 3SDXA 5IEHA 4Z7QB 2CKBA 2Q5BA 4TPRH 4F3FA 1YY9C 4MMXA 2X4UB 1KPRA 3VGGA 2G3ZA 5C08B 1RZJC 1T66D 4Z7UA 1HHHA 4J3OF 2CKBH 3OMZA 2OJEB 1WWAX 4TUUA 3CFEB 4JFYB 1UJTA 5ICZA 3PXSD 3EH2A 1F00I 1RZPA 3KXFB 2P3YA 4NUJB 3T8VA 4AYDC 3O4LD 1JDDA 1LLAA 1GZQA 4XNBA 3H0TA 3OLDA 1RCYA 1QNIA 2PXYD 4PV8A 5FGSA 2DWEB 4EZJA 4BWWA 4U1NA 3Q2NA 1JZ2A 4XO3A 2E0PA 2HKFH 2BVYA 4FMFA 4X4YA 5KN5A 2FUTA 3KDMB 2CR0A 1R0AL 2D3LA 2G5RA 3JV0A 3CU1A 2YUVA 4PJAF 4MYPA 4YXKL 2PYFA 5FLUA 4CNIB 5T1KB 2F0CA 3PL6A 3CPUA 4PJCA 4KMTH 4KHTH 5AD0B 4Z9KB 1XZWA 3FO9B 2L8AA 4LGRB 4KPHL 4P2QE 5CBEB 3UCRA 4KH2A 4A09A 2WN3A 3CVCA 1WZ1L 3INUH 4TS6A 1H5BB 5BVPL 5C09D 1ZJBA 5I76A 1FHGA 1E9OA 4HAKA 1OF2A 3TESA 3P4OB 2NUPA 4WEBH 1EVTC 3OMNB 4AT6B 3TYGH 1ZIAA 3LN4A 2A74A 1G6VK 3L4CA 3F6JA 5B4WA 5E7BA 3QORA 2Y22A 4JT6C 4FLHA 1U8OB 5E6ZA 4WHTB 5EZOL 3GLZA 1MCFA 4LARL 1G7JB 4NRZA 4X4XB 5D1XC 3TGXA 3V6OA 1A0QH 1ILUA 1G5GA 2XPZA 3FB7A 2XV0A 2I9TA 5FM5M 1YPZE 3RTLA 3ABMB 5I73C 3W1ZA 3QIUD 2Q3ZA 4JFDB 1KV7A 1DQVA 4PVMA 1BYPA 1H0DA 2CGRL 3GM8A 3WNIA 4C47A 5IQ9B 2MCMA 3S3BB 1IAIH 1NFIB 2WLHA 3JWOL 2A9MH 2D31B 2K45A 4H8QA 1OK0A 1BW8A 1RIUH 1GIGH 1BVKA 1XF1A 5HDBE 2PPAA 5E7FA 2EO7A 3K0YA 4UT7L 2QPDB 2OR9L 3BT2H 5AYTA 4JKPH 1XF5A 3O8XA 1YEHH 2I9LB 4FG6D 4CN6A 2WLIB 2MHAA 3JV4A 2HJFA 5ALBH 5K33A 3TONA 4FLOA 2KDYA 3MA7B 2UY6B 4M48L 4X5PA 1MREH 4PJXE 3HE7A 4HUXA 2QFPA 2E7MA 1EDYA 1IZKA 4NAQA 5D9SA 3SBQA 4RMBA 4PSXB 3FT2A 1MLBB 1XEUA 3PNWA 1L9NA 4UILH 4UCFA 2IFFL 4EDWH 3V0VB 4WI9A 4G6JH 2BSDA 4GG6B 1PZCA 2XOTA 3ASOB 4OV5A 4HPYH 4KKAC 1XF3A 4EKXA 2Y36H 1F4AA 4NFDA 5HHOA 2VERN 3H2PA 4L3EE 4N4YB 5DJ8A 4ELDA 3N41B 2GJZB 3C5XA 3HC4L 5GGRB 4APQB 5AFU3 2XQBH 3CC5B 3RUGB 1R3LA 3FQNA 4WNSA 1X5MA 3RZWA 3ZMRA 1JWMA 1SY6L 4QY8B 1FG2B 4XGZA 1E50A 4OGZA 4ZPVA 1JYXA 1BQHB 3MUJA 3RVXD 3SE9L 1QYGH 4S1DC 5F7HA 1TJIH 4JQXC 3QDMD 2DYPD 3VDCA 4QGYA 2I3SA 3W5MA 2FEDD 3AUWB 2XKNA 4FXGB 4LLQA 2C3VB 2K1MA 4GYBA 5DJXB 5BZZA 3WMQA 1XZ0B 2BVPB 2GSGA 3CH8A 2GJPA 3IBEA 3WE6B 4PGZA 4Y9EA 4FFYL 2OSLB 5JOEA 2Z34A 5D7HA 2VDQB 2OW6A 1Z2KA 5DS8B 4QLWA 3ZGIA 1G6RH 5SWSD 4Z1PA 5BS0B 1KNOB 5B4MC 4PRIB 4CDGC 4G8EA 1H3PL 4FA7B 2EKSA 3O4OC 2OJZL 4NUGH 2WQAA 4W9GC 5DA4A 5IF0A 3BUIA 2XWRA 1IEAA 4FG0A 3RTQD 3WXVL 5FECB 2JIXB 3KYOB 1MHPH 4XPFL 3EFOA 3D87B 1GY1A 1IBZA 2VABA 2OLDA 2WBJD 3EHBB 4S0HA 1OPGL 4IDJH 2YZ1A 3BCDA 5DVLA 1JI1A 1HCFX 2KZ1B 4GPVA 3BJ91 3LKRB 3RB5A 3X11B 3ZQWA 2E8ZA 2GHZA 3B3BA 5E0FA 3RB7A 3TA3C 3SJVE 4NQVA 1THCA 5JHDE 1VRSA 5IG7A 2F1AA 2J25A 4B9FA 2HSIA 2Y7NA 3I84A 4G6AD 5SWQA 1TQBC 3B8SA 1ZAGA 5E94B 4R7VA 4OF3A 3QEQE 1JZFA 1MI5A 3S98A 1BBDL 1PY4A 2E27L 3AREB 4E9SA 1MJJA 4HUWB 5BQ7A 5CEZH 3QEHB 1LO0L 4I8DA 4XMKL 4ZI8A 2Q1EA 3GRWA 5LCVA 1NIBA 4BFFA 3OKDA 5F44A 5E5RB 3O3EA 5B7FA 1AS6A 2FQGA 1WZLA 3WHXB 3QJFB 3BVUA 3GRWH 3D06A 5DK2A 2YRPA 3NVQA 1BA9A 1L0XA 1XGZA 1DN0A 4KJWD 1S78C 3ZE1B 1KYDA 3JZYA 3W39A 2HESX 4DEWA 1LE9A 4LEEA 3ZO9A 2YBRA 5DTFB 1E4KA 4CL7A 2NNAB 3MVSA 4FMKA 3LOWA 4JFTA 1UYWH 2PYED 4PVLA 1A2YB 1E42A 3ELAT 4FQXD 1ZT7A 4GIOA 1NQBA 2P9IC 3ESMA 3HLAA 3V4UL 1ADQA 1GJUA 4KK5C 3OKKA 5DWUL 5GJSL 3P9WB 4HZAA 3BPLC 4KJPD 3MRGB 1N9PA 4D7BA 3DHJA 1IC4L 2MFNA 4Y5VC 1EFQA 1MPAL 1ADQH 4NQEE 3V9FA 4B3VA 1OM3H 4MD5A 3HHSA 2X1PA 4TM9A 4Y4HA 2QXVA 4JJ5B 3DURA 2DLTA 2VSCA 3QUYD 1RVFH 3T3PF 4AMZA 3WUWA 3A6BH 3Q48A 3T65B 1HHJB 2FEEI 2XZQH 3CX5J 3GJFK 3MUUA 4D0KA 2F74B 1RV6X 3HB3B 4MNGA 4Y2DB 3HZKA 5DJ0B 4XO9A 4JFOB 3FCUA 2V2XA 4UBDC 3D69A 4GAYB 3MRKA 5EBMA 1HINH 3DARA 3QUXA 1ZHKB 2ESVE 1SVCP 4JGJA 1H2XA 1RZKL 3JSSA 3RWFA 4GY4A 5J12B 4MDJB 2JJTC 2TRHA 3U36A 5D7IE 4L3AA 1F13A 4QAWA 4XXCA 3VXNA 5I1EH 3REVA 3W0WB 4C56A 4JGMA 4KBPA 1F2XK 4E54B 2N0MA 7PAZA 5D7JC 1DQJA 3NH7H 1X5YA 2GC7C 3O2VH 5JXEA 3ARSA 1S7RA 5HDRA 5EMLB 1I82A 1PEZA 3MKKA 4WK2A 3JROA 5C0RH 4JFPB 5MP6H 3NZHL 3QJOA 4A63A 2WNWA 1QBLL 5BNXD 1I85C 4XCYB 1VDGA 1NCDH 4P48A 1SDYA 4ZQKB 1AZCA 1RZQA 2X89A 2XG5A 1PBYA 4N8VB 4YFDB 1IC5L 3PGDA 4JT5C 5CU5A 3CVHB 4X6CB 4ZQTA 4UAOB 3STZA 4DHLA 3GTVA 1MCOH 1YQVL 2XXGA 5ECJE 4M6NL 4ODWB 3G08A 3DTDA 3TX4A 4IRJA 4O2CA 1LP9F 1F3JA 2XN9E 1UXSB 4BIKA 4LAJH 4PYHA 1N2RB 4IRSA 2PCYA 5H4YA 3ZTJH 4MMYB 4BUQA 4HKBA 5E5LA 1D6EB 2XYCA 3IJSA 3KPPA 2XVBA 5IMOA 1UM6H 5CBAA 5JZ7D 1AGBB 4H25B 2QSCL 1AO7B 4MXWH 3QIBB 5LJYH 5D72H 3L3DA 3FK3A 3UROR 3MNWA 1J8RA 4HT1L 4LNRA 4Z18A 3HJEA 4ZXBB 1R5VB 4QHMA 3I3BA 1MVYA 2JJSC 1P5UB 2PCPA 1AC6A 1BZEA 2AJUL 2HT3D 4CC0A 3U9WA 3X1EA 4QJ5B 5HHVL 1WE5A 4Q52A 5CSZA 4A6YH 2WB7A 2GIXA 5EOTB 2C7UB 4I0PA 3NFSL 3LNDA 1J9RA 4PBZA 5DDHA 3QXDA 3IT8D 3PRZA 2PPEA 1R9FA 2OVQB 3O11A 2G60H 2Z8VC 5IWLA 4M7LT 5KJ7E 3QZBA 2H9LA 3ALWA 4YNYA 4I2XE 5CLXA 3WY4A 3F7PC 4OGYH 2YMXH 1A64A 4TNEA 4RGNC 1YA5A 2AJZA 5EEYA 2RGSA 1LDPH 3GMRA 3L1FA 2VDPB 4QRAA 4LSPL 3SGDI 1O5PA 1P4IH 1LILA 3KXFD 4U6TA 4JB9L 2ATKB 2G9KA 1PF3A 2CHXA 2VITA 2HYMA 3C5ZA 4S10A 3RBGA 3BRFA 1BWMA 4OIFA 2EVJA 4RAVA 4XI5C 4ODSL 2HRLA 4GRWE 4DN4L 4KUCF 4M7JL 4NQSA 5AZ2H 5IVXE 3WLBA 4GQQA 1Q0XL 4JZJC 4LCYA 4F9LC 1KIPB 1DQML 1H3VA 1ZRUA 2R1WA 4NGHH 4KAQH 2NPLX 3PWJA 3GMNA 4PJAB 5I1AB 3IE9A 4POZC 5JDSB 3VSTA 5IT9g 2AI0H 4DO4A 1EAJA 4OY9A 2BZCA 4NT6A 2QJDA 2VMCA 3GSRA 2ZF9A 3CIQA 1GGIH 5I26A 3ZTEA 4F7CB 1MZYA 1NCCH 3GM0A 4KTYA 5T1KD 1SYVA 3SD5A 3UG3A 2Z9TA 2O93L 4YGVA 3NFNA 4KI1A 4OFIA 1QRNE 3MLYH 2XBTA 2W91A 2L0DA 3WEMA 3IAQA 1G7MB 1M1SA 1OK8A 3CHOA 4HKZB 3DOSB 5DFVD 3EAKA 4FD0A 4XE0A 4K7FB 4GSUA 4RIRB 1UGNA 4LSVL 4W68A 4ODXB 2P8MA 1J0JA 3TV3L 1IBGH 1ZVYA 4N5ED 3FUMA 4JDTH 4FZ8H 5F9WB 2A73B 4APXB 1R47A 3FN0H 1W9XA 1DLFH 4EAEA 5MI0C 4MNQE 3PCYA 2X6AA 1R34A 2G2RB 5BUAA 3KYNA 3Q1EA 4YE0A 3B3IB 4MB5A 4D0DB 3REWA 3ES6B 3EGDB 4LSSH 1NMBH 1EDQA 1ULVA 1W72A 2G99A 2GCYB 2J21A 4NDMA 5KJRL 4NN6B 5D2LF 5I1CL 1EXHA 4AMYA 3L3GA 1XIWC 3QSKB 2WVSA 4JFDD 4NRXB 3OPZL 3P02A 2HYEA 2H9GA 1TFPA 2EDYA 3ZZSA 4QRFA 4OV6F 3HA0A 4TXVB 4Q9BA 1H3WM 1EZVX 1UENA 3LNIA 4PGCA 4KOBA 4MAUL 1U92A 4NQUA 2C9UA 3KLLA 4XNYL 4YE4H 3I9GH 4QRQB 1O75A 1HILB 1F90H 5FC9A 5KW9H 4W9JC 1EHAA 3WFCL 1UOWA 1U6AH 5EZIL 5AW7B 4QLRA 1GXEA 1CQYA 1NEXB 5DQ9A 4KRPB 1IGYB 4JHUA 4YLCA 1FRGL 2LGNA 35C8L 3NCJH 5AG8A 5IJKA 3GRBA 3MRFA 2XV3A 4HF5L 2VMEA 1PTZA 5GZOA 3EI3B 3MKSB 2AEPH 1IGJB 2HN7A 3ZDXF 3CCHB 4Q14A 5A16A 1A9VA 3MCKA 3FSWA 3WL9A 4Q9RL 2ZOLB 3FL7A 2OXHA 3ATBA 4P3DB 1ASPA 4DETA 1I3UA 1D5BB 2ZXGA 4DK3A 3MUY1 5FUOL 1FFTB 1R75A 2YD4A 4D9QD 5D7EA 4ZSOB 2DWTA 1FFPB 3PABB 4LOEA 4RA0C 1QWUA 1CE1L 5C92A 4Q6IA 5KVFL 3S3PA 1JXFA 4MD4A 4NERA 4HJJL 1AKJB 2BP8A 3T2OA 4PJDF 3GF8A 3QEGL 5D1QE 3SGKC 4APQD 3EO0B 5IB2B 3FUHA 3KLAB 1O9WA 4OJAA 1MZZA 2ARJA 4JHWH 3TIDB 3R7QA 2Q6WA 3VFMB 4LAQH 3HE6C 2W07B 1ZWIA 3P77A 3KL3A 4Z3FA 1FLRH 3W9DA 4BUGA 3RN1D 1EZVY 3DX0A 2H4EA 1WUNT 4AJVA 3FSAA 4RVBA 2PWHA 3CN3A 4PJ9A 2OTWA 4GGDA 4Q4EA 5KYUA 2B3RA 3SPGA 2D0FA 2EEDA 2XV2A 5F7DA 3T6WA 1GA2A 1UWEL 1LO2H 2M2DA 3VTAA 3TYFA 2PR4L 3NTCH 3LVTA 5HVHB 3NJJA 4L4TE 5BS0D 4FFWC 4P06A 4L3EA 4WFGD 5A2AA 4PRID 1ZTXH 4WUUD 5TTRA 2VDOL 1TQTA 3GDCA 3DGCR 1OZTG 1J1PH 5KTEL 2C9RA 5E8OB 1TR7A 1I9JH 1MVFA 2JIXD 4I5BA 5CN1A 5HJ3B 1F5WA 2R1YA 1TEGA 4XN4A 1T1ZA 4J79A 1YEJH 3GMOA 5E9DE 4OFPA 1NL0H 2CUIA 4LU5L 2VMFA 3EHBD 5E2TH 5KDOB 2EUVA 1JTTA 3SDXF 5EORH 3MVDK 3P54A 2ZTBA 3TN0B 1K4CB 4NZUH 2WXOA 4JCMA 5EO0A 3S3JA 2A6KA 5C0FB 3UPRB 3QJSB 2NX5B 1P7HL 2AJXH 1VGKB 5BRZE 2ADFH 5KSBE 4DTGL 1RZ7L 4Z7UF 5KSAA 2PW2B 4YDIL 4ZAKD 2NSXA 1JNLL 4PAZA 1KEMH 3B5HA 2ZZUT 1JWUA 2OS7A 4AC2A 4WDIB 4XNMB 2H13A 1TYEA 4ODUA 3ARED 3PSLA 2VC2L 4HISA 3ZT5A 4XVSL 3VH8G 2FQEA 3VXSD 3RWJA 5DEFA 3PQYB 2ADIB 1MQKL 3OR6B 3DK0A 4WSJA 4EIBA 4JO4H 3ABGA 1WHOA 5KYXA 4ZW5A 8CGTA 5GZNA 4ZUWA 4PBVC 1GXRA 2R56L 2VO5A 4HLZH 1FL5A 3DECA 5DCCA 2OSYA 1XCQA 1X5LA 3F83A 2W18A 4O2EB 5IB3A 1PGRB 1AGCA 1T5XA 1KIRA 5GGSB 1PIGA 4BD4A 3F65A 4KKCD 1TJHH 3SJVA 4D0CB 3IJEB 2YB8B 5JHDA 3AC0A 3HPLA 5BO1H 1RUAL 2X9WA 3BVNB 3MGTA 4LLDA 4PJCF 4WFHE 1RZFL 2QMKA 3NDZE 4G7VL 4WU7B 5BRPA 1NKGA 4E68A 1VPOH 3QUKB 1L3WA 1RURH 2HVJB 3IFNL 5EV7A 3CTTA 3GMQB 4YIQB 4AQ1A 3RDTD 3CLWA 4QHLA 1CYWA 5D1XA 2HKFL 1BLNB 3NJIA 5EU7C 1ZLDA 4L8BA 3IU4L 4BFBD 3HG5A 5IJVA 5KSUA 1HL5A 4M7KH 4HSAC 1KCSH 4PR5A 4PY7B 3R4DA 3GKWL 4GKZA 3BH9B 4N2BA 5T3XD 3AQYA 1PNDA 4JPSA 2IDUA 1QG3A 4AZ8B 4M8VA 3HR5A 3MNVB 2J4WL 3NJFA 4L3CB 4NZRH 3HB3D 2ID5A 3OV6A 1QUNB 4Y2DD 4XX5A 2FJGB 4DUXA 4LSTL 1CU4H 2BS9A 1J5CA 4ABQA 3BFWA 5C2UB 2N4IA 2VLME 1B0WA 3INUL 3MZGB 1DP0A 3CWGA 2JKLA 3EGSB 4ZFFB 3U7WH 2BHYA 3BSGA 4NKDB 3X12B 4OCWL 4YSPA 3FH5A 2VXQL 2ZT9C 3C8DA 1O5DT 3MRPA 3OLEA 4MA7L 3TCLA 5A2BA 4R8WH 4TUJA 5HE3B 2F58H 2Z64C 2EEAA 4J3OG 3F58H 2BDNL 1V7NH 3MRBA 4ZOCA 3ARDC 3UH8A 4ZFGH 3KL0A 1QASA 2KDGA 4PBWD 1JPST 1OLLA 1NM4A 2X28A 3MBEB 3VXMB 4WQOA 4ZUUA 5TFSL 3S37H 2FL5B 4QPEA 5C2VB 1YNLH 1NOFA 4WGKA 2ZG3A 1CXFA 3D9AL 3ZKND 2N1TE 4XYHA 1F42A 3FHEA 4RNRB 1QSFB 1MWAL 2J7LA 4E0RB 2G3XA 2NNXA 4RZKA 3DUUA 2ESVA 2Z92A 4IKKA 4UI2A 2CDEA 4Q2ZA 5JOPE 3SO5A 2AK1H 1S9WB 3IJYB 1ZXKA 4JRXB 1DANT 3F62A 1SBSL 1QHPA 4O58L 4XNZB 4KDTC 5D7IA 3DVNA 3PDDA 2R83A 3QAZB 2DIAA 4JZNB 4K8RC 1L9PA 3UTPE 3H54A 1LP9B 1IAIM 3ARGB 1A6TA 2V17H 3NQIA 4GBXB 2BOBA 4JFZH 2IF7A 1PAMA 3KH3A 4OZ4A 3IAGC 1MREL 1INEH 1N26A 1NCAH 3ARWA 4XPTH 3M7FB 1QLRA 2OP4H 3AY4A 3CDZA 3TVMC 2XVGA 4IS6A 1FO0A 2QR0B 4MA8L 5KG9A 1U2VC 4DZBA 4ZMXA 4NCC1 4J77A 4OFQA 4UILL 1JUFB 1MDTA 4N86A 1E6OH 1V3LA 1NCBH 3HC0A 3SO3C 5I75B 1FO0H 1T2QH 2LFEA 1SF5A 3WD5H 2FYVA 3E3QE 4YSEA 3QIBD 3WIHA 2L4OA 1QBBA 3EI2B 2BP3A 1YECH 2H2PC 2HA1A 5GRJH 2ZWSA 5EU6E 1S7QA 3UMTA 3WIHH 3Q6GL 1NBZA 1X7QB 1V55B 4LSQL 3RVVC 4HS3B 5E8EA 4UB0H 5C0AE 4A08B 1XB6A 4ENED 2WJ5A 2XN9A 1NBVH 3KBFA 2FATH 1JTPA 2APBA 1EVUA 1OSPL 5I74B 5DZ9A 5DMIH 1UWFA 2E46A 4XHJC 4XE5B 5AKRA 1G94A 2HG5A 3B6SA 3SPVA 4J3OD 3FN3A 1YC7A 1TCRA 4QRUB 32C2B 1QA9A 3UTSE 4HXAL 3N1GC 1ITCA 1A21A 1FZMA 4GSDH 5D8JL 4UQ2B 1DBAL 2YD9A 3PNRB 2HJBA 3L4WA 4RE5A 4K2UH 1UKQA 2GSIB 3ORJA 4PREA 4XXWC 5DMGD 2IMNA 1TBGA 2QEJA 3NJKA 4CW1B 5AALA 3LD8B 3MR9A 4L1QD 4P46C 1S46A 4RQQB 4BH8B 3X13A 4A0AA 2OXGA 3SCYA 5GSVA 3V52L 4TQIA 5FGBC 1TVBA 2X2IA 4YXHL 3X1FA 2JKIS 2DTMH 3T0DA 1PU0A 3RZCB 5GGVH 5K39B 5GS2H 1SN2A 5ECGA 1MRDH 2P52A 1NSNL 2JCCE 4HC1L 2H7WA 1BJMA 3FQYA 4WFED 4GQ1A 3FFDB 4F7MA 2UXFA 1W8NA 5E2VH 3TBVB 2IAMC 2BY0A 4I2XA 4PY8J 2ATPB 4PJ6A 3LKSB 3FU5A 4OQ1A 5C0CB 3WY1A 4BA0A 2EACA 3BN9D 4I18C 4D94A 3C6SB 1XAUA 1OCCB 4PV9B 3CDGA 5B1KA 4JVPA 3UAAA 3VWKA 1CE6A 4AX3A 4AV5A 1QR1A 4J8RB 2Z7UA 5J11C 3W9EA 5LCVL 3F7KA 3VE0B 5IVXA 3GXFA 1EMTL 4MCYB 1WISA 3V4LA 1JV2A 3VW3L 2IC2A 3L3OB 1EJFA 3B7UX 1H3TA 4KFMA 4F37F 4G9FE 1OL0A 1GYWA 4C4KT 4E41B 5D2LB 3N1QC 3GC3A 3OWRA 4P23D 5AL8A 4TL5A 4XP1H 1QRNA 5C0IB 1J5HA 3GJFA 2BY3A 1I3VA 2WWMC 3U30B 3FSVA 5DC2A 1I7UB 2GC7A 3O2WH 3TEWA 2C26A 4J8BA 3T4AB 3FCBA 3GJFH 1NANH 4MFHA 1FFQA 5KYYA 1A1MB 4AX4A 1C16A 1Y7VA 1CGVA 4MSWB 3RSEC 4NZDA 2UX7A 5I1JH 2C9AA 2AH0A 5LGKA 2QMJA 1PZUB 2VJXA 5KVDE 1JV5B 2QPSA 1TG8A 4K7PY 2DBLL 3GFUA 4KRPD 1INDL 2AK4B 4MNQA 4V2CB 4OZUA 4X5WA 4OH2A 3S3CB 3QJZA 3ZDXB 5L4IA 4AKOA 1IC7L 2WCPA 4OLWL 5K5YA 2ZPKH 5ICYA 1JK8B 2HLEB 3NCMA 2UZYB 4PJ8D 1BHGA 3L9RA 1PMYA 1DDHA 3I3EA 1AHWB 5KANG 2YKLL 1RPQA 3WIFB 3ZKXC 2NR6D 4M62H 1U33A 1JMXA 2AGWA 4DP9X 1JZ6A 5F70A 2E4FA 5IR1B 4X7SL 2VDOB 4PJDB 1N8ZB 5F9JA 4QYAA 2WBKA 2X2UA 4MRCA 3QFDB 5G55A 3BEWB 2Y1ZA 2R23A 1AKJD 4UQEA 1OD9A 4Y89A 4EI6A 3RPBA 4IQHA 1FAKT 4Y2OB 5DRWA 3GUTA 4UIMB 5H37G 1CB4A 2WUBH 1KYUA 2MPAL 3GBNH 3UJTL 1MRFL 2DN7A 2W81C 3RHWF 4P4KC 5MP6L 3BP5A 3BG0A 5JW4R 3V0GA 1MFVA 5E1GA 4AMXA 1XTMA 2H1PL 2JMRA 4QTIH 2E9IA 4NXSA 2CH8A 2Y1VA 3OKYA 1D5RA 4UINL 4TQPA 4ES8A 4QYOB 2GJ6E 2R4SL 4LPYA 2DQHL 2VC2B 3CDCA 4NKIH 3VQMA 1NJ9B 5ETUA 1K5WA 2WQUA 4GXVH 3B9KC 4GRLC 3KR3L 4UU9B 5AMSA 4K07A 1U93B 2PO6B 3MOAH 4DN3H 4Z7NE 1OAXL 2CG9X 3LRLA 5D1QA 4J86A 4JS7A 1GZPB 3MUNA 2E7BA 1FH5L 2WP3T 4Y7MA 3SDXB 1BZ8A 4FQ1L 3UBXA 1I8UA 2CKBB 4F3FB 1NPUA 4YHYC 4KKLD 4KROB 1KPRB 1QLFA 3C09C 4Z7UB 5LDUA 1HHHB 1Z1WA 3WFBH 3OWEA 4HIIA 2NX5D 4NPYA 3BAYA 5ICZB 4FTVA 4N87A 4NP9A 4YK4C 4OLXH 2B5LA 2BOCA 4XODA 1A6ZA 1GZQB 3FB5A 1EWHA 3O9WA 5CYKA 4L3FA 3L13A 3MV8A 4PV8B 5CCJA 4J2QA 5BXFB 2F8XC 1C1EH 5AOIA 3QO1A 2ZWKA 4U1NB 5LNEA 1K6QL 2FE0A 2P9LC 3PQYD 2A9DA 3W2DH 4NC0B 4X4YB 5KN5B 3SODB 4GAGH 1ZS2A 4YSQA 4JM4L 3LH2L 4I89A 1J86A 1KEGH 3LNFA 5E9DA 5ICXB 1JZ3A 5HHQA 2LTQC 4AITA 2WD0A 4UM8A 2WY3B 3X3FH 3UAEA 4YSOA 4XPAL 3PL6B 4W4OA 1AYRA 4PJCB 2OYLA 4LK4A 1HSBB 2X0WA 5BRZA 3GDBA 3V0FA 4AMKL 1Y1UA 5FA5B 4GQPH 4PJHE 4XP5L 3B2VL 3HZVA 1E8WA 2Z7YA 2DQMA 2XWJA 3LPOA 3MLZH 5I76B 1E9OB 3FUIA 4RMTA 1OF2B 1K3ZA 1VCBC 4ZOYA 3FU8A 2NUPB 3MMEA 4R96A 5KOMC 3RVTC 1A7RH 1J8HA 4IU2A 12E8L 2P9UC 4EXKA 3LN4B 2Z3FA 3T0VA 2A74B 2OTUA 3ULVE 3ETSA 2PCFA 2LAAA 3QORB 4GOSA 5TDNA 3BGFB 5A6MA 4NBXB 1JHLH 1ZDSA 1K9TA 3MHZA 3Q7JA 1X6LA 2F18A 5I8CA 4M6MH 2KS0A 5IBLD 3O2DA 4NRZB 4V11A 3KWXA 1I9RL 1VZGA 4Q58C 2I9TB 3KPTA 4IOSD 1MWAB 3FHAA 1MQ8A 4HWBH 3O2DH 4WW2A 4YVNA 3GNML 4ZOZA 4DKFH 3EYUH 4OCXL 4DP0X 2YRZA 1AZNA 5F1IA 1H0DB 3U1SL 5FKRA 4JM2F 3S7GA 4OCLC 5FEBA 1DVFD 1NGYA 4JDZA 1BZDA 4U1HB 1D9KB 1CDIA 1DR9A 1IBGL 3MRCB 3TJHD 5ID0A 1TMCB 2HFGH 1ZLUK 1BVKB 1ZY9A 5AW4B