5I5JA

Shewanella denitrificans nitrous oxide reductase, reduced apo form
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
573
structure length
531
Chain Sequence
SAVVHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNRDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIANFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWRGRMLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
total genus 163
structure length 531
sequence length 573
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5jA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5jA01
1TEGA 2RACA 4CY5A 5CXBB 2BHFA 1SQJA 2IDFA 2DV6A 3FYEB 3F3FA 4ERYA 4EWRA 1JXGA 2B5NA 4FA9D 4ENZA 5I5MA 2VSMB 2YAHA 2DWTA 4E54A 2AANA 3QJVB 1SHWA 4K9JA 1PNCA 2CBPA 3HEIB 4L3HD 4AI7A 3NJJA 1W6WA 4DP6X 3UVLA 3PAZA 3FQ1A 4GY4A 3RLMD 4J77A 3TASA 1GR7A 3OKWA 4GMBA 2XX1A 1SDDB 2I7OA 4PAZA 3I2NA 4AEZA 1CURA 2UXVA 2PM9B 1CC3A 2BP0A 4JSXC 2H9MA 2OK4A 1PZAA 1OCZB 4HAKA 3DKHA 1IC0A 2EIJB 2XXGA 3NSDA 4HCFA 1XMEB 3UAEA 4YSUA 2OIZA 2P9SC 3MZKA 3PVUB 1R1CA 2YNNA 3EI4B 4U7AA 1SFDA 1GS8A 3ZBMA 3N2JA 4A09A 4YSDA 3CZUB 5D4IA 4E9XA 3SMRA 1OF0A 3RN1D 1NPJA 3UVOA 2HX9A 1KDJA 3BQVA 4KNSA 5HYNB 2AGWA 2XV3A 5IT9g 4BWWA 3X1BA 2OVPB 3CVDA 3A0FA 5B3SB 3PXWD 4BH6A 4KNUA 3T71A 1AOZA 4FB1D 1NIBA 3C75A 1MDAA 2TSAA 4GM9A 2J57G 1RZQA 4J87A 2P80A 2P9KC 3V5WB 3JAMg 1KGYE 1U2VC 2XV0A 4HCIA 2ZWNA 2H47A 1JZGA 4BL0A 1ASOA 5B1JC 4A0BA 3V9CA 4PSWB 4J8GA 2CO0C 4G70B 4A11B 1A0RB 3EI3A 1SF5A 4HALA 4A2FA 3EH5B 4FA7B 3ODTA 1GYCA 5GXHA 1KCBA 1HAWA 4Y5RD 4YSTA 1BYPA 3MX0B 3VH0A 2YQBA 4P5RA 3QJUB 1PBYB 2B5LA 5HE2B 5AJAA 1XB3A 7PAZA 4E9RA 3I7NA 1AZBA 4L0PB 3NJMA 1J9RA 2XXFA 4ZK8A 2VW4A 4HHWA 1FA4A 2YAMA 3FSZA 2P9LC 2YNPA 2JFCA 2HRHA 2Q5BA 2Z2PA 3RRMC 3GDCA 2OVRB 2Q7QA 3FU8A 2QDVA 3WIAA 4GQ2P 1TYQC 2J56H 2HJ4A 4LGNA 3KW7A 3IEAA 3NYKA 4MFHA 2IUPA 4J8BA 1PCSA 2PM9A 1ADWA 5B1JA 1AG0A 4A2HA 2FTAA 2CUAA 1PZBA 5K1CC 5CXBA 4NSXA 3BWSA 3B7FA 1UATA 3OMNB 3DM0A 1MDAH 3CVCA 5D4HA 1AR1B 4DPAX 2GI0A 1NEXB 5TEEA 2WO2B 3AFCA 3S3DB 3X1NA 5I6MA 3J80g 1BYOA 1GOTB 3UVKA 2AFNA 4J79A 1J5DA 4GP8B 4E9SA 1NDTA 2CNXA 3IJ0A 5CYKA 1KBVA 5TF2A 2OVQB 2BW5A 1W6LA 4IMMA 5FKRA 2N0MA 4J73A 4F7KA 1GS7A 2MRYA 2UX6A 4AKPA 2GBAA 3OKYA 4H5IA 4YSEA 4X63B 3FM0A 4QL1A 3T6ZA 3SFZA 3FS9A 2FT6A 2CN3A 2HXAA 1NPNA 3NJHA 3QQXA 2CALA 3QJQB 1J5CA 1KV7A 1ET7A 2XYIA 4GZ8A 4J82A 3WNIA 1OV8A 3G5WA 2OK6A 4F2EA 1OCRB 1ETJA 2XV2A 1MG2A 3GREA 4BXVA 1M56B 1M57B 4A2EA 3JB9L 1L0QA 1HAUA 4PXWA 3I7PA 5AFU3 4A66A 5A2Qg 3C5MA 1L9OA 2VM4A 2H5UA 3K26A 5GSAA 4OZUA 5C9ZB 3FSVA 5IJ8E 1SHXA 4ZN4A 4YSAA 1JJUB 3EI2B 2QXVA 1Q47A 1NWPA 4CSPA 4K3JB 3DTUB 1PI6A 1W8EA 4A67A 5I6OA 1K32A 4A2MA 1OE3A 2VN3A 1VLXA 2UX7A 2R7EA 1N68A 2QDWA 3UKUC 2ZXWB 4YSCA 2H9PA 4KOBA 4FHLA 2FT7A 1P22A 1URIA 2IDQA 5IGOA 2VSKB 1N6FA 2YAPA 4W1TA 1ET5A 1ZIBA 3I89A 1KYAA 5ANHA 1ZDSA 3AG1B 3PXSD 4JSPC 3NVNA 2H3XC 2XL3A 2Y69B 3QJTB 4YSPA 2HESX 1IUZA 2BP0B 4E5ZA 5EMMB 5H14A 1PAZA 2IURA 3ZIYA 1GP2B 5F7BA 4BDVA 5TEFA 4DP4X 4G72B 1ILSA 3ABGA 3W15A 3I8CA 2PPCA 1JOIA 4PSXB 4D6VA 2UZXB 2GHZA 2IDUA 2UXGA 1I53A 4YSSA 5AZUA 3OL2B 3C99A 2HX7A 2GC4C 4GYBA 3TA4D 4G7RB 2P9PC 1OCOB 3WI9A 4G71B 3MZLA 4JT6C 3U25A 1XHMA 4JT5C 1JZHA 3IN2A 3AZUA 4YSOA 2GC7C 3JZNA 3MMYA 3RMZD 3NP3A 1SNRA 3NSFA 4QKTA 5PAZA 4G56B 4N8UA 1B9XA 4Q89A 3ASOB 4MK0B 1DYZA 1QLEB 1V54B 4PCYA 3PXTD 5AMSA 2OV0A 4HDJA 5EM2A 5K19A 4CI3A 2J57A 2CCWA 4FWWA 4E9WA 4BWTA 3SLED 1PY0A 2FQEA 2X88A 5AKRA 5CXCA 1JOFA 5HE3B 5I6PA 4DP8X 1F56A 2XYBA 2ZOOA 3IIWA 4QQEA 3PAVA 3X1EA 3SBPA 3FT0A 1AZCA 2BWIA 5B1BB 5I26A 2GC4A 3UGEA 4HIPA 4J81A 5FKQA 3T9WA 4ERZA 2FQGA 2YXVA 4O9DA 1TBGA 1X9UA 4A0BB 4KO6A 3ABKB 2E86A 3CIKB 4FA4D 5I5JA 4Q8BA 3ZX1A 1RI6A 2BO0A 4QLWA 2I85A 2DYSB 3EWEA 3OTTA 4GQ1A 5CYKB 3U4YA 5FQDA 4D0KA 3UABA 3OD3A 1MG3C 4YVUA 4EF3A 2QC5A 3QPKA 5FA5B 2OCCB 5H1MA 3EF4A 2MTAA 3FPXA 1PLBA 1GXRA 3V9FA 3FU7A 3OQRA 3T6XA 4IA9A 1IBYA 1B9YA 1HFUA 4QRJA 2EIKB 2UXFA 2GNQA 2AGLA 1B3IA 3BG0A 4DP7X 1AZNA 3F3PA 4LG9A 4ZOZA 3J81g 2FJSA 4AX3A 2BP8A 3UACA 5LDUA 3T6VA 4GGDA 3CFVA 1A4AA 1GG2B 2XVBA 3FSWA 4O45A 3GFCA 5EARA 4ERQA 3NVXA 4PNKB 3TBCA 2HJBA 3EMHA 3CDZA 2IWEA 4L3GD 5GXIA 2H47C 1N6DA 2B08A 4YSRA 3NJKA 1WS7A 4ZOYA 1NWOA 1OE2A 1YFQA 2AZAA 3ERXA 4XYHA 1AZRA 2GSMB 3SQRA 4J84A 2FNWA 1BAWA 5I28A 3EI3B 5F7AA 3S3CB 4PC0A 3RYMA 5FKTA 4CY3A 1SF3A 5IY5B 3JROA 4X60B 4KFMB 3OW8A 3NJFA 3I7OA 4GGAA 4HZ1A 3S8GB 2W88A 5C2VB 3FQYA 4GP4B 1E5ZA 4CZXA 1ERJA 3EHBB 3ASNB 3NSCA 2PCFA 3PCYA 3WKPA 3IE9A 5B7FA 1AAJA 2YNOA 3EH3B 4LG8A 1BXUA 2QPDB 3ABLB 2VW7A 3OMAB 1S4UX 3AL8B 3EI2A 4X61B 3IN0A 3BG1A 5EMLB 1BQ5A 4NERA 1VYHC 4BDVB 3X1FA 4RH4A 1R5MA 1AANA 2XLLA 2MTAH 1MZYA 3GYRA 4JKNA 5B1KA 3JT2A 1N6EA 5IC7A 4CZYA 4YVDA 2CE9A 2HXCA 3UAAA 1ID2A 2XU9A 1GSKA 2AGZA 1FFTB 1K8KC 1TU2A 5E9NA 4UAHA 3SN6B 1XB8A 4JHUA 3EG6A 4H5JA 1XB6A 3E0CA 2B3IA 4AKQA 3FSAA 4DP1X 1JXFA 1SQ9A 4GQBB 3UVNA 4E9YA 2CN2A 3F3GA 3TU6A 1BXVA 2HYEA 1EHKB 4GXFA 4DPBX 4J86A 5IGQA 3RSEC 1IBZA 1RZPA 2WO3B 3T6WA 2W18A 2HZHA 3JRPA 3OKYB 4M3HA 4CSZA 5I6KA 3NJNA 5EAMA 1XKSA 2IDTA 1ASQA 4A2DA 1A4BA 4KO5A 2Y1AA 2CAKA 4KOCA 4NAJA 3DWLC 4A7JA 3I7LA 1JVLA 2EINB 5B7MA 2XX0A 2J56A 4AKOA 4CC9A 3AW5A 1AACA 2QPEB 2YAOA 2I7SA 1E67A 3N55A 4UANA 3ULEC 4CZVA 2LLNA 2TSBA 2BZCA 2PP7A 3AG3B 5JWZA 2X87A 2YB8B 2A3TA 1L9RA 4CY2A 4PBZA 3CFSB 1ZPUA 3KW8A 1J9SA 2I3SA 3NJIA 4N4YB 1BEXA 2H6QA 1JXDA 2CJ3A 2B5MA 3IJ1A 3PSLA 1PGUA 1A8ZA 2Z2NA 2PP8A 4K3ID 5B4WA 1PMYA 2UZYB 3I7KA 4DP9X 2H6NA 1AIZA 4BK5C 6PAZA 1MG2C 1QHQA 1CYWA 1PF3A 3H4HA 4KO7A 1NR0A 4X4KA 2CO0A 3DXMC 2IWFA 3PAUA 1KDIA 3GXUB 2AGXA 2GIMA 2YMUA 3SCYA 4AOWA 4CY1A 1ET8A 3FPYA 4BWUA 3IBOA 4BUJC 2ZONA 5SXMA 2YARA 4TXVB 2PM7B 3OKTA 3JZHA 2IUQA 2J5WA 5EMJB 1BQKA 2BP8B 2B4EA 2FQDA 1AS6A 4ESGA 3D12B 1U4CA 4ZOXA 1X9RA 4A0AA 2OJYA 1TEFA 1BXAA 3NP4A 4CI1A 4FAND 2FT8A 2YAQA 1JMXB 3UADA 3RN0D 1ZV2A 5EAPA 3S3BB 3OMIB 1JZFA 4QT8A 4FA5D 4J0WA 1L9SA 3SWSD 1PZCA 2JXMA 1NZRA 3AL8A 3WG7B 5I6LA 2AH1A 3MKQA 2IDSA 2BZ7A 2PM6B 3KRXB 1AS7A 1V10A 4O3UB 3X2QB 4HHGA 4O3TB 3RFGA 4CI2A 3JTBA 2XU7A 3IJCA 1OMWB 2HKRA 4O1QD 2XUWA 3FU7B 4A2LA 2J55A 3P4FA 5C2WB 1OCCB 3V9EA 2PPDA 1J9QA 2EILB 1PNDA 4KO9A 5FC9A 4E9QA 4A09B 3CDZB 3RFHA 2PBIB 2DY2A 3BVDB 2G9AA 5TK4A 3FQ2A 4AZUA 3EI1A 2FQFA 4JSNC 1JVOA 4A08A 4BXSV 1OE1A 2YXWA 3IKOA 3PPSA 1KCWA 4XEIC 3AH8B 4FA1D 5HE1B 2XWZA 3NT0A 4M4RB 1A4CA 4FAAB 2H68A 3AL9A 4GM8A 4X3EA 1RCYA 5CXCB 4YL4A 2HLEB 2PP9A 1DZ0A 2EIMB 4Y7RA 2P80D 1GS6X 2H13A 2H3XA 2PCYA 1CUOA 2Q9OA 3ZDWA 3HFQA 3PSCB 3SVWD 1JZJA 2TRCB 4FAVD 4J0XA 1AQ8A 3NSYA 3N0DA 3SHFA 5EHFA 5GMKn 4E54B 1MZZA 2AVFA 3EU7A 3ZWLB 3AG4B 4A11A 4CI8A 2HRGA 1V55B 5TDHB 2QT6A 2EBSA 1AZUA 1BQRA 5KDOB 3SBQA 1NIDA 2IAAC 2BW4A 4DP5X 2GC7A 3DSMA 1SDDA 2P9UC 5B7EA 3KRWB 2I0RA 1TKWA 4YVNA 3VA6A 4G7QB 1ASPA 4A0AB 4HCGA 2IUVA 3NJLA 1SJMA 2YBAA 1NINA 3WNJA 1JZIA 4G7SB 4A2GA 2BCJB 2OJ1A 3N0EA 5EMKB 6PCYA 3UVMA 1PLCA 5AFAA 1JERA 3PLYA 1ILUA 8PAZA 3FRXA 4GGCA 4N14A 2VW6A 3C9CA 1JMZB 2I0SA 2Z2OA 1ZIAA 4ES0A 4JXMA 4JHVA 1XIPA 3I7HA 1QNIA 1WAEA 2BBKH 3AG2B 3UR4A 4U1EI 2HKMA 2YAEA 2CE8A 3FYIB 3EH4B 4KNTA 2P9NC 3L4OD 4E9TA 2J55H 2BWDA 2IAAA 1NIEA 4WTQA 5FXYA 5IJ7E 3I8EA 2H9LA 1NICA 3ABMB 5I6NA 3ORVD 2PPEA 2AH0A 3NVQA 4TZ4A 4ZOVA 9PCYA 2G99A 1A3ZA 1L9TA 1ZDQA 3QJSB 2JKWA 2H6KA 3SJLD 5I5IA 3AY2A 1IKOP 1M9WA 5FLXg 4DP0X 7PCYA 2IH9A 4Z8LA 1OOWA 2FWLB 4GM3A 4WKXA 3EI4A 3VGZA 1AG6A 1GY2A 3OM3B 4PBYA 1N70A 2HX8A 3JZGA 4L9OA 1KBWA 4P5SA 3UKRC 4W9ZA 3V7DB 3WKQA 1YLBB 3TBBA 1GY1A 2PLTA 3DXKC 3PE7A 3HB3B 3FGBA 4UI9R 4A08B 3SBRA 4L1QD 3H56A 1AS8A 2UXTA 5EALA 1A65A 2DYRB 2H9NA 3MBWB 4JSVC 1L9PA 4I79A 1NIAA 3PVWB 3QJRB 4JD2C 1E65A 3IIYA 5THAA 4DP2X 4DPCX 4E5ZB 1WA0X 2PPAA 2W8CA 2YAFA 2NRDA 3H4FA 4A68A 3MKSB 4OWRA 1E30A 3X1GA 5B1AB 1OLZA 2IWKA 1T5KA 1JZEA 3K27A 2GB2A 1CYXA 1NIFA 3DIVA 1PEVA 3EI1B 1PLAA 2VM3A 2WSDA 2AGYA 3OL2A 5HE0B 2XL2A 3L45A 4GP5B 2IH8A 4UF7C 1MG3A 2H14A 1GW0A 3SXTD 2VMJA 2P9IC 5D4JA 3L4MD 1SHYB 3PXLA 2I3TA 1SFHA 1WS8A 4NB7A 3S8FB 2I0TA 5TK2A 5HQGA 4J78A 2AQ5A 5PCYA 1J9TA 4E9VA 4YSQA 4XYIA 5FKSA 1E5YA 1FWXA 5H17A 4F2FA 1L9QA 2DWSA 3CG8A 3NJGA 5A7EA 3C75H 3CVBA 5EM2B 2O9KA 4R7AB 3MXXA 1RKRA 1EZLA 1WA2X 1WA1X 2PPFA 2R7EB 3FU9A 3JPXA 1NTDA 2AZUA
chains in the Genus database with same CATH superfamily
5TQ0L 1HKLH 5CXBB 4P3DB 4UUJB 3FYEB 4WI5A 4F7MB 4M93B 2A7BA 2EE0A 5T33H 1MY5A 2OJZL 4L1MA 5IK3A 3U46A 3IMWA 3DURB 1A12A 3HLKA 3OXSB 3ULUH 1KGIA 2GTZB 4XP6L 5FWRA 5SWQB 4NSKA 2NYZA 4PJ9A 4GI8A 2AK1L 4N1CA 4GAGH 4ZTPL 3MRLB 3V5HA 3FTGA 4OZHA 3AL9A 4HKXB 1BEYH 4HLJA 1NLDL 2G0KA 4NQEE 2CBQA 1LK2B 5EU4A 3RPKA 3AUVA 4FC3E 3DDFA 3ZBMA 4J39A 5D4IA 1HHKA 3GO1H 1UOOA 1J05B 4KNSA 2O6DA 4FP8L 5HJDA 3QFJB 1OTSC 1UYWL 3KDMA 4E5XG 4K7PL 5HGGS 4ALAL 4OFIA 2R2HA 1MDAA 5I1DA 3NCEB 2WOBA 3V5WB 4HK0A 3EJZC 3JWNG 1FL6B 1MFDL 2QLYA 2DLTA 4HCRH 3D18A 3U0PB 4LDOB 1PCXA 3KPLB 1G7HA 3V52L 1DQKA 4G70B 4U1JB 5F70A 5DJ6A 3L9YA 2JCCB 5CZXC 4FA7B 4LCWB 3LN4B 1IEAA 3MACH 5CEYA 4BSVB 1HAWA 1MCEA 1CGYA 4JY5L 3RY6A 4JLRB 3VH0A 1FNAA 3HHSB 4YHIA 2H26B 3LYRA 4B3EA 4ETQB 4FFTA 1FH5H 5B3JF 4KUZH 4HJEA 3RZWA 1RZJH 2YXMA 2X4PB 1EV2E 5IQ7L 4JFOB 4XB3A 3CFEA 5JTWA 5DVPA 5GJTH 1WP6A 1BJ1H 1SJXA 3GSQB 4Z7NF 2HJ4A 2J8UA 4MNQD 4RLDA 3RWJA 4PJ7B 1JHTA 1P5VB 1YNTF 2Z4TA 1XR8B 3ZY7A 2ADIA 4WY7H 1VGEH 3QW9A 2PWFA 1NEXB 5TEEA 5E7BA 3S3DB 3O2WH 1W8NA 4RAVB 1T04A 5IB1A 5MERB 4DNWA 2QPFA 1CICC 4A7QA 3UC2A 4G9FB 3RWFB 2V3DA 3ARWA 3V9FA 4K3HA 1MCQA 3ZTCC 4PJ7F 3LD8C 3U9UA 1ZXQA 5EBGA 2HKHH 3VI3F 3FS9A 3RVWC 3P40A 2FO4B 3GSVA 2CKBA 5L2KB 4KMQA 3CHXA 4Z18A 2OK6A 3QISA 3CFMA 4PJHF 1MW2A 1IEAB 3VJ6B 4PI0A 3WN6A 4BXVA 5JR1H 1JGUL 4V1DE 3TO4D 3STZB 2QBWA 5I71C 1NCGA 4AV4A 2XG5B 4L29A 3WIIL 2F8IA 1MJUL 2BK8A 3PYCA 2HTLC 3QDJD 4M61B 4UINH 4PP1D 1K72A 4MMXB 3OZLA 1W0WB 1KYOK 1SUHA 1NMBH 3NPZB 4NNYA 1XL6A 4ODSH 4PV1C 2ZXBA 4NFCA 4NX0A 4PJ5D 3ZDZF 1RULH 2HTKC 4GH7B 15C8H 1ZSDA 4XTRD 1G1YA 3PGFL 2Y69B 3CFCH 4M43H 4N2BA 1UWYA 4HWZA 2C3HA 1C1EH 2Y2TA 5F7LB 2A6DB 2H0EA 4LGRB 4DP4X 2Z91B 1T1YB 3MUUA 2GHZA 2IDUA 4I89A 4JMXA 1DVQA 4QI3A 3X12A 1G9MC 3CH8A 2GC4C 2GJRA 5T1KB 2OMXA 1KF9B 3NEXA 2BSED 3RFZC 3IB4A 2DM7A 5DD1L 2VJ0A 4C4UA 5FW6A 4LSUH 4KVNH 4TOYH 3R1GL 3TOPA 4NWUL 5KTEH 3PHOA 2E7LA 5DSCB 5I76A 1T6BX 2YPLE 3QUYB 5EZLA 5I8KL 3T6QC 3DVFA 2BVYA 5K19A 4K2UH 3QUXC 3D2UA 1PY0A 3QIWA 4XPHH 1CMOA 4NXKA 2XKUA 1AHWC 3IJ8A 2UVFA 3KHQA 3BUPA 1I1CA 4HD9A 1LLAA 4TS6A 3PAVA 1NGXB 3CMOL 1J86A 3SBPA 1G9NC 1BGXL 1AHKA 3W57A 3HAEH 5B8CB 4A0BB 3LIZL 5JUEH 1XTMA 1KCVH 3W3BA 3EO1A 5I30H 1RI6A 3QDJE 4FXLA 2JI1A 2N7BA 3BSGA 1T1WA 2DM4A 4L37A 1VZIA 3OD3A 4X4ZA 5F9JB 4XBEL 4EMZA 3AROA 4LMQI 2ATKA 4FA8A 2PETA 4NNPH 4UOZA 3EYFB 3TWCH 2HJFA 1KACB 3LKPA 1R3KA 3MRPB 3PWVB 4Y4HC 3EW3B 4YR6B 5EC1B 5INCA 3ZZSA 5I1IL 5LGJA 2VDLA 3E9TA 2AGLA 4NN6C 1ODUA 4YHMH 4Z7IA 4LG9A 5GJSL 3BESR 2ZXQA 2OSYA 4CVUA 3QWRD 2P8MB 4HUUA 1GG2B 2CLZB 3QZOA 4RE6A 5L88H 3BMWA 2IWEA 2FIRT 1VF5C 3HG1B 5C08A 3VD1A 3U9UB 4E41E 3HC4L 1ZT4A 2X7LA 1G7MA 3CUPA 4ZNEE 1BVLB 3RWFA 5TQ2L 3J8F7 1H3VA 2JVUA 5IB2B 4PV9A 3NCYP 4AG4L 4C57C 1XXDC 1CGSL 2BLFA 4GQ9H 5FYJE 3LDBB 3MV7A 4GRWB 4ZW5A 1AFVL 1F18A 2J2ZB 5MEPA 1G43A 2G9HA 4YFLF 2GIYA 4WEEA 1EMTH 4KJYA 5CGMA 5I1JH 3EH3B 2YBRB 5JZ7C 3MGOB 4FP8H 1DVSA 1OD9A 2LVCA 4X61B 4R96A 3DNKA 1GYAA 4XCNB 1VSCA 2UVEA 4MXWH 1VFUA 3M1BA 3O9WA 4GJTB 2NW2A 2XLLA 3JSSA 4M5ZL 4DGVH 5KYXB 4P46A 1U41A 4DPRA 4S1QH 2D7NA 2AGZA 3ZYZA 2AXJA 4EUPB 3RY4A 1INEH 1MJ8L 2B59B 5HBBA 3SHSA 1QP1A 4HGWA 2VC2H 4PWHA 1CLCA 4ZUSA 1Q72L 1G6RA 1BFVH 1LVEA 2MH4A 4AKQA 4DP1X 1DVTA 1E3XA 2BH0A 4YBQD 2CN2A 5CD3B 3RPBA 3EGDA 4G6MH 2BVPA 3WXVH 4WEUD 5JYMA 4HJTA 1T5WB 4CSZA 1BVKB 3WLBA 4ZTOH 2H1LM 4YDLC 1HN1A 4L8SB 2DQEL 1KNOA 1J1XH 3AADB 4QXVA 4BSWA 1FC2D 3HPLA 3Q7JA 2J56A 3AW5A 5GRWA 4UANA 4YPJA 3ZDXB 5EO0B 4EI5A 2Y36L 2TSBA 3X12B 1Z32X 3D39E 3VE0B 5IB5A 3KW8A 3A21A 1BEXA 3MVSA 1TQWA 1KG0A 1KJ2H 1QI3A 2Z2NA 3IETB 2E7LC 5D71L 2UZYB 5L4IA 4XI5D 3GD1I 4G1MA 4PG2C 4DUWA 5F6HJ 1MG2C 1N64L 1NPUA 4IJ3C 3DROB 3KLHC 3PGDB 3L5WA 4X4KA 3W39A 1KDIA 3IBEA 3QUZC 2RCSL 2ARJQ 3ILPA 2AAVA 3TO2B 1K8DB 2VITB 4TXVB 3OKTA 4HSQA 2IUQA 4N2DA 1NCWH 1BQKA 4XPFH 2BHYA 4F58L 4ESGA 1INDL 1OAQL 1IGML 3GHPA 4AUJA 1CYGA 2H3NB 2PO6A 1T21A 3QJHB 3S4SG 2VXVL 1T03L 2Q86B 3A4AA 4NUQA 3S3BB 2P47B 2BSRB 2DQTH 3UP6A 1E7UA 1K5NB 3C5ZB 3QZMA 3MKQA 4HC1L 4J2QA 5K1JA 4HZLB 2IDCA 4XNXH 2E5EA 4AN0A 4JPKL 1V10A 3HG1D 2R29A 4N2GA 4UILH 1JHLL 1XSIA 3I3DA 4GAAA 3V6FB 2AF2A 2BXYA 2JJTA 5E5MB 1OCCB 3VACA 1X6NA 2CCVA 3HZKB 2DWEA 4JM4L 4FCHA 1MFBH 2A38A 4Z3IA 1A22B 1VACA 4RWHA 4X9BA 4Y5VB 1JVOA 3H9HA 2VKXA 4N0YL 3JWOL 5CJBA 5I1GL 5J06A 2DQIH 5TE7L 4GQRA 4NUPA 4GG6B 3PWUA 2MQGA 4B97A 2Q3ZA 2CO6A 2H68A 3KXFA 1U8CA 2X2UA 1E5BA 4HA1A 1F4AA 5T33L 2AQPA 4HK0B 1BZ9B 3IRPX 3MC0A 1KJMA 1LK3L 2E59A 1YDPA 5G5DB 2H13A 3L5WB 2TRCB 4F8QA 4BFJA 4K3DH 3L4XA 2D31B 1MQKL 4JFEE 3II3A 3GJFB 1MZZA 4YNYB 3ZWLB 4A11A 3RWJB 5C07D 5AZ2H 3VTAA 2W38A 1X5MA 4Z7QE 2NDFA 2X05A 3WUWG 2QHLA 4TVPL 1WHOA 5IQMA 5D2LE 4ZOCA 1C12A 3P4NB 1BEYL 5CM1A 4KQ0A 2GC7A 3KRWB 1YEIH 5E9DB 3OSKA 1HILB 1JZIA 4OZHB 2EVHA 2EDEA 4LLWB 1JG9A 5E8OB 4RAUB 5L8LB 1JERA 1XD0A 3QAZC 2L7EA 1SVZA 1FLRH 3HPLB 1ERNA 3MV9A 4L9LC 2VW6A 1AO7D 1M2OA 5EZJA 3B2DC 1L6PA 4M48L 1BZ8A 3EYQD 1WAEA 4FXGB 5E1IA 1SZNA 2HKMA 2CGRH 4P59L 2BSBA 2CE8A 3QCTL 4I3RH 3RNQA 5LG1A 5F1IA 4ZMTA 3PQYA 2HKHL 1DJYA 3HRZB 4M00A 5DRZA 5EO1A 4A7SA 5JW4M 1BZQK 3DOHA 3EYSH 5I6NA 3DROA 1GIGL 2NY5C 2PPEA 3B8YA 3GF8A 3CIAA 1OARH 5DQ9A 1KPUB 4ZS6D 4TNWK 3OF6A 2IH9A 3RAJH 7PCYA 1KN2L 4OZIE 1NAKH 1IBBA 2UWEE 4WKXA 2Q7AA 1GY2A 4FEMA 1NAMH 4DGWC 3L5HA 1KBWA 2V9QA 3F8UB 3QQ9D 2BSTA 2O5YH 3V7DB 2R0WL 1YLBB 4UI9R 1KB5A 3L8QA 3HB3B 3REVB 4MD0A 2BFVL 3CZEA 3VWJB 2G60H 5IW1A 4NSKB 4RZCB 2YBGA 2NY4C 1A65A 3FFDA 2ED9A 2XWJB 1BVKA 3WLBB 2PWEA 5TH2B 5C0CE 3U48A 1EFXB 1F8TL 3IIYA 2IALA 4A39A 4PJ6A 5C0GA 2GBUA 3LKSB 5D2LF 2YAFA 3MKSB 3HC4H 1WQVT 4N2HA 4L4TB 3UAFA 3P9WB 4W68A 4OCLC 4PLOB 1UZ6E 3VGHA 1F0LA 3AQYA 2XC8A 3CN2A 1PG7H 3L1FA 1UA6L 4ZTEA 1YN6B 4QXTA 4LDLB 5ACMA 2XY1A 2ENSA 3PXLA 1SFHA 5F7MC 2D7TH 4EBQL 2D4DA 2QQQA 4OBSA 1ACYH 5H8DA 5FKSA 3D4ZA 1YQVH 4Z3EA 4DVBA 1BQHB 5TFSL 4BEIA 1S8DB 4PB9H 5A7EA 1JZDC 2X9WA 1R5VA 3NACH 4UV4L 2R7EB 3A47A 3OKMB 3EDDA 4U1LA 4AGMA 2XZAL 3B43A 4HPOH 1A6UL 1TJGL 2EDRA 2K8MA 3M8OH 3RL2A 3F3FA 4NKMA 2NY7H 4ENZA 2VSMB 3FONB 1WPCA 3GBLA 4LCCB 1T6VN 4E41B 3IJYA 3L9RA 1ZANL 4H5SB 4PJEE 3TN0B 1JJUA 2I9LB 2ZCZA 1AD0A 4RZKA 3LIZA 3RWCA 1KLUA 3TASA 4TNEA 3WEAA 3OKWA 1J1OH 5DYOA 4BCBA 1MSPA 3SKUD 1H3PH 3MRBB 4TQ8A 3CV5A 2UXVA 1NGZB 3O2DH 4HX1A 1CC3A 3CVHB 3UPRA 4F3FA 3HCVA 4N0FA 4C55A 5I0DA 5BVPH 2OIZA 4NPKA 4LEOA 4YDKL 1R1CA 2YNNA 2YUZA 2AV7B 4A09A 3CZSA 4GEIA 4YFEA 5D1QB 1T7YA 2VERA 4G11A 5LAXB 4WUKH 3LY6A 3RG1C 4F2MB 3A0FA 3RWDA 2B0SL 4GM9A 3C60D 4G42B 3G6JA 2XWJA 3LXCA 4A6YA 3HZ3A 1W15A 1XCQB 1KTJA 3SYPA 1MFEL 4HCIA 1ZVHA 2ITCA 3HI6H 1LYQA 2ZWNA 1A1NA 3NFNB 1JZGA 4KK9D 4GBXB 2YIHA 1A8JH 2IXQB 1NQBA 3FU6A 4G6JL 3V9CA 5D1XB 5KYYA 3T4YB 4ELDA 2F54B 3OWRA 4A2FA 3EH5B 4WW2A 5H37A 1A6PA 1YEFL 2I69A 43CAA 4JG1H 2AQNA 4WSGA 3DO3A 4WU7A 2YMXH 3CFUA 5DJDA 2XKNB 1IJ9A 4ZK8A 4N2LA 2VQUA 1RJLA 1M9SA 2YAMA 3UGUA 2R8SH 4HUXB 5C0RL 4OB5H 3MV11 3VWJD 4F7TB 3Q8EA 5I9QB 4L4TA 1EVTC 1FQ9C 5IFAH 4N2AA 2DBLH 2D0HA 5TE4H 1Z6JT 2PW2B 2G3MA 5CP7A 3V4UL 8FABB 1L6ZA 1U8QA 4HEPA 1X5YA 4K3EL 3U9PL 4HOXA 4N2CA 5C0DB 2E7CA 1ZVNA 1NAMA 3WFDH 1YRKA 3FFDB 2WZPA 1BYOA 4KVPA 1UB6B 1MFBL 5CU5A 4IHOA 1QBBA 2ZF8A 2A6DA 1I8IA 2CNXA 1OP3K 4OGXH 1YAZA 4NRYA 2KUTA 5KSBB 4EZJA 3LZLA 4HMEA 4XXCA 1CD9B 5LLIC 5EEYA 3PWNB 2DIJA 5JA9A 1FZKA 3ARBC 3I9GH 1ZWIA 2HLAA 3VRLF 3NEOA 2IWGA 3OPZH 2DQUH 3KYMA 3W9DA 3X11A 3LRKA 1BFSA 1TTGA 5CSBA 5LVEA 1RIHH 2X9ZA 4GB9A 5M5SA 3P02A 4XX1E 1AJ7L 4JKPL 4Z7NA 3BUBA 3F58L 1NEZA 4FLOA 4RWYL 2OMWB 4GBXD 1SEBB 5L6YL 5C0BA 3JV6B 1CLOL 4NQEA 4N1HB 3U7AA 5H35A 5DZLA 1FBIL 4R0LC 3CC5B 4BUHA 8CGTA 3O3UN 1KT2B 2GI7A 5E2TL 4M48H 1TFHA 3SDDA 5KVDL 1NGPL 1P22A 1S7VA 2HVJB 3ZL1A 2BC4A 2VSKB 1DL7H 4X6CE 3UO8B 3C5SB 5KSBE 4TUUA 1DUZB 3FMGH 5HTSA 5IQLA 3FCUB 3C2AL 2HESX 1IUZA 4HK3N 4DW2H 4TUJB 4IMKA 5K9JH 1Q72H 4WENB 1PKQB 4XOCA 1J0JA 2O4EA 4FFYH 5TEFA 2BDNL 4G72B 1IGTB 3ABGA 3GMOA 1MUJA 4YSSA 4WHYG 3MA9H 3E9UA 3WSQH 4OCXL 4G6ML 1F6FB 1CQKA 2R2EB 1TENA 4ZO9A 4CMMB 5FIEA 1U58A 2UY6A 2FWUA 3U1SL 4X0KB 3OBAA 2DQMA 5FYLD 1KEML 2CDFA 4Y2DA 3LRMA 5J1AA 4FZEL 4PBVC 1I3UA 2R0WH 5C97A 1L5GA 3DGCR 1FDLH 1HVXA 2ESVA 2CUIA 3MOBL 5HYQA 2ZOLA 3CFEB 4GO6B 2HJLB 1FV1A 5E8DH 1HHGB 1BDYA 3QR0A 4UMSA 4FFZA 5LBVA 1DSYA 2EC8A 2KI6A 1X9QA 4KXCA 2FJHB 2FO8A 3NA4A 1ORSB 3NIGF 5EOTB 1WBYA 5FB8A 3CC5A 5H37H 3SJVD 2BWIA 4L2LA 2JCCA 2DI7A 4JS7A 2AEIT 4Y9CA 1FFPA 1W72L 4X6CF 1VZGA 4M7LH 4XX1G 3WTXA 5JHDB 1Q90A 2Q76A 1MLCB 4EOWH 2PO6B 3QJHA 4AM0A 5IJKC 2XHNA 3NCYS 5AENA 1UZGA 3OX8B 4H88H 1IGMH 3BSZA 4QHKI 5EULV 2F5BL 4I3SL 2ARWA 1U21A 3FPXA 3BZ4A 3UFIA 3VWKD 4F9PC 4G3YH 2HLAB 4HGMA 1HFUA 4YUEL 2UXFA 1LWHA 2VDPA 3K8LA 1B3IA 2P8LB 4FNUA 3WTUA 3GT6A 3ZE0F 3F3PA 2FYYA 3LS5L 5DJXB 3T6VA 3L4CA 4BQCA 3ESMA 3RZCC 3IETA 4OR1A 3SO5A 2BNQE 3QO0B 4L3GD 2AJSL 2G4EA 2V7NB 3WN5A 4DKEL 2BXZA 5KBLA 3TEZA 2ZCHH 1VB9A 1SOSA 2Y07L 3V5DB 3VXNB 4PGJA 1A7BA 1HWWA 1ZMYA 2Z92B 4RIRA 1F4HA 3TJEH 3MRCB 3RVVD 4PJCF 5IV2B 4L8CB 2GSMB 3RFZB 5J6SA 1ORQA 1P1ZA 1U8PA 3NABH 3NCJH 3VFNB 5I28A 4PC0A 1G7QB 4QUOA 3TN0D 3MRIA 4DWHA 2RAMA 2G2PA 4PS7A 3MRDA 4PVMA 3I7OA 2NUTA 3KPRE 3BVNB 3Q2CA 3IDJA 3FU5A 3FQYA 2NY6B 4GP4B 3LSOA 2PYFA 4N1EA 5KSUB 1CR9H 1SMAA 1LXMA 1XCXA 4I48B 1KGUA 1BD2B 4LG8A 1MCDA 3O4LD 3DLQR 1VPOL 1D2OA 1FNSH 3ARSA 2OMNA 1DUYB 1SN0A 5AW1B 1N6VA 4JPWH 3SQBB 4EN3C 1AGFA 4OJYA 2WD0A 5HJGA 5IW3A 3U36B 4FD0A 4JDTH 3EUDA 3R8QA 5GRVL 3UAAA 2FD6H 3D85B 4YHKH 3JWNC 4KK9C 4KTEH 4EZKA 4MCYA 2K6ZA 3FTZA 4UT9A 3AREA 2VDLB 2BP3A 5INCB 4OTXL 1X5XA 4Y4FA 4ZODA 1PDKB 4G59C 4G8EB 5I8OH 2XPGA 4RDQG 1NEPA 1JRHI 3IF1B 1HHIA 4BCCA 1YNTA 3RSEC 1MJ7L 2F19H 3OKYB 3H9ZA 1GC1L 5IESH 5SX4I 5E6YA 1A4BA 3QQDB 4BCXA 1IO4C 3D2TA 4S0TD 3U0TB 1E9OA 3OWEA 1KB5H 1SVBA 2QPEB 4OZGB 2I7SA 5AOJA 2WLHA 1QBLL 4DK3A 1D5MA 1L9RA 4FQJH 1LO0H 4KJWD 1G7PB 1M6UA 3HZMA 4GKLA 4N4YB 5EU7C 3GM8A 3C6SB 1YYCA 3QYCA 2CNZA 2NZIA 4H40A 1CICB 1A8ZA 4HPYH 2QADD 2MPVA 4FG2A 4Y19B 3SBWA 3AITA 4WW1B 3EGXB 3PL6D 3OHXC 2XN9A 1UM6H 1JF1A 3CZFA 1MCBA 3GXUB 3THMH 4URTB 5CJOL 1ODAA 3O6FC 4X7FC 4HEMA 5GGRY 1XF3B 1P0SE 3REVA 4PH8A 3AQDA 1TITA 2GKIA 3CBRA 3MCLH 4LF3A 1AVAA 1U0QA 4KX8A 4ZOXA 5JQ6H 4FAND 3GSRB 4P23C 1JMXB 4H0GA 3WDJA 2Y5EA 3DVIA 2VC2B 2C1PA 4M62L 1ES0B 3ZDXE 4MAYA 4IKNA 4ATWA 4J0WA 3VXTA 2ARJB 3QDMD 4IBWA 3KWWA 5DVKA 1E8WA 2MHAA 3W2DL 4RWYH 2BIMA 1I3VA 1FZOB 2FR4A 4EI5D 4NC2B 3RFGA 2PTUA 4CI2A 1ND0B 3IJ9A 2M2DA 3ARFC 3ZE1F 1QR1B 4L3EE 1H2WA 3OSVA 4GBXA 2EILB 5FC9A 4EI6B 5DFTA 2GITA 2XJKA 4CU8A 2BSEA 2R0LL 4E0RA 1S5HA 2CGZA 4L23A 3VXSB 5DRWB 3STLB 2HWZL 4LMQE 1VZ2A 1CB4A 2I25N 3IDJB 1MLCA 4BGDA 4DOHB 5JIKA 3BVVA 2J44A 4FI6A 3NT0A 4C4BA 4GKSA 4O4YH 3ARBB 4GRMB 1CK0L 4XAWH 1JN6A 2WXPA 5EOTA 1IKFH 4WW1A 1ZANH 3D51A 1SEQH 1NCBH 4BZ2L 4JG9A 4FAVD 2DQDH 2EACA 5SWSA 4YC2B 1EDQA 3ZHFA 3MLPA 1C08B 2P5EE 4Q4EA 4UCFA 2NSMA 2NY2D 3PRZA 3SY0B 4BUQA 4KROD 5JORA 1SQMA 4DP5X 3JVGC 2XA3A 4L3ED 5BZWA 2I60L 2A9MH 3JVFC 3ETBJ 4HCGA 5C6TL 1ZLWH 4A2GA 2GTWA 1WSST 1JZ2A 3F7YA 1CFTB 4LEXL 2VDQL 1QSVA 4JQVC 4P9MH 3UZQA 1U8KB 2P5WE 1A3RH 3GS0A 3FAWA 4JFVA 2Z8VC 1XF2A 4G6AD 2B0SH 2AJUH 5JPNA 5GZOC 1EBPA 5AUMB 1SBBA 3UIZA 4F8NA 4F91B 3JQOB 1E5AA 2WYZA 5IHZB 4PJAE 3EH4B 3ML9A 3HZKA 2HSIA 1MCHA 1DE4B 4RDBA 5FV1L 3EQ9A 3LQMA 1A1MB 1AGDA 4X9HA 3I8EA 3MJ9A 2Q1EA 2EYRA 3E3QC 3AB0C 5IWLC 1ZHBB 3RX9A 4WGKA 1IKOP 4UDUB 4Y4FC 5EPMB 4LPYA 5I73C 1KY7A 4XNYH 5IG7A 5IZ7A 2FWLB 3NIFA 1N0XL 3HI1B 5CJXA 4MKTA 4PJBF 4I4WB 5CMAA 3E2HC 3Q9QA 2H3NA 3DUSB 4WTXA 5E2UL 5FGBC 2PNDA 1CD8A 4M8UA 2Z65C 3NCFB 4NIKB 3I2CL 4XPBH 1MIEL 4NCC1 2KYIA 2BS8A 1CD1A 5D1QC 5E6IC 3R06A 1AS8A 1KJ2A 2B1HH 3PWUB 3EJJX 2XBZA 2DL9A 2GBVA 4XC1L 3TJPA 2E27H 4Y9GA 1TQSA 3AACA 4K5PA 3GBEA 1H0DB 5T1MA 1N4XH 4XVSH 1L4IA 1UWFA 3X1GA 2J8UB 5E5MA 1EHAA 4JHWH 1O5DT 5IBUG 2K7PA 1A7PH 1J18A 2F7PA 1W16A 2Z64C 3QJFA 3VD0A 1S7QA 1JTOA 4YGVB 5AB2A 5HHNA 4BM7A 1FHGA 1BM7A 5D2NB 4XC3H 1CDIA 3T0AA 4NQVA 3PHQB 2IH3A 3BAWA 4ANKA 4ZXBB 1OTUC 3NJGA 1Z9SA 3CVBA 1RIHL 3GMQA 3DA0A 2B3RA 2CA4A 5DMKA 3V0IA 2PPFA 4ZX6A 2NMSA 4QF1B 2GITB 3V52H 2ZXDA 1S7RA 2WCGA 3M46A 4HIIA 4ZX3A 5AAPA 4V11A 2DV6A 4Z7NB 4O2CA 2DEYX 4TULL 1XEDA 3L3DB 4HZAA 2I26N 5HI3C 5DHVH 2R2CA 4PWGA 2WXGA 1BOGA 3TZVD 1TZGL 1UD8A 5EEUA 1X5LA 5LNDA 1MKFA 4DP6X 2AP2A 4GY4A 1N59B 3RLMD 2VJ8A 1CXFA 1I9JH 2FBJL 1C12B 2BY0A 1L7IL 3D25B 3BWAA 4PIRF 1F45A 2BP0A 4P5KB 4PWJA 4BINA 2H9MA 1B0RB 1QLEH 4JL1A 1BZ7A 1XXFC 1NLDH 3L81A 1CLYH 1YUHA 4YSUA 5IJVB 3U7YH 1AKPA 3EI4B 1QI4A 3Q3GA 1B0IA 3RN1D 2CDFB 3HBGA 4XP1L 3INUH 1DO5A 4MTMA 1J8KA 3H3PH 5EUOB 2BY1A 2P24B 5F0MB 3TVMC 2VZTA 2TSAA 3BGFC 1XGPB 5FA3A 1QFWH 1E0OB 2DLFH 2P9KC 1QFPA 4FS0A 1RK7A 1LP9A 3V4PH 5GGSY 4Z8FH 3O6KL 3IDXL 3TYGL 4D9LL 4MLIA 2IAMB 1G7JB 3RTLA 5JNYB 4HUKB 3WGVB 1HI6A 1GYCA 4LCVA 1EDYA 5G55A 4AT6A 5CJQH 3V4VB 1SLUA 3HE6A 4NHCH 4BFKA 1JGUH 2YC1B 1KGCE 4F5CA 1QYGL 5IP4A 4HETA 4UQDA 3MOQA 5KVFL 3FSZA 2V17H 2WK2A 2JFCA 3C60A 4X98B 3ZN6A 2CDGA 2YD7A 3O4OC 5CGYD 5BRZA 2EP6A 5GGSB 1NC4D 1T1WB 3KEHA 1AYRA 4L37B 4R3SB 4TPRL 5I8EA 4LGNA 4PGBA 5KG9B 1Z2KA 3BWSA 3OMNB 3U83A 3DWTA 4QMEA 1CVRA 5HJ3B 4KV5F 1W72A 2L8AA 3L3HA 3NTCL 1CICD 2Y7OA 3OKOB 5KSAB 3QZPA 4X0NA 5BMFH 4U1GB 2X44D 2OR7A 4WUUA 2F53D 4EIBA 5ALBH 1KTLA 4WGVB 3V4UH 4K7PY 3RA7H 1HH6B 1LP9F 1XH3A 1Q0XL 3MLTA 5CBEA 2Y0SA 2ZCHL 3BFWA 4UNIA 2MSPA 4X5QA 5IBTL 4LL9A 3IJYB 4HCRL 4J4PA 1ACCA 5TE6L 3FRPB 2GK2A 3KWVA 3TFBA 4RZCA 3MRCA 1H6EA 4A66A 1JGDB 2Q87A 3TV3H 1SY6A 5CBAA 3MACL 1YEWA 5C9ZB 1WCQA 5J9PB 2E6JA 4W9KC 3WTVA 4DVBB 3DTUB 2AS5M 4HUXA 3BP6B 2VB5A 3VMNA 4B9YA 4EUPA 2H1PH 1YAIA 2J88H 1RZJL 3BYYA 3Q1SL 5EU5A 4M5TA 4YBQC 5DZVA 2EXYC 3BKCH 4I3GA 4XMPL 4GRLD 4P46B 5FFGA 2H9PA 3RDJA 2IDQA 2AQ3A 5IVZA 2ZG2A 2NNXA 4QXTB 5GZOD 3C09B 3F58H 4NQCA 1SM3L 1JNHA 3VI4E 1KYAA 4PRAA 5ANHA 5DD0H 1MFCH 1JWUA 4OZGF 5KSBF 3DO7B 3BH4A 3BH9A 2G60L 4NCC2 4WSJA 3MBED 5E2TH 1S9XB 2OFQA 3AREB 1KELL 2UXGA 1I53A 1WEJH 2YKLL 3H6JA 4GYBA 4D94A 3VTMA 2AQ1A 4AJWA 5ENWA 3ZKXC 3PV6B 1NSNL 1OCOB 1Y07A 1MOEA 3HKZA 3JZNA 2GC7C 5ANMB 1CE6A 3SDAC 3WIHL 1JI2A 5E00B 1SXBA 4LVOB 3QUKB 4LEEA 2VDKL 4XNDA 3O0LA 2AVGA 4G9FA 3VRIB 4E9WA 3ULUD 5FYKL 5CXCA 4OUUB 4CC4C 2ZYIA 2A5UA 4QRPB 4IBUA 4P2RE 4ZO8A 2WBJD 4KI5F 4UZUA 2YK1L 4HIPA 1R0AL 4WVRA 3CHRA 5AW5B 1LTXA 4P5TA 4AL8C 2ICWJ 3DOSB 2X0VA 4PJGA 3FSOA 2R2BB 3QO1A 3EWEA 2H4EA 3MKKA 2OMTA 3HNTH 4AMKL 5I15L 4OZIB 3SJVB 4GMTH 4M6OL 1LO2H 3B6SA 3EF4A 2X4TB 1OW0A 3NCWA 2OL3H 5CINL 3OQRA 5K39A 5EIIA 2CKBB 5L2KA 5KYWB 1QFWM 1U93B 4S0HA 1B2WL 3B9EA 3S36H 1IKNA 2XNAB 2O6EA 4NFDA 3A6CL 3BJ91 3CDZA 2MQ0A 2P5PA 2G0LA 2HT3C 2H2SC 2P3YA 4OY9A 4KWUA 4TTDC 1RY7B 3BN9D 1JL8A 3MU3A 4Q58C 2KKQA 1M1XB 4FQIH 4M29A 2QVKA 4YHYB 1E8MA 4YZFF 2HWZH 1D6VL 2K8QA 2FH6A 4QT5A 2PABA 3HR6A 1WTLA 5IVNA 1FZKB 3OJMB 3H3BC 4D0CA 4U49A 4YX2H 5A2KH 5LGHL 1FYTB 1ERJA 2TRHA 4Y16D 1EGJH 5SWZA 1B4JH 4PRDA 4NRZA 2QFPA 4JFOA 2EUXA 4OZGE 2YNOA 2RBLA 1BXUA 3OLEA 4GRLB 2QPDB 3ATFA 3LH8A 4P46D 4PGCB 1P4LA 2DD8H 2ZYSA 1UD4A 1KPVB 2H0FA 2GIXA 1UUNA 3VWKA 4HZLA 3MHZA 3T5WA 5B1KA 1HCVA 3SKMB 5I30L 4PWIA 3GSUA 1CQYA 2YZ1A 1EBAA 2XBTA 3IMUA 5FYLE 4XC1H 2Q7YB 2E7MA 4MJ5A 1MCJA 2Q86A 5BZDA 4IDJL 3LKQB 3NCBB 4OQ1A 3AXIA 2V7HB 2YUVA 4HKBA 1E4JA 2W5PA 4DH2A 2VISB 5CD5C 4MQ7B 3VH8G 3QK0A 1KJVB 3ZHDA 3NPSB 4UTBA 3BQUB 4YHML 2HZHA 2QVFB 1QI5A 1WLHA 2CZNA 1I85A 1AHWB 5AVRB 4OVUA 4XZUB 5CCKH 3QUXB 5HGBA 4LP4A 3U30B 3VRLE 3P4OA 3O3BA 3MNWB 3BT2L 3CFSB 3M88A 2VDMA 4YZFE 5HDBF 3U79A 5JOEA 3IJ1A 1F13A 2CJ3A 4M4RA 3UBGA 4D0CB 5J3HD 3ZDZE 2PP8A 4ZYKA 2X2HA 4WDIA 3K5SA 4NO5B 3I7KA 4OJDH 2YD2A 2E6QA 3EOTH 2N56A 5DI8A 4KO7A 4P8QA 1NR0A 1OKEA 4F7EA 4A6YL 2BSCA 2WUBL 5IF0B 1RURL 5IR1B 5L6YH 2PM7B 3QEUA 2ICEB 5TPWL 1USZA 2BP8B 5FHAH 4JZNB 2GT9A 2ZXCA 2B4CH 3AWEA 1BXAA 2H32B 4DT2A 4DQAA 4Z76B 5F6IC 1M7UA 1OD7A 5BOJA 5I17A 4QWWD 4CC4A 4ZUVB 3ROOB 2EECA 4JHWL 4JHNA 3HLAA 1OK8A 3BZFB 2H6PB 3TBSB 2XZZA 5I6LA 1B0GA 3C9NB 3FT3A 1LE5A 1OW0C 3ZTNH 3OAYK 5FYKE 2IH1A 4JFHD 4HHGA 5DEJA 1XIWB 1R3KB 4GFXA 1V05A 5EUOF 3WOVA 1J9QA 2PPDA 1CFSA 4CADB 3K6SB 4ECNA 2G9HB 1GMIA 4UT6H 3WFBL 4FABL 2P48B 4HQQL 4K15A 5G2NA 2YXWA 2DWDB 2BOLA 3IGAA 4LU5H 4WHYH 4OKDA 4TULH 4PU2A 5ID1A 5LKNA 7FABL 3JWNH 1TZAA 3TZVC 5C86A 3BHBB 2PCYA 1UOLA 4JDVA 3PSCB 4YBLC 1JV5B 3V0HA 4DHLA 5D71H 5E8DL 4DN4H 4LSSL 4WTWA 5KVFH 4YHNB 4UQ9A 4K71C 3CK0H 4XPAL 2W07A 4OCMC 5DK0B 4X6FA 5KEZA 1S7WA 1NGYB 4EXPX 3UAJD 5SWQA 3PG2A 2PYFB 5KSUA 3CDGA 3IU3A 2XWBA 2FWSA 4G7QB 4KKPA 5JW3L 2LOEA 1CK0H 4BP9A 1ACXA 2D73A 3RHWF 1KJ3L 2CR3A 3CFJB 4UT9H 5E56A 3D39A 1MRFL 4DO6A 5ISZD 5T3XE 4LSPH 2WB7A 3I50L 4HVBA 2MCPH 2VDKH 3CZGA 4NT6B 3SDCC 1M3IA 4JXMA 4PRBA 2A74A 3P77A 4BA8A 5GSVB 3SQOH 5F97E 2Z35B 3U30C 4U1SB 1FJ1B 2YAEA 4PRHB 3FYIB 4NOFA 4U1KA 3SCMB 3BRFA 3TA3B 4F24A 1TYEB 3ZSSA 3HMXA 2NNAB 2QKSA 4P4RA 5CLYA 3G6DH 3ZLQC 3WTTA 1FFNB 2OK0H 1EHNA 3IMBA 1ADQH 2DQJL 2YD5A 3NVQA 2HCZX 3IAQA 4JFPB 4X7DC 3QEQD 4NO3B 5DS2A 5TE4L 2NW2B 5D1XA 3R7RA 2NXYC 5E4AA 4AMKH 5D2NE 3RFRA 3SO3C 4AM0Q 4W9DC 1OOWA 3NFNA 2EEBA 2VR5A 4KY1L 4LBAA 3O11A 5GGSA 2NY5L 1E90A 1YUKB 1AGCA 5SX5K 4IRJD 1RZ8B 3KPSB 5BV7H 2EC9U 1I1AA 4TUKH 3WKQA 2MOQA 4A08B 2Z8WC 1ZCRA 2BFGA 4KDVA 1MQKH 1A6TA 5E5UB 5FUOH 1ZGLB 3PVWB 4GRLC 5I0ZA 3CDGB 3IU3B 4XVJH 3MV7E 4H0HB 4Y19A 1RP8A 3UTQB 4P2RB 4P48A 4XB7A 4GAFB 5I18H 4JCMA 4FYQA 3BH8B 4WUUB 2OYLA 2BWQA 4ZDHA 4HJ0C 4TSCH 3L9BA 3I2CH 5D7KE 1PEVA 1S7TA 1TTRA 2WLKA 3SZ6A 1P7KB 1UOWA 3MFFB 4WNJA 3NGBC 2OR8A 3LOWA 2W9EH 1SXAA 2VMJA 1KELH 1XCWA 3IGAB 4WTZG 4RNRB 5TK2A 3ZO9A 3UC0L 4YHPB 1I1FA 2X10A 3KLLA 4HFUH 1CZ8L 5HGHA 3V6ZA 4YSQA 2FRGP 3BUDA 5BO1H 2AAAA 2GYSA 1BJMA 4XVSL 4Z7QA 3B7YA 4JREC 4X4MA 2X53A 3EOAB 3JBG7 3N5AA 1U91A 3QFJE 2FAUA 1C5DA 4HGKC 5E8EB 1XR8A 4I0PD 4KXAA 1NTDA 4PJBE 4XAKD 1ED3B 1MFAL 4XBPA 1CE1L 1LO4H 7TAAA 4CY5A 1IAOB 3OKNB 3K4ZA 4M1CD 4ERYA 3SPHA 2XQBH 3V4VA 3QIWD 3NESA 4WJ5A 4ZXBD 2YEZB 4AEFA 4MJHA 5GSRB 1DUZA 3W38A 2N0KA 4M6NL 4I1RA 2CJSA 4GSXA 4DCQB 1WZLA 1WV7T 2BC4B 3QGVA 4JFSA 1QSEB 1K5NA 1Q0YH 3X13A 3I2NA 3GEFA 3ARYA 3GSWB 4TVSa 4OB5L 1PIFA 1UQSA 3DI2B 3D2UB 4TLUA 1KY6A 4MDJB 4JZNA 3FDWA 5KANI 1HX0A 1UXSB 4K3EH 1SFDA 4MCNA 3U9PH 3GJFH 4UOW1 1FE8L 3CZUB 2VRQA 5AVUB 1T04B 1PPIA 3QPXH 4JO1L 4NZFA 1GW6A 3FH7A 5FOBA 1G9NL 1OEZW 2V2WB 4UT7L 2XV3A 5FW7A 3FW6A 3BP7A 1G1KA 4YDVA 1NIBA 1QSZA 3DX9B 2X0WA 4XXWA 3FCSB 1HILA 4FQCH 3JAMg 1V3LA 1IGYB 1MFEH 1EAPA 3NIFE 4CN6A 1CGWA 2V2XB 3Q6FB 4Z95H 3MUY1 1KIQB 2VO5A 2H47A 4K23L 1I3RA 3H7LA 3HW7A 1F00I 1ONQB 1S7UB 1KPUA 4YNYA 4A11B 3QEQB 3EI3A 1AR2A 4O51B 2OZ4H 4WO4D 5ITBL 5JHLH 3AREC 3WD5L 4OF5A 4R97C 2DQ6A 1Q1JL 3RE0A 3SCMA 5HE2B 1XB3A 4HIJB 4MZRA 1KYFA 5AVTB 1J9RA 1PIGA 1UA7A 5J12C 1UM5L 4I4WA 4P5TC 5D9SA 1TYQC 2BVEA 5FM4A 2LAAA 3RQ3A 4H1LG 3ZRSA 5K1CC 5SWSD 4UQAA 3GSUB 4ALAH 4IOSA 4YGVA 2GI0A 2XWBB 3D85D 2AERT 3AFCA 4XNQB 4QHNB 5GSRA 4QTHB 5MHSE 4TQIA 1A1MA 4E68A 4ZNEA 1HEZB 5AEAA 1BWMA 1D5ZB 1FVCB 1TSRA 4NS0A 4IOFD 4GRLA 4FQHB 2WSKA 4YHOL 1HCZA 4RA3A 4JFXB 4P9HL 1QWHA 4X6CB 1MN4A 2MRYA 3OGCA 1Y6NR 4WQOA 1WF5A 3P0VH 1K8IB 5GGQL 4MXVF 3T6ZA 3EXLA 2EDYA 4X0KA 3WFCL 3UYPA 3F2LA 1KCUH 4CILA 3U46B 3G5XA 4K9EC 3S35X 1D6VH 2QKIC 4O2FB 4A2EA 1L0QA 4LZKA 1G7MB 5CN1A 4R5TA 4BV1A 1UGNA 3DX8A 4KKCC 4U1GC 4B53A 2VM4A 2H5UA 4R4FH 2Y5TB 1GGCL 3B4NA 2DJ4A 1SHXA 2QADB 2WXOA 3HTLX 4L8BA 4P2CG 4FXKA 4OLUL 4X8XA 2CR0A 1PS3A 4PRIB 5I6OA 1KWGA 5CN2A 5C07E 2QDWA 3OR7B 4HJIA 5EO0A 4EI5B 3K8KA 4F7CB 3GD1C 1M7IB 3G6JE 3V6OC 3BGMB 4FJZA 5M5UA 5IGOA 4G9FE 3D39D 3KEDA 4B9KC 1GYVA 4W1TA 2YPLD 1AD9B 1TU2B 3G5ZA 3O4OB 4PMFA 4OZIA 5H4ZA 3AG1B 4BFRA 3NVNA 3MQIA 2QELA 3CLFL 5TF0A 1PAZA 2YUXA 3WJLC 1PY9A 2VQ4A 3AMKA 3GBDA 1T2XA 3OXRA 1ILSA 3DX6A 3ILQC 4LLUB 2UZXB 2GJJA 2NXYD 1DQMH 5BXFB 5FCUH 3MFFA 2WINA 2FR4B 2E27L 3E6HB 4HDIB 3TA4D 1A64A 1IVLA 2JJTC 4G7RB 4R9HA 5F89A 3BGAA 1S3KL 2QADC 3FCTA 4UU9A 2NXZB 3WI9A 1S7UA 3WIIH 3EO9L 5C3LD 3MMYA 3CXDL 5IHHA 3DYOA 4G56B 3ULVF 2V2XA 4U05A 1A2YB 4TV3A 5EM2A 3TVMB 1P4BL 4K94C 3GZQA 4PJ5E 4Z5RA 3TJEL 2PYEB 3FTGB 3MSPA 5AKRA 2NTSP 3HE6D 2FO1A 5HE3B 4N6RB 2YO3A 2YR3A 4PJDB 2E3VA 3SD2A 3DI3B 2GUOA 1FFOA 1EEZB 1JGIA 4ZRGA 3VI4F 2PW2A 4KKBC 5CP7B 2X9XA 2ED6A 3NRPA 5T1KD 5IW6A 3MLXL 4L1LA 4ES8A 1CGSH 4N5ED 4QLWA 2W9EL 1WD8A 4JPIB 1BQSA 2OW7A 1FZOA 3F7QA 3CXHK 4HF5L 4KKAD 5SWZD 3IJSB 3H9YA 5D7LB 2V5MA 4MQXD 3ULUE 4OZGA 2AJZB 2VDOL 4L9LA 3W5MA 3BW9B 4PJEA 4PJ9D 4XH2B 2AJYL 4DUXA 5EO9B 5DJDB 2APFA 1LO5A 3MUZ1 4PJ5B 1V7NH 4AX3A 2QPSA 2YD9A 4Y1AE 2KLSA 1YNTB 2WQUA 4XNUL 1UFGA 2BIOA 4ZXBC 1I1YB 5B21A 1P2CB 5L7XH 3MXVH 5DVMA 4YWGL 1N6DA 4MWFB 1ZT1B 1M05B 5DVOA 5D2NC 3CU7A 3IDGB 3H3PL 1I1RA 4U3CA 1AZVA 3VFRB 2DF3A 4H1LH 4TMPA 4UQEA 4X6FB 5D2LA 5B39B 3S8GB 5C2VB 1J1XL 2Y7LA 4PRPA 1JPFB 2MKWA 3MCKA 5EA0H 2IQAA 1RUPH 1AAJA 2HT4C 2F61A 4G8FA 2D3JA 3WNPA 3RL1A 3VYOA 3QFGA 4GNKB 1R3LB 2B16A 4LT7A 1YYML 4PJ8B 4Q6KA 4RH4A 5E0FA 4QPEA 5E6IB 3X1FA 4CU6A 4EEEA 5EBLB 2I5YL 1FO0B 5BRZD 2J6WA 1KJMB 1J5OL 4W9FC 4YVDA 4CZYA 2FD6L 2IPTL 3LRGA 3E2HB 5EORH 1FFTB 5G4NA 5C0FA 4CADA 1V8HA 4UT9L 1XZ0B 2OL3B 2VE6A 1XB8A 4TLKA 4BIKA 2WJ7A 5I73B 2JIXA 4QHUB 3RBSA 4KBPA 4HWBA 4P5TB 1NBCA 2DJMA 5DRNB 5HDQL 1JGVH 2XICA 4DPBX 3FT3B 2F1AA 1HWHB 4N28A 4NO3A 2C9VA 2SEBA 3W2DH 4N6QA 4AVHA 4P4RB 1RL1A 2Y1AA 4KOCA 4XHJD 1JVLA 1SLVA 3BT0A 3LS4H 4YDNA 2GW5A 3PDDA 2FATH 2JF1A 1IC7H 4IRZA 4QRQA 5FM5O 4PJ7E 4HWEH 2EDHA 2WZ0A 3O6ML 1FIGL 1O6FA 3VX0A 5C0CA 3LKRA 5B38A 4JE4B 1CI3M 2XA8L 5K59F 1BYNA 4P5MB 5I16A 2P8PA 1FFPB 2PKDA 1AIZA 2IALB 3NGBB 4IRJC 4JDZB 4PY7A 3FFCD 1N9PA 1HXMA 2EVGA 5MEQB 4W9JC 2XTSA 3K2IA 2X09A 4NCDA 1S9XA 4CY1A 1T1YA 2AC0A 4PVLA 4PUBL 4AYFB 3N42F 5SXMA 1PYWB 4UTAL 2EUVA 3QC5X 2PXYA 5AOIA 5L0QC 2X3BA 5GS2H 3LEXB 1BZ7B 5FFOA 5C6PB 1L7TL 1T83A 1X9RA 3QXVA 1L9NA 1TEFA 1F6AB 4ODVL 5E2JA 1OTUD 1L5GB 1JZ8A 1U33A 3AXLA 4QT8A 1BP3B 3O41B 1N59A 5SV3A 4IS6A 1Q1PA 4MB4A 2HFGH 5HHPA 1WZAA 5DC9B 1CCZA 5GRVK 3RNKA 3ULSA 4MJ6A 4X99B 4FQ1H 4K3GA 5E4EC 2AI0H 2BHZA 4HFWA 4S1SH 2Q6WB 3IJCA 5GS1B 3C08L 2OX5B 4JO4L 3GI8L 2Q7YA 2MCAA 3TX4A 2VDMH 3CDZB 3NIDA 3OKDB 2ADGB 1I75A 4GKNA 2AABH 2J8UF 4UQCA 5KAQF 4GXUN 1U2HA 5HE1B 3GK8H 2G4GA 3CSYB 1YJDL 3PHQA 1IGFH 3W11C 1BF5A 5CKAA 1DZ0A 4FFVD 1PW3A 2G3ZA 4P06A 3IDNB 1AXTH 1CUOA 2Q9OA 4M6NH 3ALPA 1JZJA 1UWXH 4LKCB 4U6XA 3S3PA 3SHFA 1EJ8A 5HHME 5LBSH 3EU7A 4U1JA 4QHUA 2CKBH 2DQTL 2NY0B 4PJHB 5HGDB 1FNEA 4L4TD 1LD9B 4N3TA 4WV1B 5HPMA 1NFAA 2DLFL 2P9UC 5B7EA 2J2ZA 1ASPA 1NAML 3OAZH 1PFCA 5D7JD 1ZHNA 5EMKB 2ZPKH 2DKMA 1FRGH 3KDMB 3O3EA 4JO1H 4Z7UB 1R3LA 5IVZB 4K71B 3FRXA 1WGVA 2X42A 1ZE3C 3BCDA 1WK0A 2EDWA 3GXFA 3MJ8B 4CAGA 5I8CB 2F08A 3WAKA 1A66A 1LK2A 3DC0A 1G4MA 3MCKB 4XN9A 3AY4A 2VDOA 4LLVA 2WOYA 2Y7QA 4UWQB 5T1LA 3B1TA 2JKWA 3KPNB 2H6KA 1Q1JH 4LCIH 5HI5D 1X7QB 5DC4B 4F33A 4G80B 1X5FA 3MREB 3TA3C 3UERA 5GGTA 5FYJU 3RWHA 3QNXB 5AB1A 4OIIH 4MBRA 3JZGA 2VZOA 4UNTA 2PWGA 4JFFE 3R7QA 5IWLA 4ZNCD 3DXKC 3UBFA 3L2NA 3QFJA 3FU3A 5D1QD 2TRYA 1EAQA 2AQRA 5FX3A 5JZ7D 2UXTA 5EALA 4LB8A 4FXTA 1E65A 3OGCB 3GSNA 3QI9B 3WTSA 4OQTA 3QNZA 2BRRH 3LEXA 1I9RH 5B1AB 1AGEA 1SOXA 1Z0MA 3MRFB 4N2OA 1PYWA 1UFUA 2XJLA 3HNVH 4NP4L 3I75B 5JW5B 4Z0XA 1CN4A 2ZUSA 3QI9C 1ZJBA 4IRJA 2EH8L 2K3HA 1SPDA 4YBLB 2EIBA 5IHUH 3T09A 1I2MB 3Q01A 3LPFA 4I2XA 4P3CL 1WTGT 3B7UX 3VMOA 2EIZB 5F7EL 1H3WM 4IDJH 1K4CB 2F5AH 3AM8A 3IM1A 2V3FA 3LTVA 3IRCA 5I18L 2J88L 1FWXA 3Q1SH 4R7LA 5EM2B 3SZKC 3U9WA 1EZLA 1WA1X 4R90L 4EI6A 3C6LD 5DJ0A 3NIGB 4RGNE 3JPXA 3BKYH 1QOKA 5IHBA 1QPPA 3ECVA 5KS9F 3FO1A 5LAPA 1MH5B 2NXZD 5HDBE 3SKNA 1MFUA 1P69B 2DWTA 4YEFA 5HJ3A 4JM2B 2XVLA 3VO0A 3GC3A 4CBZA 3TIEA 2OA9A 1CZ8H 3BUYB 1YEFH 3VXTB 4XI5C 2BY3A 1AY1L 3OB0K 4CW1A 1IEBB 2WKOA 2CNYA 2ZG1A 4PJAA 4HOMA 5ESQA 3TT3H 4M61A 3CZNA 4LF3B 1FYTE 1XMEB 3MRRA 1HHHA 3MZKA 1AD9A 3SGEH 4YSDA 4RFOH 1XR9A 1MVUB 2X9YA 3QHFL 4N0CC 5K93A 1K3IA 1UCTA 1P4IH 4FYSA 1J0KA 3WNNA 3Q2WA 1EO8L 1Q0YL 1SLXA 5ICYA 3G6AA 2E74C 2F15A 3LH9A 3LHAA 2ZX5A 1B0WA 3US1A 4XCYB 3AJ7A 3WN5C 3SEPA 4WV1C 3VQ2C 1KBKA 1RHHB 4N2NA 1RPKA 4AVIA 5E00A 1KMGA 3CXDH 3UDWC 1JV5A 1G5AA 2DW5A 4OD2B 4PSWB 1UD6A 2V0AA 4LOFA 4UV7L 1EO7A 2FYVA 2CDEB 3QIBD 4M9OA 4M7JL 4WNSA 1CGVA 1WD9A 5T3ZD 6FABH 3FUKA 3P73A 4Y5RD 1WISA 2DI9A 5CJQL 4FL4B 3ARBD 5AJAA 4JVUA 4E9RA 2AK4D 4NUJB 1K5WA 3FO2A 3NJMA 3E1ZA 4L0PB 1ETZA 3UCQA 5MENA 2EVIA 1AMYA 3NPSC 2DQCL 3PWPE 4I5BB 3WIAA 4CN4A 1DJHA 3CFTA 3MBEA 1GZQB 3DJSA 3F6JA 3MYZA 5IT2H 4L3CB 1PCSA 1SJEB 4O2WA 1ADWA 1WWBX 5FGCB 3U4BH 4JRYD 2VABB 4KKNA 4ZPVA 3ROLB 1IQWL 4DVRL 4GW1B 5DR5L 5JOFA 1BLNA 3C8KA 2WO2B 4R0LB 1FIEA 5C1MB 2K3TA 2WAHA 1YR2A 4PJ9C 3GHEH 5C07A 4Y4KB 4G1EB 3IJ0A 1MJJA 3O4JA 5E7FA 2AKRA 2FHBA 2ALWA 3ULVL 4BKLA 3GXPA 3QWQB 2WHVA 3FT9A 1R47A 2GBAA 2Q3XA 4NKOA 4TOYL 4J4PD 4PTTB 2DLHA 3CSPA 4CBPA 2EDBA 4FFVC 4ZXBA 4Y16C 3MRDB 4FQLH 4YWGH 4ZMXA 5BS0D 4F37F 3H2QA 4UI2A 5HHOD 2CGRL 4J82A 1CL7L 2WJ5A 1K2DA 1KB5B 3HS8A 4AYID 3WMPA 4O51A 4IRJB 3W81A 2Z92A 3JV5A 4KXDA 4C4KT 1AGBB 2V7NA 1UOVA 3W37A 3WEOA 3BUYA 3QIUA 2Y3AA 2QXVA 2EE3A 4P49A 4A2MA 5DTFB 4G8IB 4HC1A 1CFNA 4AQ1B 1RSYA 2UX7A 1CTMA 3FUHA 5IGXH 1CD1B 1KGCD 4AIZA 4KXBA 1RZ7H 3FN3A 4LLQB 4WAFA 4JPVH 3OX8A 4N0UA 4PTUA 3IDYC 1U92B 2WYHA 4MB1A 4N8PA 1IC5L 1JDCA 3AS3A 1J10A 3W0WE 1KIRB 3I8CA 4PSXB 4D6VA 2QVTA 1P4UA 2VR9A 5JHDE 3D5OF 4KFMA 1E4WH 4IRSB 1LE5B 4XVJL 3C99A 4OI9A 3VD7A 3KGRA 2VL5A 4FULA 4X5XA 3KLDA 4X83A 3C6LB 4GBXC 1QO3A 4ZMPA 2FO4A 3GSVB 3ARDD 4HKZB 3VNYA 3MZLA 4YS4A 3L95B 4U1NA 4GI9A 1PSKL 1G7PA 3HZMB 4ZFOA 1B9XA 4MK0B 2P5WB 4WO4A 1PZ5B 1WH0A 4PCYA 1QBML 2OV0A 4O2FA 1FSKC 1T1ZA 3VGGA 1XGPA 4HEME 2JKLA 2CCWA 2DTML 4XNAA 3ZTEA 2X88A 5M94B 3JWDH 1AO7A 4G7VL 5TDOA 3QQDA 1K8DA 2VITA 2ZX8A 4ELKB 4AN1A 4NRXA 4WI8A 3VXMA 5J4MA 4UOQA 1BLIA 4NM8L 3V10A 4J3WA 1H19A 4WUUE 1C16A 4OM1L 2ADIB 4JR9L 5KSAC 5A40E 1WZKA 4GQ1A 1UWEL 5JXED 3MRMA 3LZFL 1PJWA 3GJEA 2R9HC 2Z93B 1J0IA 3GIVB 1KC5L 3R0NA 2OTPA 2AQTA 3L5IA 4BYHA 4F9LC 1AC6A 1G87A 1IIIA 3FOMB 2LABA 3UPCA 2ZAHA 2Z3FA 4MNQA 3JUZA 2Z6FA 4NDMA 5CSGA 3J81g 4JGNA 1D7BA 5JPNB 1T7WA 1RHFA 4OCSL 4BRVA 3KS0J 1NDGA 3MV01 4LSDA 1AQDA 4FI8A 3EMHA 4X5WA 1XGZA 2ITFA 1KBBA 2H2SD 3BEVB 1IGCL 2XWEA 1R5WB 3QPXL 1ZHNB 2AZAA 4DN4L 2W9DL 1ZTXL 4O2EB 5ID0B 5GRUL 4Y16A 3VI4A 1F4WH 4NQUA 5FECB 1QZ1A 4J3SA 5DD1H 3H0TA 5K9KB 1SXNA 4OCWL 4XO3A 4LKCA 4TNVF 5B7FA 2OR9H 4QHLB 1EANA 3MGAA 3ALWA 4FN0A 4ZMVA 4OSUL 1YHPA 5GHWL 1J1OL 4EPSA 5J5EA 4AYFA 3PPEA 2VDLL 4GKSB 1MPAL 1KJ2B 1AANA 1AXIB 3S97C 1MRCL 4CKQA 5KWYC 4IQHA 2F1BA 4N20A 1Q9LB 5EEZA 1RD6A 2XU9A 5HYFA 4MMYB 3X3GH 3Q05A 3HG1E 3PL6C 4HIQA 1V5JA 2WZ6A 2A9DA 4JVWA 4GSRA 2R4SL 4A1RA 3SN6B 1JV2A 4KRMB 5CJOH 4PS4H 3OC8A 4XMZA 2FGWH 4H5JA 4UMGA 3NMEA 2VTFA 3P11L 4K5LA 5AB0A 3T6WA 1U95B 3HRZC 2OYKA 3NJNA 5ID1B 3QI9D 1XKSA 2WLNA 3O8XD 3FT2B 4ODUA 2WW8A 3TTYA 3JXAA 4LL4A 5IFJA 1AACA 3CJJA 3LKPB 4YR6A 4XWOC 5E0QA 2K7QA 2LLNA 1C5DB 2YB8B 1O6SB 2A3TA 3BSZL 2V2TB 2IAMC 3F7VB 3BO8B 4PJXF 4PBZA 5FUOL 4P2QA 3TBTA 3WV0A 3PDGA 12E8H 3K8MA 3W82A 3FQRA 5C0IA 4XXWC 1MCIA 5L4FA 2QKIB 1TQBC 3K71A 1AR1D 1TTFA 2CJUH 2HPOA 4KVCL 1T1ZB 5FOJA 4XGZA 1BVLA 4KK5D 1SN5A 3ZJAA 4PJ8A 1JYVA 3FK3A 1ZA6B 4FQQA 4O4YL 5TDPA 1F4XH 4G6FB 4JFYA 1OAZH 3IMTA 5B3NA 3JV4B 4XPTL 4N0FB 3D12B 3QCUL 4QXWA 5AVXB 3GGWA 2OJYA 2XFXA 3MZGB 5ETUA 3TT3L 4AYEC 5AYQA 4Y2LA 4J5VA 1XH1A 2V6HA 3SPVA 2DYPB 2NOYA 3GKWH 3SWSD 1PZCA 4JBSA 4RX4A 1PZUB 3DMMC 1KYDA 5I75C 1ZJAA 1DQJA 1HHIB 2EEFA 4H0IA 2ZOUA 4WEMB 5HI4C 3TURA 1RXLA 4UAOB 4PRPE 1QSFD 3RL2B 2XU7A 4A2LA 3FU7B 3P4FA 3KWUA 4NQXA 3OPZL 1YJDC 4X42A 3QUMB 4BQBA 4LVNC 3QO0A 1NGQH 4X4XA 4Q9BA 2G9AA 3AB0B 3FQ2A 4IRZL 2FQFA 1DQML 2OJEA 1YEKH 3L4ZA 4BKSC 2DWXA 4LSQH 4UYPA 4AT6B 5CXCB 3MLWH 2AXHA 2EZ0C 4KZ0A 3TPUA 3GTTA 1U95A 3N44B 3VQLA 2WWNA 2JKRM 4Y7RA 3NOIA 4PREA 2CM5A 4PJEF 2H3XA 3I02A 4POYA 1KIPA 1A9BA 1P4BH 4KJPD 4OZFA 3NSYA 5GGRB 5BJTB 1F3DJ 1G4RA 1BREA 5I1IH 1OB0A 2HRGA 3LKQA 1SHMA 1UJ3C 5IW6B 2R56L 3UTPD 3RDTB 1MJ7H 3TT1H 1K4DB 1T3FB 4YO0A 2X1OA 2P24A 1R19A 2O5ZL 3A67H 3HBPA 4FTVA 4A0AB 1NAMB 3N0PB 1YC8A 4WWKA 3E7JA 1LP9E 4UZSA 4UQBA 2IUVA 2X1QA 2Z1KA 4G7SB 5F7DA 1CO1A 4J3VA 4UBDD 5FHAL 1KBGH 2VXUL 5E6ZA 2DYPD 4KC3B 4YC2C 2AKRB 2JLPA 2GSIA 2I07B 5DO2C 2Z2OA 3WFEL 3MR9B 4IOIA 4I0PA 1IAKB 5E1AA 5I19L 2ZTBA 4GT7A 3PDOB 2BBKH 3SE3C 1CGUA 4C83A 3Q06A 2CWRA 3LS5H 4ZFQA 4FNTA 3B3IB 4LOUC 4O58H 3WELA 5ICZA 1H8OA 5DJCB 4W9GC 2A77H 4YDLB 1YPZA 1OSZB 4E42A 4Z0BL 1NIEA 3ARUA 1MHEA 5IJ7E 3MOBH 2DZEA 3AWGA 3ZE0E 2H9LA 4EIZC 5A3ID 1QSFB 4GUCA 1TO4A 2H2PC 1A4JA 1LEIA 5DK3A 1BZEA 1M9WA 5FLXg 5A7BA 5KG9A 1RUKH 4FYRA 4LNRA 5D6CB 4WWOA 5ICXB 4GM3A 1Z9LA 2F1EA 5KOMC 3UTSB 5BRZB 2WP3T 1QW8A 4MA3B 5BUGA 2IGTA 4LIQE 3HR5B 3LPGA 3LN5A 1YEEH 4PJIE 2QGCA 1R3IH 3FUFA 3FB7A 4D3CH 1BIIB 3TCXA 4CDGC 1WWCA 5LG6A 4TQPA 3BPCB 2H9NA 1VPOH 3MRNA 5J13C 3T08A 4LSVH 1HNFA 1RHHA 1KENH 4QTIH 2QGBA 3QAQA 4NC1E 3ZPDA 1PEWA 4HBCL 2DI8A 2ZJSH 1QFWI 1Y6KR 5E1HB 1OLZA 3IXAB 4I1NB 5AZ2L 1FN4B 4E41D 1KCRL 4J23A 3MLZH 4XVUC 2JB5H 3ESNA 3DX1A 1PD1A 1CBVH 2R2HB 5I1DB 3C87A 5C0IB 1F11A 1P7BA 1WS8A 3KXFB 4JQIH 3REWB 4Y0GA 3N85L 1Q9OA 2IBGA 5HQGA 3MGTB 4E9VA 3S88H 2X4NA 2AXWA 4H1LA 2YMXL 2DWSA 2OI9C 1HDMB 4GXUM 4X6CA 3FT4B 4IU2A 5HVWA 4K3ID 2LFEA 2LLLA 1V7ML 4PJFB 1F90H 1M7IA 5DUPL 1SQJA 4I3RL 2R39A 4PS3A 5D7IF 3PNWB 4D7BA 1N6QL 2YRZA 5A43C 1IQDB 3L6FA 1IFHH 3ECUA 3WS3B 2RALA 3GTVA 1IC7L 4I0KA 3GSNH 1J8HA 4NM8H 4RX4D 3MN8A 3ZU8A 4PAZA 3E38A 5AAMA 5DA0B 1SEBA 3T77A 3RAJL 1MCFA 5IKCB 3GMLB 3WJJC 1EUUA 3P9LA 2A6JB 3UAEA 1NFKA 4CVZA 4NRXB 4C8XA 4GXVL 4AIZB 3UZQB 2O5YL 2ZQKA 2IOIA 3SDCB 2L04A 1MCPH 3UYRL 4EN3B 1A5FH 1JRHL 4R83A 4FMVA 2VJXA 2OVPB 3HE7A 3O4LA 1OSEA 2QSCL 2F54D 1OAUL 5E6SB 4YH6A 3MV8D 1CD0A 2NY6C 1IU1A 5J9PA 1HHJB 2WWOA 4JJHA 3TPKA 4N8VA 3GMNA 2ZWZA 3NFPA 3X14B 1R46A 3QSKB 1VENA 4FQ2H 4UM8A 3UMTA 4KKBD 1TSHA 2COQA 3F7KA 3SE3A 2CO0C 2DN7A 5D7KD 3FRPA 1FP5A 1RUQL 3QCVH 1QRKA 2A74C 3GBMH 2DRUA 1OAZL 2IPUG 3LV3B 1BFTA 4XB8A 1SHSA 1Y18A 1DSWA 1D9KA 4HF5H 3VRJB 4X5WB 3HNSL 3PHAA 3F01A 4TF4A 2VN5A 5FKAA 4ZAKA 4N26A 5TE6H 2YNPA 1A4KA 1KIPB 2VWEE 4L1TA 1GOFA 3GKWL 5D1QE 3IXTA 1U8JB 2YGNA 4JR9H 2FX7L 1BFVL 2IUPA 5EUOE 1JD7A 2FTAA 5DURD 4CRPA 3KLAA 2A2QT 1X5GA 2NDGA 1R24A 4ZFGH 3BD4A 4OIAA 1ZE3H 1HEHC 4R2GD 1FO0L 4BQ6A 1QFSA 3QFDA 3CHOA 1J5DA 1S4IA 3MGTA 2BP5M 2R2BA 3QO1B 3DGGA 1H0DA 4YJZL 3NQKA 4W93A 3FXIC 1I8LA 1BSIA 3EOAA 1GS7A 1OGPA 1HOCB 2ICEC 3V6ZB 3VDAA 5KJ7E 4M4PA 3R0MA 2OP4H 3LH2H 5IIEA 3FF8A 3HA0A 2GBTA 5SWZE 3LIUA 1NKRA 1Q8MA 1EZVY 5HHQA 4BFGA 3CXFA 1X3DA 1MG2A 1M56B 2PWHA 1HAUA 2YD1A 4JEGB 4OJFL 4BK4A 2E7BA 4C54A 4JDEA 4ZN4A 1A9EA 2I9LA 4X80H 1JJUB 1CFVH 1TQTA 4CSPA 2VR4A 4O02B 1D7CA 3IFNH 3U0TA 3HR5A 2VWEC 5DJ2A 3ZZ1A 1E4KA 3MROB 4HUNB 4YFLI 5I66B 3UKUC 5ADPH 2YQ2A 4NM4L 5BS0A 2COVD 8FABA 4S1DD 5JO5B 3GIZL 3S37H 5FDYA 3BQUC 1UA6H 2WVVA 1GVIA 2OSLA 2YGVA 1TJIL 4G5ZL 1MWAB 5FYJD 4AVKA 4E5ZA 4PJAB 1PDKA 2EIEA 4QIRA 2BP0B 1JNJA 3DDGA 2EUZA 1ZV5A 2LFGA 1RJLB 2PO6C 1NBQA 1IEBA 4ODUB 3V6OA 4DKFL 1BM3L 3D30A 3VG9B 3W15A 1U3ZA 5LGKA 4XCFL 2YD0A 1IAIM 4ZZFA 3SD5A 5E51A 4MX7A 5LNGA 2J43A 3UZVA 1U3HD 4M6OH 4KUCD 2KZKA 2X3CA 3O8XC 5JPMC 3EO9H 4BA0A 5A2CA 3RMZD 2KLRA 2WQXA 4JO3L 4ZAKB 2VRKA 2IVFC 3PXTD 1G0YR 4HDJA 1DN0A 4UIMB 3QHZL 4M1GH 1DDTA 3MRGB 3ARBA 5HHOB 5KJRH 3GTNA 1F56A 4FNQA 4MAUH 1HQRB 1JF1B 3CZFB 3MLTB 1E4XL 4AYGA 1PGRB 5DD0L 2DKSA 1DP0A 2D0GA 3P3RA 3ZE0B 4JN2A 1WAAA 3LZNA 1YYLH 4XVUD 3V5KB 3JV4A 4L1HA 5DK0A 4CW1B 2VDRA 1CICA 1CBVL 3Q9PA 4IKJA 2E9JA 3SDDD 1ZOXA 5CR8A 1UB5B 2XCMC 3TXAA 1ZTMA 3V0WL 2AI0L 4S1SL 1A7QH 3PE9A 1AE6L 1HESA 4P2OC 3UAJA 4LLMA 1FG2A 3T0EA 1PLBA 4WCYH 4KTGA 2IGFH 3S88L 4EDWL 2J4WL 3PIQA 4J8QA 1VCBC 4M93C 1CJYA 3RVUC 5J0BA 2OMVA 1V7MH 5FXCH 4F8TA 2NQCA 2VH5L 4GGDA 4O45A 5AG8A 3IF1A 4B5EA 3L17A 4TQEL 3S3JA 4FE9A 3G5ZB 1ZVSB 4ZT1A 4NAAA 5I1KL 4DESA 2R0ZH 1UWGL 2VDQA 3CX2A 3I6KA 4GO8A 3BX7C 3V6FA 4EJ1C 4RSVA 4QY8B 2LV4A 5LO7A 2RA1A 3BKCL 4O02A 4F37K 5F7AA 3BYTA 3SIKA 3IFLH 3OJVC 4L8BB 2W07B 2XN1A 1BIHA 4PR5A 3MLUL 1I8MB 3GXNA 1QFHA 2VXTH 3GJFK 4QKXB 5C09B 2CRYA 3EYUH 2UY7B 3L4VA 4LVOC 4N68A 4W9EC 1F3JB 2X0UA 1QLFA 3OZ9H 1RP9A 3IN0A 5TF1H 4RGNB 1U8CB 4OCRH 5C2UB 1A6ZB 1JDDA 3VTTA 3DJTA 2XZCL 15C8L 2IPTH 4PG9A 2ADYA 4ZUWB 3K7UA 3RP1A 1GZHC 4JRYA 1KBGL 3RDTC 1IZJA 1JK8B 1RK0A 1KZQA 1UJ3B 2YEQA 3FSAA 2CHNA 2J1KA 2O61A 4OSUH 2VL5B 4X5XB 4OJCA 3D0VB 2XRAL 4LNVA 5M95B 3LRHA 3JRPA 2L7UA 3O4GA 2VAAB 1NCNA 1JN6B 3VXMD 5EAMA 2XETA 1ASQA 3MV7D 5BPPA 4O58L