5EMJB

Crystal structure of prmt5:mep50 with compound 8 and sinefungin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
303
structure length
303
Chain Sequence
CMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5emjB00
2YMUA 3K27A 2IAAA 2H47A 2TRCB 4J84A 5SXMA 3EI3B 4CZYA 2AGZA 3AFCA 3V5WB 4O1QD 5GSAA 3PSLA 3EI1A 4FWWA 3CIKB 3OKWA 1JMXB 4J78A 3KRXB 4A11B 1VYHC 5FQDA 4GGAA 3RN1D 3I8CA 5K1CC 4CY1A 1GP2B 5EARA 3UVMA 3UR4A 3P4FA 4GQ1A 3SBRA 2AGWA 2CNXA 3I7LA 4PXWA 2IUVA 4AOWA 2AQ5A 3MMYA 2YNNA 1OMWB 4CC9A 2UZXB 2P9LC 3DM0A 3V7DB 1R5MA 4CI2A 4E54A 3SN6B 2HKRA 4FA1D 4Y7RA 4CI3A 1XHMA 3CFSB 2QC5A 3C9CA 4I79A 2OVQB 4ZOVA 2H6KA 4A09A 5IGOA 3ZWLB 1PI6A 3W15A 4PNKB 1FWXA 3UVNA 3EI2B 3IIYA 2IUQA 4MK0B 2Z2OA 5IC7A 3F3GA 4K3ID 3JAMg 1XIPA 3IIWA 3I7HA 3GFCA 2HJBA 5H17A 2H13A 4R7AB 4ERZA 3EI4B 4Z8LA 1NR0A 2PM9A 5IGQA 1JMZB 4O3UB 3GREA 2PM6B 3I7OA 3PXSD 2H68A 4GQBB 3J81g 5HE0B 3I7NA 2P9SC 3OL2B 1PGUA 2H14A 4X61B 4E5ZA 4L3GD 2H6NA 5CXBA 5AMSA 2CO0C 3PSCB 1XKSA 2XYIA 3ORVD 3HFQA 2YNOA 4QQEA 2OIZA 3I89A 3F3FA 4J82A 3J80g 1U2VC 3NVQA 4O3TB 5I5IA 3UKRC 2W18A 4OWRA 1P22A 2IWKA 3EI3A 5EALA 3SFZA 4XYHA 4PSXB 3UVKA 4X63B 4JSNC 4CZVA 4FA9D 4UI9R 3SXTD 3UKUC 1PEVA 1GXRA 5GMKn 4LGNA 2P9UC 5FA5B 4JSPC 4U7AA 2B5MA 5TF2A 5B4WA 4A11A 4A7JA 2OVRB 5FKQA 4ZOZA 2H9MA 2IWFA 4GZ8A 4A2MA 2IURA 3IJ0A 4ZN4A 1Q47A 2EBSA 4JSXC 3SWSD 5FLXg 2P9KC 4O45A 5AJAA 4FAND 4O9DA 3MXXA 1ERJA 3UVOA 3ODTA 5KDOB 4ERYA 2BBKH 3RRMC 3B7FA 5FKTA 3PXTD 2H6QA 1S4UX 4IMMA 1K8KC 2YNPA 3MKSB 3UVLA 4PBYA 2AGXA 4EWRA 3RSEC 4J8GA 2H9LA 5HE1B 5EMKB 2B5LA 1MDAH 4U1EI 4A0AB 3EI2A 5CXCB 5FKSA 4Y5RD 5TDHB 4A08B 3C75H 3AL9A 2OK4A 3DWLC 4X60B 4J0XA 5HE2B 2P9PC 5IJ7E 5HQGA 1N6EA 4N14A 1JJUB 4JSVC 3JPXA 2H9PA 3RN0D 3EI4A 3BG1A 3SCYA 3SBQA 2GNQA 3RLMD 4D6VA 3N0EA 5FXYA 4J81A 4L9OA 2AGYA 3VGZA 5IT9g 4PC0A 4G56B 4A0BB 2OJYA 2J57G 3AL8A 2CN2A 5HYNB 4JT6C 2H3XA 2PBIB 1JOFA 1YFQA 4GM3A 3OL2A 3BWSA 5EMLB 4J73A 5C9ZB 2QXVA 1OLZA 3OKYB 1N6FA 2MTAH 5TEEA 4FB1D 4GGCA 3F3PA 2OK6A 5EAMA 3I2NA 3EG6A 2YB8B 2AGLA 4J8BA 4JT5C 4QL1A 2CE8A 1SHYB 3FRXA 4OZUA 4QRJA 5EMJB 4J79A 4BUJC 1B9YA 2YBAA 4KFMB 2J56H 3RFHA 4L1QD 2G99A 2H9NA 3V9FA 3SJLD 3I7PA 4JD2C 2Z2PA 5A2Qg 1RI6A 5EM2B 3I7KA 4X3EA 3PVWB 3FM0A 2HYEA 4QT8A 4GGDA 3JROA 4E5ZB 2CE9A 3DXKC 4A2LA 4CI1A 5HE3B 1MG2A 4FAVD 1PBYB 4FA5D 3L4OD 3C5MA 5CYKB 3U4YA 4GMBA 2P9IC 4L3HD 3OTTA 2BCJB 3PXWD 3DSMA 4BH6A 4J86A 3A0FA 5IJ8E 3IJCA 3E0CA 5GXHA 2UZYB 1TBGA 4A0AA 4FHLA 2AH0A 5CXCA 3PVUB 2HJ4A 4A08A 3EI1B 5GXIA 3MZLA 4XYIA 3NVNA 2GC4A 2XU7A 4XEIC 4CY2A 4J0WA 4IA9A 5I5JA 4K3JB 4YVDA 3FGBA 2HESX 5H14A 5C2VB 3CFVA 2O9KA 2AH1A 5I5MA 3BG0A 4LG9A 4BL0A 4CI8A 3SLED 2P9NC 5K19A 1A0RB 1QNIA 1U4CA 4PBZA 3SVWD 2B5NA 3PE7A 2CO0A 4D0KA 4A0BA 2HKMA 4CY3A 1N6DA 2B4EA 1MG3A 4H5IA 3JZNA 3RFGA 4E54B 4CY5A 5FKRA 1NEXB 3NVXA 3EU7A 4ZOXA 5JWZA 1GOTB 3N0DA 3OKYA 3K26A 4HDJA 4A09B 2I0SA 3SMRA 3OKTA 1K32A 2XL3A 2CN3A 4ERQA 4GQ2P 3SBPA 3EWEA 4H5JA 3JB9L 1GG2B 5EMMB 4NSXA 3JZGA 1L0QA 4LG8A 4JXMA 4AEZA 3VH0A 3IKOA 4J77A 2I0RA 2I3TA 5EM2A 3OW8A 4J87A 2HXCA 3JZHA 5THAA 3KRWB 3AL8B 3SHFA 2PM9B 3DXMC 3RMZD 1TYQC 5TEFA 2G9AA 5EAPA 1B9XA 5C2WB 1SQ9A 2J55H 4TZ4A 3VA6A 4ES0A 2I3SA 2OVPB 2I0TA 2GC7A 5AFU3 3JRPA 4GM9A 1SQJA 4PSWB 5CXBB 3C99A 2IUPA 3ULEC 3MKQA 4ESGA 4GM8A 3EMHA 5H1MA 5CYKA 2PM7B 3I8EA 3L4MD 4ZOYA 2XL2A 4CZXA 3IJ1A 3AH8B 4FA4D 2Q7QA 3MZKA 2Z2NA
chains in the Genus database with same CATH superfamily
2YMUA 3K27A 2IAAA 2EIEA 2H47A 2TRCB 4J84A 5SXMA 3EI3B 4CZYA 3T3MA 2AGZA 3AFCA 3V5WB 3KCIA 4AN1A 4O1QD 1A12A 5GSAA 3PSLA 3EI1A 4FWWA 3CIKB 3OKWA 1JMXB 4J78A 4NAAA 3KRXB 4A11B 1VYHC 5FQDA 4GGAA 3RN1D 3I8CA 4Z7QA 4Z7OA 5K1CC 4CY1A 1GP2B 4DNWA 5EARA 3O4GA 3UVMA 3UR4A 3P4FA 4GQ1A 3SBRA 5M5SA 2AGWA 4NC4A 2CNXA 3FCUA 1U8CA 3I7LA 4AN0A 5M5VA 3IJEA 4PXWA 2IUVA 4AOWA 3MUOA 2AQ5A 2XDWA 3MMYA 2YNNA 1OMWB 4CC9A 4WK2A 2BKLA 2UZXB 2P9LC 3DM0A 3V7DB 1R5MA 4CI2A 4E54A 3SN6B 2HKRA 4FA1D 4Y7RA 4CI3A 1XHMA 3K6SA 3CFSB 2QC5A 3C9CA 4I79A 3V4VA 2OVQB 4ZOVA 2H6KA 4A09A 1YR2A 5IGOA 3ZWLB 1PI6A 3W15A 4PNKB 1FWXA 3UVNA 3ZDYA 3EI2B 1H2ZA 3IIYA 2IUQA 4MK0B 2Z2OA 5IC7A 3F3GA 3O4HA 3DDUA 2VC2A 4K3ID 3JAMg 1XIPA 3IIWA 3IURA 3I7HA 3GFCA 2HJBA 5H17A 1JTDB 4BP9A 2H13A 4R7AB 4RE5A 4ERZA 3EI4B 4Z8LA 1O6FA 1NR0A 3ZE1A 2PM9A 2QR5A 3IVMA 4AX4A 5IGQA 1JMZB 4O3UB 4JHPC 3GREA 3K71A 2PM6B 3I7OA 3PXSD 2H68A 4GQBB 1C9IA 3J81g 5HE0B 3I7NA 2P9SC 2VDNA 3OL2B 2VDRA 1PGUA 4JHNA 2H14A 1H2WA 3O4IA 3T3PA 4X61B 4E5ZA 4L3GD 2H6NA 5CXBA 5AMSA 2CO0C 3PSCB 1XKSA 2XYIA 3ORVD 4MMXA 3HFQA 2YNOA 4QQEA 2OIZA 3I89A 3F3FA 4J82A 4WJKA 3GC3B 3J80g 1E5TA 1U2VC 4MMZA 3NVQA 3NIDA 4O3TB 5I5IA 3UKRC 2W18A 4OWRA 1GOHA 2HU8A 1L5GA 1P22A 2IWKA 3EI3A 5EALA 3SFZA 4XYHA 4PSXB 3UVKA 4X63B 4JSNC 4CZVA 4FA9D 4UI9R 3SXTD 3UKUC 1PEVA 1GXRA 5GMKn 4LGNA 2P9UC 5FA5B 4JSPC 4O02A 4U7AA 2B5MA 2VZ3A 5TF2A 5B4WA 4A11A 4A7JA 2OVRB 5FKQA 4ZOZA 2H9MA 2IWFA 4GZ8A 4A2MA 2IURA 1JV2A 2EIBA 3IJ0A 4ZN4A 1Q47A 2EBSA 2HU7A 4BCBA 2WQ8A 4JSXC 3SWSD 5FLXg 2P9KC 4O45A 4WK0A 5AJAA 2EICA 4FAND 4O9DA 3MVDK 3IUJA 3MXXA 1ERJA 3UVOA 3ZDZA 3ODTA 5KDOB 1T2XA 4ERYA 2BBKH 3MUNA 3RRMC 3B7FA 5FKTA 3PXTD 2H6QA 1S4UX 4NENA 5FFGA 4IMMA 1K8KC 4G55A 1O6GA 2YNPA 3MKSB 4G1EA 3UVLA 4PBYA 2AGXA 4EWRA 3RSEC 4J8GA 2H9LA 5HE1B 5EMKB 2B5LA 1MDAH 4U1EI 4A0AB 3EI2A 1VZ2A 5CXCB 5FKSA 4Y5RD 5TDHB 4A08B 3C75H 3AL9A 5HDBA 2OK4A 3DWLC 5E6SA 5M5TA 4X60B 4J0XA 5HE2B 2P9PC 5IJ7E 5HQGA 1N6EA 4N14A 1JJUB 4UM8A 4JSVC 3JPXA 2H9PA 4IRZA 5C86A 3RN0D 3V4PA 3GD1I 3EI4A 4L1MA 3BG1A 3SCYA 2JKXA 3SBQA 2GNQA 3RLMD 4D6VA 3N0EA 5FXYA 4J81A 4L9OA 2AGYA 3VGZA 5IT9g 4PC0A 5E6UA 4G56B 4A0BB 2OJYA 2J57G 5M5RA 3AL8A 2CN2A 1BPOA 5HYNB 4JT6C 2H3XA 3QI0A 2PBIB 1JOFA 1YFQA 4GM3A 3OL2A 2VDPA 3BWSA 5EMLB 4J73A 4BCDA 2QXVA 5C9ZB 3EQ7A 4O2WA 1OLZA 3K72A 1H2XA 3OKYB 1N6FA 2MTAH 5TEEA 4FB1D 4GGCA 3F3PA 2EIDA 2OK6A 5EAMA 1QFMA 3I2NA 3EG6A 2YB8B 2AGLA 2VDLA 4J8BA 4JT5C 2VDOA 4QL1A 2CE8A 1SHYB 3FRXA 4OZUA 4QRJA 5EMJB 4J79A 4BUJC 1B9YA 1H2YA 2YBAA 1TYEA 4KFMB 2J56H 3RFHA 3ZE2A 4L1QD 2G99A 2H9NA 3IULA 3V9FA 3SJLD 3I7PA 4JD2C 2Z2PA 5A2Qg 1RI6A 5EM2B 3I7KA 1E8NA 1UOPA 4X3EA 3PVWB 3FM0A 3IUQA 2HYEA 4QT8A 4GGDA 4AMYA 3JROA 1C9LA 1K3IA 4E5ZB 3VI3A 2CE9A 3DXKC 4A2LA 4CI1A 5HE3B 1MG2A 4FAVD 1PBYB 4FA5D 3L4OD 1VE6A 2VDMA 2XE4A 3C5MA 3ZE0A 5CYKB 3U4YA 4GMBA 1GOFA 2P9IC 4L3HD 3OTTA 2BCJB 3PXWD 5M5UA 3DSMA 5FFOA 4BH6A 4J86A 3A0FA 2QZPA 3ZDXA 5IJ8E 3IJCA 3E0CA 2VDQA 5GXHA 2UZYB 4MMYA 1TBGA 4A0AA 4FHLA 2AH0A 5CXCA 3PVUB 4WK4A 2HJ4A 4A08A 3EI1B 1UOQA 5GXIA 4AMZA 3MZLA 4XYIA 3NVNA 2GC4A 4QAMA 2XU7A 4XEIC 4CY2A 4J0WA 4IA9A 5I5JA 4K3JB 4YVDA 3FGBA 2HESX 5H14A 5C2VB 2VZ1A 3CFVA 2O9KA 2AH1A 4BP8A 5I5MA 5C92A 4RE6A 3BG0A 4LG9A 4BL0A 1UTCA 4CI8A 3SLED 2P9NC 5K19A 4UM9A 1A0RB 1QNIA 1VZ3A 1U4CA 4PBZA 3SVWD 2B5NA 1UOOA 3PE7A 2CO0A 4D0KA 2XZGA 4A0BA 2HKMA 5M61A 4CY3A 1N6DA 3IUMA 2B4EA 1MG3A 4H5IA 3JZNA 3RFGA 4E54B 4DNUA 4CY5A 5FKRA 2VDKA 1NEXB 4DNVA 3NVXA 3EU7A 4ZOXA 5JWZA 1GOTB 3N0DA 3OKYA 3K26A 3EQ8A 4HDJA 4A09B 2I0SA 3OF7A 3SMRA 3OKTA 1K32A 2XL3A 1M1XA 2CN3A 4ERQA 4GQ2P 3SBPA 5E6RA 3EWEA 4H5JA 3JB9L 1GG2B 1QFSA 5EMMB 4NSXA 3JZGA 1L0QA 4LG8A 4JXMA 4AEZA 3IUNA 3VH0A 3IKOA 3EQ9A 4J77A 1GOGA 3VI4A 2HU5A 2I0RA 2I3TA 3O4JA 5EM2A 1E8MA 3OW8A 4J87A 2HXCA 3JZHA 5THAA 3KRWB 1VE7A 3AL8B 3SHFA 2PM9B 3DXMC 3FCSA 4G1MA 3RMZD 1TYQC 4D9SA 5TEFA 2G9AA 5EAPA 1B9XA 4Z7NA 5C2WB 1SQ9A 2J55H 4TZ4A 3VA6A 4ES0A 2I3SA 2OVPB 4NBMA 2I0TA 2GC7A 5AFU3 3JRPA 4GM9A 1SQJA 4PSWB 4BCCA 5CXBB 3C99A 2IUPA 3ULEC 3MKQA 3QHYB 4ESGA 4GM8A 3EMHA 5H1MA 5CYKA 2PM7B 3I8EA 3L4MD 4ZOYA 3NIGA 2XL2A 4CZXA 1I2MB 3NIFA 3IJ1A 3AH8B 4FA4D 2Q7QA 3MZKA 2Z2NA
chains in the Genus database with same CATH topology
2YMUA 3K27A 2IAAA 2H47A 2TRCB 4J84A 5SXMA 3EI3B 4CZYA 2AGZA 3AFCA 3V5WB 4O1QD 5GSAA 3PSLA 3EI1A 4FWWA 3CIKB 3OKWA 1JMXB 4J78A 3KRXB 4A11B 1VYHC 5FQDA 4GGAA 3RN1D 3I8CA 5K1CC 4CY1A 1GP2B 5EARA 3UVMA 3UR4A 3P4FA 4GQ1A 3SBRA 2AGWA 2CNXA 3I7LA 4PXWA 2IUVA 4AOWA 2AQ5A 3MMYA 2YNNA 1OMWB 4CC9A 2UZXB 2P9LC 3DM0A 3V7DB 1R5MA 4CI2A 4E54A 3SN6B 2HKRA 4FA1D 4Y7RA 4CI3A 1XHMA 3CFSB 2QC5A 3C9CA 4I79A 2OVQB 4ZOVA 2H6KA 4A09A 5IGOA 3ZWLB 1PI6A 3W15A 4PNKB 1FWXA 3UVNA 3EI2B 3IIYA 2IUQA 4MK0B 2Z2OA 5IC7A 3F3GA 4K3ID 3JAMg 1XIPA 3IIWA 3I7HA 3GFCA 2HJBA 5H17A 2H13A 4R7AB 4ERZA 3EI4B 4Z8LA 1NR0A 2PM9A 5IGQA 1JMZB 4O3UB 3GREA 2PM6B 3I7OA 3PXSD 2H68A 4GQBB 3J81g 5HE0B 3I7NA 2P9SC 3OL2B 1PGUA 2H14A 4X61B 4E5ZA 4L3GD 2H6NA 5CXBA 5AMSA 2CO0C 3PSCB 1XKSA 2XYIA 3ORVD 3HFQA 2YNOA 4QQEA 2OIZA 3I89A 3F3FA 4J82A 3J80g 1U2VC 3NVQA 4O3TB 5I5IA 3UKRC 2W18A 4OWRA 1P22A 2IWKA 3EI3A 5EALA 3SFZA 4XYHA 4PSXB 3UVKA 4X63B 4JSNC 4CZVA 4FA9D 4UI9R 3SXTD 3UKUC 1PEVA 1GXRA 5GMKn 4LGNA 2P9UC 5FA5B 4JSPC 4U7AA 2B5MA 5TF2A 5B4WA 4A11A 4A7JA 2OVRB 5FKQA 4ZOZA 2H9MA 2IWFA 4GZ8A 4A2MA 2IURA 3IJ0A 4ZN4A 1Q47A 2EBSA 4JSXC 3SWSD 5FLXg 2P9KC 4O45A 5AJAA 4FAND 4O9DA 3MXXA 1ERJA 3UVOA 3ODTA 5KDOB 4ERYA 2BBKH 3RRMC 3B7FA 5FKTA 3PXTD 2H6QA 1S4UX 4IMMA 1K8KC 2YNPA 3MKSB 3UVLA 4PBYA 2AGXA 4EWRA 3RSEC 4J8GA 2H9LA 5HE1B 5EMKB 2B5LA 1MDAH 4U1EI 4A0AB 3EI2A 5CXCB 5FKSA 4Y5RD 5TDHB 4A08B 3C75H 3AL9A 2OK4A 3DWLC 4X60B 4J0XA 5HE2B 2P9PC 5IJ7E 5HQGA 1N6EA 4N14A 1JJUB 4JSVC 3JPXA 2H9PA 3RN0D 3EI4A 3BG1A 3SCYA 3SBQA 2GNQA 3RLMD 4D6VA 3N0EA 5FXYA 4J81A 4L9OA 2AGYA 3VGZA 5IT9g 4PC0A 4G56B 4A0BB 2OJYA 2J57G 3AL8A 2CN2A 5HYNB 4JT6C 2H3XA 2PBIB 1JOFA 1YFQA 4GM3A 3OL2A 3BWSA 5EMLB 4J73A 5C9ZB 2QXVA 1OLZA 3OKYB 1N6FA 2MTAH 5TEEA 4FB1D 4GGCA 3F3PA 2OK6A 5EAMA 3I2NA 3EG6A 2YB8B 2AGLA 4J8BA 4JT5C 4QL1A 2CE8A 1SHYB 3FRXA 4OZUA 4QRJA 5EMJB 4J79A 4BUJC 1B9YA 2YBAA 4KFMB 2J56H 3RFHA 4L1QD 2G99A 2H9NA 3V9FA 3SJLD 3I7PA 4JD2C 2Z2PA 5A2Qg 1RI6A 5EM2B 3I7KA 4X3EA 3PVWB 3FM0A 2HYEA 4QT8A 4GGDA 3JROA 4E5ZB 2CE9A 3DXKC 4A2LA 4CI1A 5HE3B 1MG2A 4FAVD 1PBYB 4FA5D 3L4OD 3C5MA 5CYKB 3U4YA 4GMBA 2P9IC 4L3HD 3OTTA 2BCJB 3PXWD 3DSMA 4BH6A 4J86A 3A0FA 5IJ8E 3IJCA 3E0CA 5GXHA 2UZYB 1TBGA 4A0AA 4FHLA 2AH0A 5CXCA 3PVUB 2HJ4A 4A08A 3EI1B 5GXIA 3MZLA 4XYIA 3NVNA 2GC4A 2XU7A 4XEIC 4CY2A 4J0WA 4IA9A 5I5JA 4K3JB 4YVDA 3FGBA 2HESX 5H14A 5C2VB 3CFVA 2O9KA 2AH1A 5I5MA 3BG0A 4LG9A 4BL0A 4CI8A 3SLED 2P9NC 5K19A 1A0RB 1QNIA 1U4CA 4PBZA 3SVWD 2B5NA 3PE7A 2CO0A 4D0KA 4A0BA 2HKMA 4CY3A 1N6DA 2B4EA 1MG3A 4H5IA 3JZNA 3RFGA 4E54B 4CY5A 5FKRA 1NEXB 3NVXA 3EU7A 4ZOXA 5JWZA 1GOTB 3N0DA 3OKYA 3K26A 4HDJA 4A09B 2I0SA 3SMRA 3OKTA 1K32A 2XL3A 2CN3A 4ERQA 4GQ2P 3SBPA 3EWEA 4H5JA 3JB9L 1GG2B 5EMMB 4NSXA 3JZGA 1L0QA 4LG8A 4JXMA 4AEZA 3VH0A 3IKOA 4J77A 2I0RA 2I3TA 5EM2A 3OW8A 4J87A 2HXCA 3JZHA 5THAA 3KRWB 3AL8B 3SHFA 2PM9B 3DXMC 3RMZD 1TYQC 5TEFA 2G9AA 5EAPA 1B9XA 5C2WB 1SQ9A 2J55H 4TZ4A 3VA6A 4ES0A 2I3SA 2OVPB 2I0TA 2GC7A 5AFU3 3JRPA 4GM9A 1SQJA 4PSWB 5CXBB 3C99A 2IUPA 3ULEC 3MKQA 4ESGA 4GM8A 3EMHA 5H1MA 5CYKA 2PM7B 3I8EA 3L4MD 4ZOYA 2XL2A 4CZXA 3IJ1A 3AH8B 4FA4D 2Q7QA 3MZKA 2Z2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMU A;  3K27 A;  2IAA A;  2H47 A;  2TRC B;  4J84 A;  5SXM A;  3EI3 B;  4CZY A;  2AGZ A;  3AFC A;  3V5W B;  4O1Q D;  5GSA A;  3PSL A;  3EI1 A;  4FWW A;  3CIK B;  3OKW A;  1JMX B;  4J78 A;  3KRX B;  4A11 B;  1VYH C;  5FQD A;  4GGA A;  3RN1 D;  3I8C A;  5K1C C;  4CY1 A;  1GP2 B;  5EAR A;  3UVM A;  3UR4 A;  3P4F A;  4GQ1 A;  3SBR A;  2AGW A;  2CNX A;  3I7L A;  4PXW A;  2IUV A;  4AOW A;  2AQ5 A;  3MMY A;  2YNN A;  1OMW B;  4CC9 A;  2UZX B;  2P9L C;  3DM0 A;  3V7D B;  1R5M A;  4CI2 A;  4E54 A;  3SN6 B;  2HKR A;  4FA1 D;  4Y7R A;  4CI3 A;  1XHM A;  3CFS B;  2QC5 A;  3C9C A;  4I79 A;  2OVQ B;  4ZOV A;  2H6K A;  4A09 A;  5IGO A;  3ZWL B;  1PI6 A;  3W15 A;  4PNK B;  1FWX A;  3UVN A;  3EI2 B;  3IIY A;  2IUQ A;  4MK0 B;  2Z2O A;  5IC7 A;  3F3G A;  4K3I D;  3JAM g;  1XIP A;  3IIW A;  3I7H A;  3GFC A;  2HJB A;  5H17 A;  2H13 A;  4R7A B;  4ERZ A;  3EI4 B;  4Z8L A;  1NR0 A;  2PM9 A;  5IGQ A;  1JMZ B;  4O3U B;  3GRE A;  2PM6 B;  3I7O A;  3PXS D;  2H68 A;  4GQB B;  3J81 g;  5HE0 B;  3I7N A;  2P9S C;  3OL2 B;  1PGU A;  2H14 A;  4X61 B;  4E5Z A;  4L3G D;  2H6N A;  5CXB A;  5AMS A;  2CO0 C;  3PSC B;  1XKS A;  2XYI A;  3ORV D;  3HFQ A;  2YNO A;  4QQE A;  2OIZ A;  3I89 A;  3F3F A;  4J82 A;  3J80 g;  1U2V C;  3NVQ A;  4O3T B;  5I5I A;  3UKR C;  2W18 A;  4OWR A;  1P22 A;  2IWK A;  3EI3 A;  5EAL A;  3SFZ A;  4XYH A;  4PSX B;  3UVK A;  4X63 B;  4JSN C;  4CZV A;  4FA9 D;  4UI9 R;  3SXT D;  3UKU C;  1PEV A;  1GXR A;  5GMK n;  4LGN A;  2P9U C;  5FA5 B;  4JSP C;  4U7A A;  2B5M A;  5TF2 A;  5B4W A;  4A11 A;  4A7J A;  2OVR B;  5FKQ A;  4ZOZ A;  2H9M A;  2IWF A;  4GZ8 A;  4A2M A;  2IUR A;  3IJ0 A;  4ZN4 A;  1Q47 A;  2EBS A;  4JSX C;  3SWS D;  5FLX g;  2P9K C;  4O45 A;  5AJA A;  4FAN D;  4O9D A;  3MXX A;  1ERJ A;  3UVO A;  3ODT A;  5KDO B;  4ERY A;  2BBK H;  3RRM C;  3B7F A;  5FKT A;  3PXT D;  2H6Q A;  1S4U X;  4IMM A;  1K8K C;  2YNP A;  3MKS B;  3UVL A;  4PBY A;  2AGX A;  4EWR A;  3RSE C;  4J8G A;  2H9L A;  5HE1 B;  5EMK B;  2B5L A;  1MDA H;  4U1E I;  4A0A B;  3EI2 A;  5CXC B;  5FKS A;  4Y5R D;  5TDH B;  4A08 B;  3C75 H;  3AL9 A;  2OK4 A;  3DWL C;  4X60 B;  4J0X A;  5HE2 B;  2P9P C;  5IJ7 E;  5HQG A;  1N6E A;  4N14 A;  1JJU B;  4JSV C;  3JPX A;  2H9P A;  3RN0 D;  3EI4 A;  3BG1 A;  3SCY A;  3SBQ A;  2GNQ A;  3RLM D;  4D6V A;  3N0E A;  5FXY A;  4J81 A;  4L9O A;  2AGY A;  3VGZ A;  5IT9 g;  4PC0 A;  4G56 B;  4A0B B;  2OJY A;  2J57 G;  3AL8 A;  2CN2 A;  5HYN B;  4JT6 C;  2H3X A;  2PBI B;  1JOF A;  1YFQ A;  4GM3 A;  3OL2 A;  3BWS A;  5EML B;  4J73 A;  5C9Z B;  2QXV A;  1OLZ A;  3OKY B;  1N6F A;  2MTA H;  5TEE A;  4FB1 D;  4GGC A;  3F3P A;  2OK6 A;  5EAM A;  3I2N A;  3EG6 A;  2YB8 B;  2AGL A;  4J8B A;  4JT5 C;  4QL1 A;  2CE8 A;  1SHY B;  3FRX A;  4OZU A;  4QRJ A;  5EMJ B;  4J79 A;  4BUJ C;  1B9Y A;  2YBA A;  4KFM B;  2J56 H;  3RFH A;  4L1Q D;  2G99 A;  2H9N A;  3V9F A;  3SJL D;  3I7P A;  4JD2 C;  2Z2P A;  5A2Q g;  1RI6 A;  5EM2 B;  3I7K A;  4X3E A;  3PVW B;  3FM0 A;  2HYE A;  4QT8 A;  4GGD A;  3JRO A;  4E5Z B;  2CE9 A;  3DXK C;  4A2L A;  4CI1 A;  5HE3 B;  1MG2 A;  4FAV D;  1PBY B;  4FA5 D;  3L4O D;  3C5M A;  5CYK B;  3U4Y A;  4GMB A;  2P9I C;  4L3H D;  3OTT A;  2BCJ B;  3PXW D;  3DSM A;  4BH6 A;  4J86 A;  3A0F A;  5IJ8 E;  3IJC A;  3E0C A;  5GXH A;  2UZY B;  1TBG A;  4A0A A;  4FHL A;  2AH0 A;  5CXC A;  3PVU B;  2HJ4 A;  4A08 A;  3EI1 B;  5GXI A;  3MZL A;  4XYI A;  3NVN A;  2GC4 A;  2XU7 A;  4XEI C;  4CY2 A;  4J0W A;  4IA9 A;  5I5J A;  4K3J B;  4YVD A;  3FGB A;  2HES X;  5H14 A;  5C2V B;  3CFV A;  2O9K A;  2AH1 A;  5I5M A;  3BG0 A;  4LG9 A;  4BL0 A;  4CI8 A;  3SLE D;  2P9N C;  5K19 A;  1A0R B;  1QNI A;  1U4C A;  4PBZ A;  3SVW D;  2B5N A;  3PE7 A;  2CO0 A;  4D0K A;  4A0B A;  2HKM A;  4CY3 A;  1N6D A;  2B4E A;  1MG3 A;  4H5I A;  3JZN A;  3RFG A;  4E54 B;  4CY5 A;  5FKR A;  1NEX B;  3NVX A;  3EU7 A;  4ZOX A;  5JWZ A;  1GOT B;  3N0D A;  3OKY A;  3K26 A;  4HDJ A;  4A09 B;  2I0S A;  3SMR A;  3OKT A;  1K32 A;  2XL3 A;  2CN3 A;  4ERQ A;  4GQ2 P;  3SBP A;  3EWE A;  4H5J A;  3JB9 L;  1GG2 B;  5EMM B;  4NSX A;  3JZG A;  1L0Q A;  4LG8 A;  4JXM A;  4AEZ A;  3VH0 A;  3IKO A;  4J77 A;  2I0R A;  2I3T A;  5EM2 A;  3OW8 A;  4J87 A;  2HXC A;  3JZH A;  5THA A;  3KRW B;  3AL8 B;  3SHF A;  2PM9 B;  3DXM C;  3RMZ D;  1TYQ C;  5TEF A;  2G9A A;  5EAP A;  1B9X A;  5C2W B;  1SQ9 A;  2J55 H;  4TZ4 A;  3VA6 A;  4ES0 A;  2I3S A;  2OVP B;  2I0T A;  2GC7 A;  5AFU 3;  3JRP A;  4GM9 A;  1SQJ A;  4PSW B;  5CXB B;  3C99 A;  2IUP A;  3ULE C;  3MKQ A;  4ESG A;  4GM8 A;  3EMH A;  5H1M A;  5CYK A;  2PM7 B;  3I8E A;  3L4M D;  4ZOY A;  2XL2 A;  4CZX A;  3IJ1 A;  3AH8 B;  4FA4 D;  2Q7Q A;  3MZK A;  2Z2N A; 
#chains in the Genus database with same CATH topology
 2YMU A;  3K27 A;  2IAA A;  2EIE A;  2H47 A;  2TRC B;  4J84 A;  5SXM A;  3EI3 B;  4CZY A;  3T3M A;  2AGZ A;  3AFC A;  3V5W B;  3KCI A;  4AN1 A;  4O1Q D;  1A12 A;  5GSA A;  3PSL A;  3EI1 A;  4FWW A;  3CIK B;  3OKW A;  1JMX B;  4J78 A;  4NAA A;  3KRX B;  4A11 B;  1VYH C;  5FQD A;  4GGA A;  3RN1 D;  3I8C A;  4Z7Q A;  4Z7O A;  5K1C C;  4CY1 A;  1GP2 B;  4DNW A;  5EAR A;  3O4G A;  3UVM A;  3UR4 A;  3P4F A;  4GQ1 A;  3SBR A;  5M5S A;  2AGW A;  4NC4 A;  2CNX A;  3FCU A;  1U8C A;  3I7L A;  4AN0 A;  5M5V A;  3IJE A;  4PXW A;  2IUV A;  4AOW A;  3MUO A;  2AQ5 A;  2XDW A;  3MMY A;  2YNN A;  1OMW B;  4CC9 A;  4WK2 A;  2BKL A;  2UZX B;  2P9L C;  3DM0 A;  3V7D B;  1R5M A;  4CI2 A;  4E54 A;  3SN6 B;  2HKR A;  4FA1 D;  4Y7R A;  4CI3 A;  1XHM A;  3K6S A;  3CFS B;  2QC5 A;  3C9C A;  4I79 A;  3V4V A;  2OVQ B;  4ZOV A;  2H6K A;  4A09 A;  1YR2 A;  5IGO A;  3ZWL B;  1PI6 A;  3W15 A;  4PNK B;  1FWX A;  3UVN A;  3ZDY A;  3EI2 B;  1H2Z A;  3IIY A;  2IUQ A;  4MK0 B;  2Z2O A;  5IC7 A;  3F3G A;  3O4H A;  3DDU A;  2VC2 A;  4K3I D;  3JAM g;  1XIP A;  3IIW A;  3IUR A;  3I7H A;  3GFC A;  2HJB A;  5H17 A;  1JTD B;  4BP9 A;  2H13 A;  4R7A B;  4RE5 A;  4ERZ A;  3EI4 B;  4Z8L A;  1O6F A;  1NR0 A;  3ZE1 A;  2PM9 A;  2QR5 A;  3IVM A;  4AX4 A;  5IGQ A;  1JMZ B;  4O3U B;  4JHP C;  3GRE A;  3K71 A;  2PM6 B;  3I7O A;  3PXS D;  2H68 A;  4GQB B;  1C9I A;  3J81 g;  5HE0 B;  3I7N A;  2P9S C;  2VDN A;  3OL2 B;  2VDR A;  1PGU A;  4JHN A;  2H14 A;  1H2W A;  3O4I A;  3T3P A;  4X61 B;  4E5Z A;  4L3G D;  2H6N A;  5CXB A;  5AMS A;  2CO0 C;  3PSC B;  1XKS A;  2XYI A;  3ORV D;  4MMX A;  3HFQ A;  2YNO A;  4QQE A;  2OIZ A;  3I89 A;  3F3F A;  4J82 A;  4WJK A;  3GC3 B;  3J80 g;  1E5T A;  1U2V C;  4MMZ A;  3NVQ A;  3NID A;  4O3T B;  5I5I A;  3UKR C;  2W18 A;  4OWR A;  1GOH A;  2HU8 A;  1L5G A;  1P22 A;  2IWK A;  3EI3 A;  5EAL A;  3SFZ A;  4XYH A;  4PSX B;  3UVK A;  4X63 B;  4JSN C;  4CZV A;  4FA9 D;  4UI9 R;  3SXT D;  3UKU C;  1PEV A;  1GXR A;  5GMK n;  4LGN A;  2P9U C;  5FA5 B;  4JSP C;  4O02 A;  4U7A A;  2B5M A;  2VZ3 A;  5TF2 A;  5B4W A;  4A11 A;  4A7J A;  2OVR B;  5FKQ A;  4ZOZ A;  2H9M A;  2IWF A;  4GZ8 A;  4A2M A;  2IUR A;  1JV2 A;  2EIB A;  3IJ0 A;  4ZN4 A;  1Q47 A;  2EBS A;  2HU7 A;  4BCB A;  2WQ8 A;  4JSX C;  3SWS D;  5FLX g;  2P9K C;  4O45 A;  4WK0 A;  5AJA A;  2EIC A;  4FAN D;  4O9D A;  3MVD K;  3IUJ A;  3MXX A;  1ERJ A;  3UVO A;  3ZDZ A;  3ODT A;  5KDO B;  1T2X A;  4ERY A;  2BBK H;  3MUN A;  3RRM C;  3B7F A;  5FKT A;  3PXT D;  2H6Q A;  1S4U X;  4NEN A;  5FFG A;  4IMM A;  1K8K C;  4G55 A;  1O6G A;  2YNP A;  3MKS B;  4G1E A;  3UVL A;  4PBY A;  2AGX A;  4EWR A;  3RSE C;  4J8G A;  2H9L A;  5HE1 B;  5EMK B;  2B5L A;  1MDA H;  4U1E I;  4A0A B;  3EI2 A;  1VZ2 A;  5CXC B;  5FKS A;  4Y5R D;  5TDH B;  4A08 B;  3C75 H;  3AL9 A;  5HDB A;  2OK4 A;  3DWL C;  5E6S A;  5M5T A;  4X60 B;  4J0X A;  5HE2 B;  2P9P C;  5IJ7 E;  5HQG A;  1N6E A;  4N14 A;  1JJU B;  4UM8 A;  4JSV C;  3JPX A;  2H9P A;  4IRZ A;  5C86 A;  3RN0 D;  3V4P A;  3GD1 I;  3EI4 A;  4L1M A;  3BG1 A;  3SCY A;  2JKX A;  3SBQ A;  2GNQ A;  3RLM D;  4D6V A;  3N0E A;  5FXY A;  4J81 A;  4L9O A;  2AGY A;  3VGZ A;  5IT9 g;  4PC0 A;  5E6U A;  4G56 B;  4A0B B;  2OJY A;  2J57 G;  5M5R A;  3AL8 A;  2CN2 A;  1BPO A;  5HYN B;  4JT6 C;  2H3X A;  3QI0 A;  2PBI B;  1JOF A;  1YFQ A;  4GM3 A;  3OL2 A;  2VDP A;  3BWS A;  5EML B;  4J73 A;  4BCD A;  2QXV A;  5C9Z B;  3EQ7 A;  4O2W A;  1OLZ A;  3K72 A;  1H2X A;  3OKY B;  1N6F A;  2MTA H;  5TEE A;  4FB1 D;  4GGC A;  3F3P A;  2EID A;  2OK6 A;  5EAM A;  1QFM A;  3I2N A;  3EG6 A;  2YB8 B;  2AGL A;  2VDL A;  4J8B A;  4JT5 C;  2VDO A;  4QL1 A;  2CE8 A;  1SHY B;  3FRX A;  4OZU A;  4QRJ A;  5EMJ B;  4J79 A;  4BUJ C;  1B9Y A;  1H2Y A;  2YBA A;  1TYE A;  4KFM B;  2J56 H;  3RFH A;  3ZE2 A;  4L1Q D;  2G99 A;  2H9N A;  3IUL A;  3V9F A;  3SJL D;  3I7P A;  4JD2 C;  2Z2P A;  5A2Q g;  1RI6 A;  5EM2 B;  3I7K A;  1E8N A;  1UOP A;  4X3E A;  3PVW B;  3FM0 A;  3IUQ A;  2HYE A;  4QT8 A;  4GGD A;  4AMY A;  3JRO A;  1C9L A;  1K3I A;  4E5Z B;  3VI3 A;  2CE9 A;  3DXK C;  4A2L A;  4CI1 A;  5HE3 B;  1MG2 A;  4FAV D;  1PBY B;  4FA5 D;  3L4O D;  1VE6 A;  2VDM A;  2XE4 A;  3C5M A;  3ZE0 A;  5CYK B;  3U4Y A;  4GMB A;  1GOF A;  2P9I C;  4L3H D;  3OTT A;  2BCJ B;  3PXW D;  5M5U A;  3DSM A;  5FFO A;  4BH6 A;  4J86 A;  3A0F A;  2QZP A;  3ZDX A;  5IJ8 E;  3IJC A;  3E0C A;  2VDQ A;  5GXH A;  2UZY B;  4MMY A;  1TBG A;  4A0A A;  4FHL A;  2AH0 A;  5CXC A;  3PVU B;  4WK4 A;  2HJ4 A;  4A08 A;  3EI1 B;  1UOQ A;  5GXI A;  4AMZ A;  3MZL A;  4XYI A;  3NVN A;  2GC4 A;  4QAM A;  2XU7 A;  4XEI C;  4CY2 A;  4J0W A;  4IA9 A;  5I5J A;  4K3J B;  4YVD A;  3FGB A;  2HES X;  5H14 A;  5C2V B;  2VZ1 A;  3CFV A;  2O9K A;  2AH1 A;  4BP8 A;  5I5M A;  5C92 A;  4RE6 A;  3BG0 A;  4LG9 A;  4BL0 A;  1UTC A;  4CI8 A;  3SLE D;  2P9N C;  5K19 A;  4UM9 A;  1A0R B;  1QNI A;  1VZ3 A;  1U4C A;  4PBZ A;  3SVW D;  2B5N A;  1UOO A;  3PE7 A;  2CO0 A;  4D0K A;  2XZG A;  4A0B A;  2HKM A;  5M61 A;  4CY3 A;  1N6D A;  3IUM A;  2B4E A;  1MG3 A;  4H5I A;  3JZN A;  3RFG A;  4E54 B;  4DNU A;  4CY5 A;  5FKR A;  2VDK A;  1NEX B;  4DNV A;  3NVX A;  3EU7 A;  4ZOX A;  5JWZ A;  1GOT B;  3N0D A;  3OKY A;  3K26 A;  3EQ8 A;  4HDJ A;  4A09 B;  2I0S A;  3OF7 A;  3SMR A;  3OKT A;  1K32 A;  2XL3 A;  1M1X A;  2CN3 A;  4ERQ A;  4GQ2 P;  3SBP A;  5E6R A;  3EWE A;  4H5J A;  3JB9 L;  1GG2 B;  1QFS A;  5EMM B;  4NSX A;  3JZG A;  1L0Q A;  4LG8 A;  4JXM A;  4AEZ A;  3IUN A;  3VH0 A;  3IKO A;  3EQ9 A;  4J77 A;  1GOG A;  3VI4 A;  2HU5 A;  2I0R A;  2I3T A;  3O4J A;  5EM2 A;  1E8M A;  3OW8 A;  4J87 A;  2HXC A;  3JZH A;  5THA A;  3KRW B;  1VE7 A;  3AL8 B;  3SHF A;  2PM9 B;  3DXM C;  3FCS A;  4G1M A;  3RMZ D;  1TYQ C;  4D9S A;  5TEF A;  2G9A A;  5EAP A;  1B9X A;  4Z7N A;  5C2W B;  1SQ9 A;  2J55 H;  4TZ4 A;  3VA6 A;  4ES0 A;  2I3S A;  2OVP B;  4NBM A;  2I0T A;  2GC7 A;  5AFU 3;  3JRP A;  4GM9 A;  1SQJ A;  4PSW B;  4BCC A;  5CXB B;  3C99 A;  2IUP A;  3ULE C;  3MKQ A;  3QHY B;  4ESG A;  4GM8 A;  3EMH A;  5H1M A;  5CYK A;  2PM7 B;  3I8E A;  3L4M D;  4ZOY A;  3NIG A;  2XL2 A;  4CZX A;  1I2M B;  3NIF A;  3IJ1 A;  3AH8 B;  4FA4 D;  2Q7Q A;  3MZK A;  2Z2N A; 
#chains in the Genus database with same CATH homology
 2YMU A;  3K27 A;  2IAA A;  2H47 A;  2TRC B;  4J84 A;  5SXM A;  3EI3 B;  4CZY A;  2AGZ A;  3AFC A;  3V5W B;  4O1Q D;  5GSA A;  3PSL A;  3EI1 A;  4FWW A;  3CIK B;  3OKW A;  1JMX B;  4J78 A;  3KRX B;  4A11 B;  1VYH C;  5FQD A;  4GGA A;  3RN1 D;  3I8C A;  5K1C C;  4CY1 A;  1GP2 B;  5EAR A;  3UVM A;  3UR4 A;  3P4F A;  4GQ1 A;  3SBR A;  2AGW A;  2CNX A;  3I7L A;  4PXW A;  2IUV A;  4AOW A;  2AQ5 A;  3MMY A;  2YNN A;  1OMW B;  4CC9 A;  2UZX B;  2P9L C;  3DM0 A;  3V7D B;  1R5M A;  4CI2 A;  4E54 A;  3SN6 B;  2HKR A;  4FA1 D;  4Y7R A;  4CI3 A;  1XHM A;  3CFS B;  2QC5 A;  3C9C A;  4I79 A;  2OVQ B;  4ZOV A;  2H6K A;  4A09 A;  5IGO A;  3ZWL B;  1PI6 A;  3W15 A;  4PNK B;  1FWX A;  3UVN A;  3EI2 B;  3IIY A;  2IUQ A;  4MK0 B;  2Z2O A;  5IC7 A;  3F3G A;  4K3I D;  3JAM g;  1XIP A;  3IIW A;  3I7H A;  3GFC A;  2HJB A;  5H17 A;  2H13 A;  4R7A B;  4ERZ A;  3EI4 B;  4Z8L A;  1NR0 A;  2PM9 A;  5IGQ A;  1JMZ B;  4O3U B;  3GRE A;  2PM6 B;  3I7O A;  3PXS D;  2H68 A;  4GQB B;  3J81 g;  5HE0 B;  3I7N A;  2P9S C;  3OL2 B;  1PGU A;  2H14 A;  4X61 B;  4E5Z A;  4L3G D;  2H6N A;  5CXB A;  5AMS A;  2CO0 C;  3PSC B;  1XKS A;  2XYI A;  3ORV D;  3HFQ A;  2YNO A;  4QQE A;  2OIZ A;  3I89 A;  3F3F A;  4J82 A;  3J80 g;  1U2V C;  3NVQ A;  4O3T B;  5I5I A;  3UKR C;  2W18 A;  4OWR A;  1P22 A;  2IWK A;  3EI3 A;  5EAL A;  3SFZ A;  4XYH A;  4PSX B;  3UVK A;  4X63 B;  4JSN C;  4CZV A;  4FA9 D;  4UI9 R;  3SXT D;  3UKU C;  1PEV A;  1GXR A;  5GMK n;  4LGN A;  2P9U C;  5FA5 B;  4JSP C;  4U7A A;  2B5M A;  5TF2 A;  5B4W A;  4A11 A;  4A7J A;  2OVR B;  5FKQ A;  4ZOZ A;  2H9M A;  2IWF A;  4GZ8 A;  4A2M A;  2IUR A;  3IJ0 A;  4ZN4 A;  1Q47 A;  2EBS A;  4JSX C;  3SWS D;  5FLX g;  2P9K C;  4O45 A;  5AJA A;  4FAN D;  4O9D A;  3MXX A;  1ERJ A;  3UVO A;  3ODT A;  5KDO B;  4ERY A;  2BBK H;  3RRM C;  3B7F A;  5FKT A;  3PXT D;  2H6Q A;  1S4U X;  4IMM A;  1K8K C;  2YNP A;  3MKS B;  3UVL A;  4PBY A;  2AGX A;  4EWR A;  3RSE C;  4J8G A;  2H9L A;  5HE1 B;  5EMK B;  2B5L A;  1MDA H;  4U1E I;  4A0A B;  3EI2 A;  5CXC B;  5FKS A;  4Y5R D;  5TDH B;  4A08 B;  3C75 H;  3AL9 A;  2OK4 A;  3DWL C;  4X60 B;  4J0X A;  5HE2 B;  2P9P C;  5IJ7 E;  5HQG A;  1N6E A;  4N14 A;  1JJU B;  4JSV C;  3JPX A;  2H9P A;  3RN0 D;  3EI4 A;  3BG1 A;  3SCY A;  3SBQ A;  2GNQ A;  3RLM D;  4D6V A;  3N0E A;  5FXY A;  4J81 A;  4L9O A;  2AGY A;  3VGZ A;  5IT9 g;  4PC0 A;  4G56 B;  4A0B B;  2OJY A;  2J57 G;  3AL8 A;  2CN2 A;  5HYN B;  4JT6 C;  2H3X A;  2PBI B;  1JOF A;  1YFQ A;  4GM3 A;  3OL2 A;  3BWS A;  5EML B;  4J73 A;  5C9Z B;  2QXV A;  1OLZ A;  3OKY B;  1N6F A;  2MTA H;  5TEE A;  4FB1 D;  4GGC A;  3F3P A;  2OK6 A;  5EAM A;  3I2N A;  3EG6 A;  2YB8 B;  2AGL A;  4J8B A;  4JT5 C;  4QL1 A;  2CE8 A;  1SHY B;  3FRX A;  4OZU A;  4QRJ A;  5EMJ B;  4J79 A;  4BUJ C;  1B9Y A;  2YBA A;  4KFM B;  2J56 H;  3RFH A;  4L1Q D;  2G99 A;  2H9N A;  3V9F A;  3SJL D;  3I7P A;  4JD2 C;  2Z2P A;  5A2Q g;  1RI6 A;  5EM2 B;  3I7K A;  4X3E A;  3PVW B;  3FM0 A;  2HYE A;  4QT8 A;  4GGD A;  3JRO A;  4E5Z B;  2CE9 A;  3DXK C;  4A2L A;  4CI1 A;  5HE3 B;  1MG2 A;  4FAV D;  1PBY B;  4FA5 D;  3L4O D;  3C5M A;  5CYK B;  3U4Y A;  4GMB A;  2P9I C;  4L3H D;  3OTT A;  2BCJ B;  3PXW D;  3DSM A;  4BH6 A;  4J86 A;  3A0F A;  5IJ8 E;  3IJC A;  3E0C A;  5GXH A;  2UZY B;  1TBG A;  4A0A A;  4FHL A;  2AH0 A;  5CXC A;  3PVU B;  2HJ4 A;  4A08 A;  3EI1 B;  5GXI A;  3MZL A;  4XYI A;  3NVN A;  2GC4 A;  2XU7 A;  4XEI C;  4CY2 A;  4J0W A;  4IA9 A;  5I5J A;  4K3J B;  4YVD A;  3FGB A;  2HES X;  5H14 A;  5C2V B;  3CFV A;  2O9K A;  2AH1 A;  5I5M A;  3BG0 A;  4LG9 A;  4BL0 A;  4CI8 A;  3SLE D;  2P9N C;  5K19 A;  1A0R B;  1QNI A;  1U4C A;  4PBZ A;  3SVW D;  2B5N A;  3PE7 A;  2CO0 A;  4D0K A;  4A0B A;  2HKM A;  4CY3 A;  1N6D A;  2B4E A;  1MG3 A;  4H5I A;  3JZN A;  3RFG A;  4E54 B;  4CY5 A;  5FKR A;  1NEX B;  3NVX A;  3EU7 A;  4ZOX A;  5JWZ A;  1GOT B;  3N0D A;  3OKY A;  3K26 A;  4HDJ A;  4A09 B;  2I0S A;  3SMR A;  3OKT A;  1K32 A;  2XL3 A;  2CN3 A;  4ERQ A;  4GQ2 P;  3SBP A;  3EWE A;  4H5J A;  3JB9 L;  1GG2 B;  5EMM B;  4NSX A;  3JZG A;  1L0Q A;  4LG8 A;  4JXM A;  4AEZ A;  3VH0 A;  3IKO A;  4J77 A;  2I0R A;  2I3T A;  5EM2 A;  3OW8 A;  4J87 A;  2HXC A;  3JZH A;  5THA A;  3KRW B;  3AL8 B;  3SHF A;  2PM9 B;  3DXM C;  3RMZ D;  1TYQ C;  5TEF A;  2G9A A;  5EAP A;  1B9X A;  5C2W B;  1SQ9 A;  2J55 H;  4TZ4 A;  3VA6 A;  4ES0 A;  2I3S A;  2OVP B;  2I0T A;  2GC7 A;  5AFU 3;  3JRP A;  4GM9 A;  1SQJ A;  4PSW B;  5CXB B;  3C99 A;  2IUP A;  3ULE C;  3MKQ A;  4ESG A;  4GM8 A;  3EMH A;  5H1M A;  5CYK A;  2PM7 B;  3I8E A;  3L4M D;  4ZOY A;  2XL2 A;  4CZX A;  3IJ1 A;  3AH8 B;  4FA4 D;  2Q7Q A;  3MZK A;  2Z2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...