4ERYA

X-ray structure of wdr5-mll3 win motif peptide binary complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transferase
molecule keywords WD repeat-containing protein 5
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4eryA00
3P4FA 3AL9A 3FGBA 3NVXA 5I5MA 2YBAA 2BCJB 4N14A 2YNPA 4A2LA 4E5ZA 4D0KA 4O9DA 4CY2A 3JAMg 2AGZA 3EI2B 2H47A 2IUQA 5IJ8E 2IWKA 2YB8B 5CXBA 4LGNA 3MZKA 3EI4A 4GGDA 5HE2B 1JJUB 5C2VB 3FRXA 2J57G 1NR0A 5AFU3 5CYKB 4BL0A 5EAPA 5K19A 3E0CA 5FLXg 2P9SC 5EAMA 3BWSA 4CZVA 2OVPB 1A0RB 3JZNA 3MMYA 4LG9A 4L1QD 2PM9B 5FA5B 3I7OA 1K8KC 2AH0A 3AL8B 1GXRA 3DXMC 1B9XA 2OVRB 4J79A 2GNQA 3OL2B 4X3EA 4A08A 4IMMA 3SXTD 4A0BB 3UVMA 5IC7A 5EMJB 5EALA 3SBPA 4BUJC 4E54B 5IGOA 4A09A 3MZLA 4K3ID 5CXCA 4J82A 5KDOB 4CY1A 2P9NC 3SBQA 3RMZD 4PC0A 1PI6A 2P9PC 2XU7A 2HYEA 5EMLB 4A0AB 3DXKC 4X61B 3RSEC 3OTTA 3F3PA 4YVDA 3L4OD 3V9FA 3JROA 4ERYA 5TDHB 2OVQB 4CZXA 2CN3A 3UKUC 2H3XA 4JSXC 1Q47A 2H14A 4IA9A 3IKOA 1RI6A 3I7KA 3IIYA 4L9OA 2HJ4A 4J8BA 3I2NA 4HDJA 2H9PA 2Z2OA 3CFSB 2CE9A 3U4YA 5IGQA 4GQ1A 5TEEA 3KRWB 4EWRA 4Z8LA 3PE7A 4AEZA 4J0XA 3I7HA 3OW8A 4OZUA 4ESGA 3EI1A 3EI3B 3GFCA 3K26A 4QQEA 2CNXA 4GQ2P 4MK0B 3C99A 5HE3B 3NVNA 3ODTA 1SHYB 2Z2NA 4ZOVA 3VA6A 2H9LA 4JSPC 4L3HD 4A11B 3N0EA 3SMRA 3CFVA 4PBZA 2OK4A 2Q7QA 4BH6A 4QL1A 4X63B 3DM0A 3AFCA 2IUPA 5TF2A 5GXIA 2J55H 2P9LC 3VH0A 4JSNC 3OKYA 4JT6C 3UVNA 2G9AA 1QNIA 4K3JB 2I3TA 4FA4D 4E5ZB 4GQBB 3ZWLB 2AGLA 3SFZA 3I7LA 4FA5D 5EM2A 1YFQA 5HE0B 5JWZA 2I0RA 4CI2A 4CI8A 1SQ9A 3N0DA 5EMMB 3FM0A 1XHMA 3J81g 1MDAH 4JSVC 4FA1D 3UKRC 3SN6B 1R5MA 1N6EA 5B4WA 2UZYB 5CXBB 1VYHC 4PSWB 3V5WB 2BBKH 3KRXB 4U1EI 3EI4B 4FAND 4ERZA 3SHFA 2HKMA 3VGZA 3IJ1A 1U4CA 2PM6B 5AMSA 2G99A 4QT8A 3JRPA 2HJBA 3JB9L 5THAA 1L0QA 5C2WB 2AGWA 5I5JA 4FB1D 4A08B 4J77A 2CN2A 3DSMA 4FA9D 4JD2C 2GC7A 3SLED 2HXCA 3SVWD 3OKWA 4A09B 3PVUB 3C75H 5CXCB 5IJ7E 2XL3A 4XYHA 3RLMD 1SQJA 2CE8A 4J87A 3UVKA 4CZYA 2I0TA 4KFMB 4JT5C 1JMZB 3HFQA 1XKSA 5FXYA 4J84A 2P9IC 3F3GA 4PNKB 4J78A 3SBRA 3MXXA 4H5JA 2B5MA 3RFGA 3OKTA 4ZOXA 1MG3A 4Y5RD 4GGCA 2YMUA 3RRMC 4QRJA 5H17A 3I7NA 2PBIB 4XEIC 2XYIA 3F3FA 4O3UB 5FQDA 2EBSA 4ES0A 5C9ZB 3I8CA 5AJAA 1TBGA 3BG0A 3A0FA 3MKQA 3I7PA 4CY3A 1OLZA 2H6QA 4GGAA 2I0SA 3UVLA 3AH8B 2IURA 3SJLD 3PXWD 1GOTB 4ZOZA 1P22A 3EI1B 3CIKB 1S4UX 2YNNA 3SCYA 4OWRA 4XYIA 5A2Qg 3ULEC 4Y7RA 4H5IA 2I3SA 2TRCB 4NSXA 2OK6A 2P9KC 4PXWA 2H9MA 5SXMA 2CO0C 4FAVD 2HESX 5HQGA 5FKQA 3B7FA 5TEFA 2W18A 3EI2A 4GM9A 4GM8A 1N6FA 2GC4A 4GM3A 2QC5A 5GXHA 4FHLA 2OJYA 4D6VA 1ERJA 4O1QD 5GMKn 5FKRA 3OKYB 1PBYB 2Z2PA 4J86A 2OIZA 3ORVD 5CYKA 3PXSD 5IT9g 4CI1A 5EM2B 5K1CC 2YNOA 3C9CA 3PSLA 4O45A 2H68A 4I79A 3EWEA 4LG8A 4ZN4A 2PM9A 2IUVA 3L4MD 2O9KA 1FWXA 3MKSB 3AL8A 1XIPA 4A2MA 2B5NA 1MG2A 3OL2A 4CY5A 2IWFA 4A0BA 5EARA 2UZXB 4J8GA 3EG6A 4GZ8A 2H9NA 4E54A 1B9YA 4G56B 3NVQA 2H6KA 5I5IA 1PGUA 2H6NA 1JMXB 2P9UC 4J73A 1NEXB 4A0AA 3J80g 4CI3A 4PBYA 3EMHA 5FKTA 4J0WA 4R7AB 2AGYA 1N6DA 4FWWA 4CC9A 5FKSA 4JXMA 3DWLC 3EU7A 3K27A 1GG2B 5HYNB 4U7AA 4TZ4A 3V7DB 3UR4A 2J56H 4ERQA 2CO0A 1PEVA 2AH1A 2H13A 4L3GD 3JPXA 3IJCA 2MTAH 3RFHA 2B5LA 1OMWB 1K32A 5HE1B 4UI9R 3RN0D 3PSCB 3EI3A 1TYQC 3RN1D 2B4EA 3UVOA 2AGXA 3W15A 4PSXB 3JZGA 3C5MA 5H1MA 4X60B 1U2VC 2PM7B 2AQ5A 3BG1A 4A11A 4ZOYA 2XL2A 3IJ0A 3SWSD 4GMBA 4A7JA 3I8EA 3I89A 2HKRA 4O3TB 4J81A 1GP2B 2QXVA 1JOFA 5EMKB 4AOWA 3PVWB 2IAAA 3GREA 3IIWA 3JZHA 3PXTD 5GSAA 5H14A
chains in the Genus database with same CATH superfamily
3P4FA 3AL9A 3FGBA 3NVXA 5I5MA 2YBAA 4AMZA 2BCJB 4N14A 2YNPA 4A2LA 2XE4A 4E5ZA 4D0KA 4O9DA 2VDKA 4CY2A 4D9SA 3JAMg 2AGZA 1GOGA 4NAAA 3EI2B 2H47A 2IUQA 5IJ8E 1VE6A 2IWKA 3V4VA 2YB8B 5CXBA 4LGNA 3MZKA 3EI4A 4GGDA 5HE2B 1JJUB 5C2VB 3FRXA 2J57G 1NR0A 5AFU3 3KCIA 3ZE0A 5M5SA 5CYKB 4BL0A 5EAPA 5K19A 3E0CA 5FLXg 4BP8A 2P9SC 5EAMA 3BWSA 1YR2A 2OVPB 4CZVA 1A0RB 4MMXA 3JZNA 3MMYA 4LG9A 2VC2A 4L1QD 2PM9B 5FA5B 3FCUA 3I7OA 1K8KC 2AH0A 3AL8B 1GXRA 3DXMC 1B9XA 2OVRB 4WK2A 4J79A 2GNQA 3OL2B 4X3EA 4A08A 1H2YA 4IMMA 3SXTD 4A0BB 3UVMA 5IC7A 5EMJB 5EALA 3SBPA 4BUJC 4E54B 5IGOA 4A09A 3MZLA 4K3ID 5CXCA 4J82A 5KDOB 4CY1A 2P9NC 3NIGA 3SBQA 4IRZA 3RMZD 4PC0A 1PI6A 2P9PC 2XU7A 2HYEA 5EMLB 4A0AB 3DXKC 4X61B 3RSEC 3OTTA 3F3PA 2HU5A 3L4OD 4YVDA 3V9FA 3JROA 2VZ3A 4ERYA 2VDLA 5TDHB 2OVQB 4CZXA 2CN3A 1C9LA 3UKUC 2H3XA 4JSXC 1Q47A 2JKXA 4Z7OA 2H14A 4IA9A 4BCBA 3IKOA 1RI6A 3I7KA 3IIYA 2HJ4A 4J8BA 3I2NA 4L9OA 4HDJA 4NBMA 4RE5A 2H9PA 3O4IA 2Z2OA 3CFSB 2CE9A 3U4YA 5IGQA 4GQ1A 5TEEA 3KRWB 4EWRA 4Z8LA 3PE7A 3IURA 4AEZA 1I2MB 4J0XA 5HDBA 3I7HA 3OW8A 4OZUA 4ESGA 3EI1A 3EI3B 3MUOA 5C92A 3IVMA 3GFCA 3K26A 4QQEA 2CNXA 4GQ2P 4MK0B 3C99A 5HE3B 3NVNA 3ODTA 1SHYB 2Z2NA 4ZOVA 5M5TA 3VA6A 2H9LA 4MMYA 4JSPC 3O4JA 3QHYB 4L3HD 4A11B 3N0EA 2VDQA 3SMRA 1TYEA 1VZ3A 3CFVA 3IUMA 1H2XA 4PBZA 3IUJA 2OK4A 2Q7QA 4L1MA 4BH6A 4QL1A 4X63B 3DM0A 4BCCA 3AFCA 2IUPA 5TF2A 5GXIA 2J55H 2P9LC 3VH0A 3MVDK 4JSNC 3OKYA 4JT6C 3V4PA 3UVNA 5FFGA 2G9AA 1QNIA 1H2WA 4K3JB 2I3TA 4FA4D 4E5ZB 4GQBB 3ZDXA 3ZWLB 2AGLA 3SFZA 3I7LA 5C86A 4FA5D 5EM2A 1YFQA 5HE0B 5JWZA 1VZ2A 2I0RA 4CI2A 4CI8A 1SQ9A 3N0DA 3ZDZA 4BCDA 5EMMB 3FM0A 1XHMA 3J81g 1MDAH 4JSVC 4FA1D 3UKRC 3SN6B 1R5MA 1N6EA 5B4WA 2UZYB 5CXBB 1VYHC 4PSWB 3V5WB 2QR5A 2BBKH 3EQ8A 2VDMA 3EI4B 3KRXB 4U1EI 4Z7NA 4FAND 4ERZA 3SHFA 2HKMA 3VGZA 2WQ8A 2VDNA 3IJ1A 1T2XA 1U4CA 2PM6B 5AMSA 2G99A 4QT8A 2QZPA 3JRPA 2HJBA 4MMZA 3JB9L 4AMYA 5THAA 1L0QA 3ZE1A 1O6GA 3K6SA 5C2WB 3OF7A 2AGWA 5I5JA 4FB1D 4A08B 4J77A 5M5UA 2CN2A 3DSMA 4FA9D 4Z7QA 4JD2C 2GC7A 3SLED 5E6UA 2HXCA 3SVWD 1K3IA 3OKWA 4A09B 3PVUB 3C75H 5CXCB 4AN0A 5IJ7E 2XL3A 4XYHA 3RLMD 2EICA 1SQJA 2CE8A 4J87A 3UVKA 4CZYA 2VZ1A 2I0TA 4KFMB 4JT5C 1JMZB 3HFQA 1XKSA 1U8CA 5FXYA 4J84A 2P9IC 3F3GA 1L5GA 4PNKB 4J78A 3SBRA 3MXXA 4H5JA 2B5MA 3RFGA 3OKTA 4ZOXA 1MG3A 3IUNA 5M61A 4Y5RD 4GGCA 2YMUA 3RRMC 4QRJA 5H17A 3I7NA 2PBIB 4XEIC 2BKLA 2XYIA 3F3FA 4O3UB 5FQDA 2EBSA 4ES0A 3DDUA 4G1MA 3VI3A 1JTDB 3ZE2A 5C9ZB 3I8CA 5AJAA 1TBGA 3BG0A 1C9IA 3A0FA 3MKQA 3I7PA 4UM8A 4CY3A 1OLZA 2H6QA 4GGAA 2I0SA 2VDOA 3UVLA 3AH8B 3VI4A 2IURA 3SJLD 4AN1A 3PXWD 1GOTB 4ZOZA 1P22A 3EI1B 3CIKB 1S4UX 2YNNA 3SCYA 4OWRA 4G55A 4XYIA 5A2Qg 3K71A 3ULEC 4Y7RA 1UOPA 4H5IA 2I3SA 1JV2A 2TRCB 4NSXA 4WJKA 1O6FA 2OK6A 2P9KC 4PXWA 2H9MA 5SXMA 2CO0C 5M5VA 4G1EA 4FAVD 2HESX 4NENA 5HQGA 5FKQA 1BPOA 3B7FA 2W18A 5TEFA 3EI2A 1UOQA 4GM9A 4GM8A 1N6FA 2GC4A 4GM3A 2QC5A 4NC4A 2EIEA 5GXHA 1E8MA 4FHLA 2OJYA 1UOOA 4D6VA 1ERJA 4O1QD 5GMKn 4WK0A 4BP9A 5FKRA 3OKYB 1PBYB 2Z2PA 4J86A 2OIZA 3ORVD 5CYKA 3PXSD 2VDRA 5IT9g 4CI1A 1A12A 4JHPC 5EM2B 1QFMA 5K1CC 2YNOA 3C9CA 3IULA 3PSLA 4O45A 2XDWA 4O2WA 2H68A 4I79A 3NIFA 3EWEA 4LG8A 4ZN4A 2PM9A 2IUVA 3L4MD 2O9KA 1FWXA 3MKSB 3AL8A 1XIPA 4A2MA 2B5NA 1MG2A 3OL2A 4CY5A 2IWFA 4A0BA 5EARA 2UZXB 4J8GA 4AX4A 5M5RA 3EG6A 2VDPA 4GZ8A 2H9NA 4DNVA 4E54A 1B9YA 4G56B 1E8NA 4O02A 3NVQA 1GOHA 2H6KA 2EIDA 5I5IA 1PGUA 2H6NA 3O4HA 1JMXB 2P9UC 5E6SA 4J73A 1NEXB 4A0AA 3J80g 3EQ9A 5E6RA 4WK4A 4CI3A 4PBYA 3EMHA 5FKTA 4DNUA 3MUNA 4J0WA 2XZGA 2AGYA 1N6DA 4R7AB 4FWWA 3IUQA 3ZDYA 4CC9A 5FKSA 4DNWA 4JXMA 3DWLC 3EU7A 3K27A 1GG2B 4RE6A 5HYNB 4U7AA 3O4GA 4TZ4A 3V7DB 3UR4A 1VE7A 3T3MA 2J56H 4ERQA 4UM9A 2CO0A 1PEVA 2AH1A 2H13A 4L3GD 5FFOA 3JPXA 3IJCA 4QAMA 2MTAH 3FCSA 3RFHA 2B5LA 1OMWB 1GOFA 1K32A 4UI9R 5HE1B 3PSCB 3RN0D 3EI3A 2HU7A 1TYQC 1M1XA 3RN1D 2B4EA 3UVOA 2AGXA 3W15A 3GC3B 4PSXB 4JHNA 3JZGA 2HU8A 3K72A 3C5MA 5H1MA 4X60B 1U2VC 2PM7B 2AQ5A 3BG1A 4A11A 4ZOYA 2XL2A 3IJ0A 3SWSD 4GMBA 4A7JA 3I8EA 3I89A 3QI0A 2HKRA 4O3TB 4J81A 1GP2B 2QXVA 1JOFA 1UTCA 2EIBA 1H2ZA 1E5TA 5EMKB 3T3PA 4AOWA 3IJEA 3NIDA 1QFSA 2IAAA 3PVWB 3GREA 3GD1I 3IIWA 3JZHA 3PXTD 3EQ7A 5GSAA 5H14A
chains in the Genus database with same CATH topology
3P4FA 3AL9A 3FGBA 3NVXA 5I5MA 2YBAA 2BCJB 4N14A 2YNPA 4A2LA 4E5ZA 4D0KA 4O9DA 4CY2A 3JAMg 2AGZA 3EI2B 2H47A 2IUQA 5IJ8E 2IWKA 2YB8B 5CXBA 4LGNA 3MZKA 3EI4A 4GGDA 5HE2B 1JJUB 5C2VB 3FRXA 2J57G 1NR0A 5AFU3 5CYKB 4BL0A 5EAPA 5K19A 3E0CA 5FLXg 2P9SC 5EAMA 3BWSA 4CZVA 2OVPB 1A0RB 3JZNA 3MMYA 4LG9A 4L1QD 2PM9B 5FA5B 3I7OA 1K8KC 2AH0A 3AL8B 1GXRA 3DXMC 1B9XA 2OVRB 4J79A 2GNQA 3OL2B 4X3EA 4A08A 4IMMA 3SXTD 4A0BB 3UVMA 5IC7A 5EMJB 5EALA 3SBPA 4BUJC 4E54B 5IGOA 4A09A 3MZLA 4K3ID 5CXCA 4J82A 5KDOB 4CY1A 2P9NC 3SBQA 3RMZD 4PC0A 1PI6A 2P9PC 2XU7A 2HYEA 5EMLB 4A0AB 3DXKC 4X61B 3RSEC 3OTTA 3F3PA 4YVDA 3L4OD 3V9FA 3JROA 4ERYA 5TDHB 2OVQB 4CZXA 2CN3A 3UKUC 2H3XA 4JSXC 1Q47A 2H14A 4IA9A 3IKOA 1RI6A 3I7KA 3IIYA 4L9OA 2HJ4A 4J8BA 3I2NA 4HDJA 2H9PA 2Z2OA 3CFSB 2CE9A 3U4YA 5IGQA 4GQ1A 5TEEA 3KRWB 4EWRA 4Z8LA 3PE7A 4AEZA 4J0XA 3I7HA 3OW8A 4OZUA 4ESGA 3EI1A 3EI3B 3GFCA 3K26A 4QQEA 2CNXA 4GQ2P 4MK0B 3C99A 5HE3B 3NVNA 3ODTA 1SHYB 2Z2NA 4ZOVA 3VA6A 2H9LA 4JSPC 4L3HD 4A11B 3N0EA 3SMRA 3CFVA 4PBZA 2OK4A 2Q7QA 4BH6A 4QL1A 4X63B 3DM0A 3AFCA 2IUPA 5TF2A 5GXIA 2J55H 2P9LC 3VH0A 4JSNC 3OKYA 4JT6C 3UVNA 2G9AA 1QNIA 4K3JB 2I3TA 4FA4D 4E5ZB 4GQBB 3ZWLB 2AGLA 3SFZA 3I7LA 4FA5D 5EM2A 1YFQA 5HE0B 5JWZA 2I0RA 4CI2A 4CI8A 1SQ9A 3N0DA 5EMMB 3FM0A 1XHMA 3J81g 1MDAH 4JSVC 4FA1D 3UKRC 3SN6B 1R5MA 1N6EA 5B4WA 2UZYB 5CXBB 1VYHC 4PSWB 3V5WB 2BBKH 3KRXB 4U1EI 3EI4B 4FAND 4ERZA 3SHFA 2HKMA 3VGZA 3IJ1A 1U4CA 2PM6B 5AMSA 2G99A 4QT8A 3JRPA 2HJBA 3JB9L 5THAA 1L0QA 5C2WB 2AGWA 5I5JA 4FB1D 4A08B 4J77A 2CN2A 3DSMA 4FA9D 4JD2C 2GC7A 3SLED 2HXCA 3SVWD 3OKWA 4A09B 3PVUB 3C75H 5CXCB 5IJ7E 2XL3A 4XYHA 3RLMD 1SQJA 2CE8A 4J87A 3UVKA 4CZYA 2I0TA 4KFMB 4JT5C 1JMZB 3HFQA 1XKSA 5FXYA 4J84A 2P9IC 3F3GA 4PNKB 4J78A 3SBRA 3MXXA 4H5JA 2B5MA 3RFGA 3OKTA 4ZOXA 1MG3A 4Y5RD 4GGCA 2YMUA 3RRMC 4QRJA 5H17A 3I7NA 2PBIB 4XEIC 2XYIA 3F3FA 4O3UB 5FQDA 2EBSA 4ES0A 5C9ZB 3I8CA 5AJAA 1TBGA 3BG0A 3A0FA 3MKQA 3I7PA 4CY3A 1OLZA 2H6QA 4GGAA 2I0SA 3UVLA 3AH8B 2IURA 3SJLD 3PXWD 1GOTB 4ZOZA 1P22A 3EI1B 3CIKB 1S4UX 2YNNA 3SCYA 4OWRA 4XYIA 5A2Qg 3ULEC 4Y7RA 4H5IA 2I3SA 2TRCB 4NSXA 2OK6A 2P9KC 4PXWA 2H9MA 5SXMA 2CO0C 4FAVD 2HESX 5HQGA 5FKQA 3B7FA 5TEFA 2W18A 3EI2A 4GM9A 4GM8A 1N6FA 2GC4A 4GM3A 2QC5A 5GXHA 4FHLA 2OJYA 4D6VA 1ERJA 4O1QD 5GMKn 5FKRA 3OKYB 1PBYB 2Z2PA 4J86A 2OIZA 3ORVD 5CYKA 3PXSD 5IT9g 4CI1A 5EM2B 5K1CC 2YNOA 3C9CA 3PSLA 4O45A 2H68A 4I79A 3EWEA 4LG8A 4ZN4A 2PM9A 2IUVA 3L4MD 2O9KA 1FWXA 3MKSB 3AL8A 1XIPA 4A2MA 2B5NA 1MG2A 3OL2A 4CY5A 2IWFA 4A0BA 5EARA 2UZXB 4J8GA 3EG6A 4GZ8A 2H9NA 4E54A 1B9YA 4G56B 3NVQA 2H6KA 5I5IA 1PGUA 2H6NA 1JMXB 2P9UC 4J73A 1NEXB 4A0AA 3J80g 4CI3A 4PBYA 3EMHA 5FKTA 4J0WA 4R7AB 2AGYA 1N6DA 4FWWA 4CC9A 5FKSA 4JXMA 3DWLC 3EU7A 3K27A 1GG2B 5HYNB 4U7AA 4TZ4A 3V7DB 3UR4A 2J56H 4ERQA 2CO0A 1PEVA 2AH1A 2H13A 4L3GD 3JPXA 3IJCA 2MTAH 3RFHA 2B5LA 1OMWB 1K32A 5HE1B 4UI9R 3RN0D 3PSCB 3EI3A 1TYQC 3RN1D 2B4EA 3UVOA 2AGXA 3W15A 4PSXB 3JZGA 3C5MA 5H1MA 4X60B 1U2VC 2PM7B 2AQ5A 3BG1A 4A11A 4ZOYA 2XL2A 3IJ0A 3SWSD 4GMBA 4A7JA 3I8EA 3I89A 2HKRA 4O3TB 4J81A 1GP2B 2QXVA 1JOFA 5EMKB 4AOWA 3PVWB 2IAAA 3GREA 3IIWA 3JZHA 3PXTD 5GSAA 5H14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4F A;  3AL9 A;  3FGB A;  3NVX A;  5I5M A;  2YBA A;  2BCJ B;  4N14 A;  2YNP A;  4A2L A;  4E5Z A;  4D0K A;  4O9D A;  4CY2 A;  3JAM g;  2AGZ A;  3EI2 B;  2H47 A;  2IUQ A;  5IJ8 E;  2IWK A;  2YB8 B;  5CXB A;  4LGN A;  3MZK A;  3EI4 A;  4GGD A;  5HE2 B;  1JJU B;  5C2V B;  3FRX A;  2J57 G;  1NR0 A;  5AFU 3;  5CYK B;  4BL0 A;  5EAP A;  5K19 A;  3E0C A;  5FLX g;  2P9S C;  5EAM A;  3BWS A;  4CZV A;  2OVP B;  1A0R B;  3JZN A;  3MMY A;  4LG9 A;  4L1Q D;  2PM9 B;  5FA5 B;  3I7O A;  1K8K C;  2AH0 A;  3AL8 B;  1GXR A;  3DXM C;  1B9X A;  2OVR B;  4J79 A;  2GNQ A;  3OL2 B;  4X3E A;  4A08 A;  4IMM A;  3SXT D;  4A0B B;  3UVM A;  5IC7 A;  5EMJ B;  5EAL A;  3SBP A;  4BUJ C;  4E54 B;  5IGO A;  4A09 A;  3MZL A;  4K3I D;  5CXC A;  4J82 A;  5KDO B;  4CY1 A;  2P9N C;  3SBQ A;  3RMZ D;  4PC0 A;  1PI6 A;  2P9P C;  2XU7 A;  2HYE A;  5EML B;  4A0A B;  3DXK C;  4X61 B;  3RSE C;  3OTT A;  3F3P A;  4YVD A;  3L4O D;  3V9F A;  3JRO A;  4ERY A;  5TDH B;  2OVQ B;  4CZX A;  2CN3 A;  3UKU C;  2H3X A;  4JSX C;  1Q47 A;  2H14 A;  4IA9 A;  3IKO A;  1RI6 A;  3I7K A;  3IIY A;  4L9O A;  2HJ4 A;  4J8B A;  3I2N A;  4HDJ A;  2H9P A;  2Z2O A;  3CFS B;  2CE9 A;  3U4Y A;  5IGQ A;  4GQ1 A;  5TEE A;  3KRW B;  4EWR A;  4Z8L A;  3PE7 A;  4AEZ A;  4J0X A;  3I7H A;  3OW8 A;  4OZU A;  4ESG A;  3EI1 A;  3EI3 B;  3GFC A;  3K26 A;  4QQE A;  2CNX A;  4GQ2 P;  4MK0 B;  3C99 A;  5HE3 B;  3NVN A;  3ODT A;  1SHY B;  2Z2N A;  4ZOV A;  3VA6 A;  2H9L A;  4JSP C;  4L3H D;  4A11 B;  3N0E A;  3SMR A;  3CFV A;  4PBZ A;  2OK4 A;  2Q7Q A;  4BH6 A;  4QL1 A;  4X63 B;  3DM0 A;  3AFC A;  2IUP A;  5TF2 A;  5GXI A;  2J55 H;  2P9L C;  3VH0 A;  4JSN C;  3OKY A;  4JT6 C;  3UVN A;  2G9A A;  1QNI A;  4K3J B;  2I3T A;  4FA4 D;  4E5Z B;  4GQB B;  3ZWL B;  2AGL A;  3SFZ A;  3I7L A;  4FA5 D;  5EM2 A;  1YFQ A;  5HE0 B;  5JWZ A;  2I0R A;  4CI2 A;  4CI8 A;  1SQ9 A;  3N0D A;  5EMM B;  3FM0 A;  1XHM A;  3J81 g;  1MDA H;  4JSV C;  4FA1 D;  3UKR C;  3SN6 B;  1R5M A;  1N6E A;  5B4W A;  2UZY B;  5CXB B;  1VYH C;  4PSW B;  3V5W B;  2BBK H;  3KRX B;  4U1E I;  3EI4 B;  4FAN D;  4ERZ A;  3SHF A;  2HKM A;  3VGZ A;  3IJ1 A;  1U4C A;  2PM6 B;  5AMS A;  2G99 A;  4QT8 A;  3JRP A;  2HJB A;  3JB9 L;  5THA A;  1L0Q A;  5C2W B;  2AGW A;  5I5J A;  4FB1 D;  4A08 B;  4J77 A;  2CN2 A;  3DSM A;  4FA9 D;  4JD2 C;  2GC7 A;  3SLE D;  2HXC A;  3SVW D;  3OKW A;  4A09 B;  3PVU B;  3C75 H;  5CXC B;  5IJ7 E;  2XL3 A;  4XYH A;  3RLM D;  1SQJ A;  2CE8 A;  4J87 A;  3UVK A;  4CZY A;  2I0T A;  4KFM B;  4JT5 C;  1JMZ B;  3HFQ A;  1XKS A;  5FXY A;  4J84 A;  2P9I C;  3F3G A;  4PNK B;  4J78 A;  3SBR A;  3MXX A;  4H5J A;  2B5M A;  3RFG A;  3OKT A;  4ZOX A;  1MG3 A;  4Y5R D;  4GGC A;  2YMU A;  3RRM C;  4QRJ A;  5H17 A;  3I7N A;  2PBI B;  4XEI C;  2XYI A;  3F3F A;  4O3U B;  5FQD A;  2EBS A;  4ES0 A;  5C9Z B;  3I8C A;  5AJA A;  1TBG A;  3BG0 A;  3A0F A;  3MKQ A;  3I7P A;  4CY3 A;  1OLZ A;  2H6Q A;  4GGA A;  2I0S A;  3UVL A;  3AH8 B;  2IUR A;  3SJL D;  3PXW D;  1GOT B;  4ZOZ A;  1P22 A;  3EI1 B;  3CIK B;  1S4U X;  2YNN A;  3SCY A;  4OWR A;  4XYI A;  5A2Q g;  3ULE C;  4Y7R A;  4H5I A;  2I3S A;  2TRC B;  4NSX A;  2OK6 A;  2P9K C;  4PXW A;  2H9M A;  5SXM A;  2CO0 C;  4FAV D;  2HES X;  5HQG A;  5FKQ A;  3B7F A;  5TEF A;  2W18 A;  3EI2 A;  4GM9 A;  4GM8 A;  1N6F A;  2GC4 A;  4GM3 A;  2QC5 A;  5GXH A;  4FHL A;  2OJY A;  4D6V A;  1ERJ A;  4O1Q D;  5GMK n;  5FKR A;  3OKY B;  1PBY B;  2Z2P A;  4J86 A;  2OIZ A;  3ORV D;  5CYK A;  3PXS D;  5IT9 g;  4CI1 A;  5EM2 B;  5K1C C;  2YNO A;  3C9C A;  3PSL A;  4O45 A;  2H68 A;  4I79 A;  3EWE A;  4LG8 A;  4ZN4 A;  2PM9 A;  2IUV A;  3L4M D;  2O9K A;  1FWX A;  3MKS B;  3AL8 A;  1XIP A;  4A2M A;  2B5N A;  1MG2 A;  3OL2 A;  4CY5 A;  2IWF A;  4A0B A;  5EAR A;  2UZX B;  4J8G A;  3EG6 A;  4GZ8 A;  2H9N A;  4E54 A;  1B9Y A;  4G56 B;  3NVQ A;  2H6K A;  5I5I A;  1PGU A;  2H6N A;  1JMX B;  2P9U C;  4J73 A;  1NEX B;  4A0A A;  3J80 g;  4CI3 A;  4PBY A;  3EMH A;  5FKT A;  4J0W A;  4R7A B;  2AGY A;  1N6D A;  4FWW A;  4CC9 A;  5FKS A;  4JXM A;  3DWL C;  3EU7 A;  3K27 A;  1GG2 B;  5HYN B;  4U7A A;  4TZ4 A;  3V7D B;  3UR4 A;  2J56 H;  4ERQ A;  2CO0 A;  1PEV A;  2AH1 A;  2H13 A;  4L3G D;  3JPX A;  3IJC A;  2MTA H;  3RFH A;  2B5L A;  1OMW B;  1K32 A;  5HE1 B;  4UI9 R;  3RN0 D;  3PSC B;  3EI3 A;  1TYQ C;  3RN1 D;  2B4E A;  3UVO A;  2AGX A;  3W15 A;  4PSX B;  3JZG A;  3C5M A;  5H1M A;  4X60 B;  1U2V C;  2PM7 B;  2AQ5 A;  3BG1 A;  4A11 A;  4ZOY A;  2XL2 A;  3IJ0 A;  3SWS D;  4GMB A;  4A7J A;  3I8E A;  3I89 A;  2HKR A;  4O3T B;  4J81 A;  1GP2 B;  2QXV A;  1JOF A;  5EMK B;  4AOW A;  3PVW B;  2IAA A;  3GRE A;  3IIW A;  3JZH A;  3PXT D;  5GSA A;  5H14 A; 
#chains in the Genus database with same CATH topology
 3P4F A;  3AL9 A;  3FGB A;  3NVX A;  5I5M A;  2YBA A;  4AMZ A;  2BCJ B;  4N14 A;  2YNP A;  4A2L A;  2XE4 A;  4E5Z A;  4D0K A;  4O9D A;  2VDK A;  4CY2 A;  4D9S A;  3JAM g;  2AGZ A;  1GOG A;  4NAA A;  3EI2 B;  2H47 A;  2IUQ A;  5IJ8 E;  1VE6 A;  2IWK A;  3V4V A;  2YB8 B;  5CXB A;  4LGN A;  3MZK A;  3EI4 A;  4GGD A;  5HE2 B;  1JJU B;  5C2V B;  3FRX A;  2J57 G;  1NR0 A;  5AFU 3;  3KCI A;  3ZE0 A;  5M5S A;  5CYK B;  4BL0 A;  5EAP A;  5K19 A;  3E0C A;  5FLX g;  4BP8 A;  2P9S C;  5EAM A;  3BWS A;  1YR2 A;  2OVP B;  4CZV A;  1A0R B;  4MMX A;  3JZN A;  3MMY A;  4LG9 A;  2VC2 A;  4L1Q D;  2PM9 B;  5FA5 B;  3FCU A;  3I7O A;  1K8K C;  2AH0 A;  3AL8 B;  1GXR A;  3DXM C;  1B9X A;  2OVR B;  4WK2 A;  4J79 A;  2GNQ A;  3OL2 B;  4X3E A;  4A08 A;  1H2Y A;  4IMM A;  3SXT D;  4A0B B;  3UVM A;  5IC7 A;  5EMJ B;  5EAL A;  3SBP A;  4BUJ C;  4E54 B;  5IGO A;  4A09 A;  3MZL A;  4K3I D;  5CXC A;  4J82 A;  5KDO B;  4CY1 A;  2P9N C;  3NIG A;  3SBQ A;  4IRZ A;  3RMZ D;  4PC0 A;  1PI6 A;  2P9P C;  2XU7 A;  2HYE A;  5EML B;  4A0A B;  3DXK C;  4X61 B;  3RSE C;  3OTT A;  3F3P A;  2HU5 A;  3L4O D;  4YVD A;  3V9F A;  3JRO A;  2VZ3 A;  4ERY A;  2VDL A;  5TDH B;  2OVQ B;  4CZX A;  2CN3 A;  1C9L A;  3UKU C;  2H3X A;  4JSX C;  1Q47 A;  2JKX A;  4Z7O A;  2H14 A;  4IA9 A;  4BCB A;  3IKO A;  1RI6 A;  3I7K A;  3IIY A;  2HJ4 A;  4J8B A;  3I2N A;  4L9O A;  4HDJ A;  4NBM A;  4RE5 A;  2H9P A;  3O4I A;  2Z2O A;  3CFS B;  2CE9 A;  3U4Y A;  5IGQ A;  4GQ1 A;  5TEE A;  3KRW B;  4EWR A;  4Z8L A;  3PE7 A;  3IUR A;  4AEZ A;  1I2M B;  4J0X A;  5HDB A;  3I7H A;  3OW8 A;  4OZU A;  4ESG A;  3EI1 A;  3EI3 B;  3MUO A;  5C92 A;  3IVM A;  3GFC A;  3K26 A;  4QQE A;  2CNX A;  4GQ2 P;  4MK0 B;  3C99 A;  5HE3 B;  3NVN A;  3ODT A;  1SHY B;  2Z2N A;  4ZOV A;  5M5T A;  3VA6 A;  2H9L A;  4MMY A;  4JSP C;  3O4J A;  3QHY B;  4L3H D;  4A11 B;  3N0E A;  2VDQ A;  3SMR A;  1TYE A;  1VZ3 A;  3CFV A;  3IUM A;  1H2X A;  4PBZ A;  3IUJ A;  2OK4 A;  2Q7Q A;  4L1M A;  4BH6 A;  4QL1 A;  4X63 B;  3DM0 A;  4BCC A;  3AFC A;  2IUP A;  5TF2 A;  5GXI A;  2J55 H;  2P9L C;  3VH0 A;  3MVD K;  4JSN C;  3OKY A;  4JT6 C;  3V4P A;  3UVN A;  5FFG A;  2G9A A;  1QNI A;  1H2W A;  4K3J B;  2I3T A;  4FA4 D;  4E5Z B;  4GQB B;  3ZDX A;  3ZWL B;  2AGL A;  3SFZ A;  3I7L A;  5C86 A;  4FA5 D;  5EM2 A;  1YFQ A;  5HE0 B;  5JWZ A;  1VZ2 A;  2I0R A;  4CI2 A;  4CI8 A;  1SQ9 A;  3N0D A;  3ZDZ A;  4BCD A;  5EMM B;  3FM0 A;  1XHM A;  3J81 g;  1MDA H;  4JSV C;  4FA1 D;  3UKR C;  3SN6 B;  1R5M A;  1N6E A;  5B4W A;  2UZY B;  5CXB B;  1VYH C;  4PSW B;  3V5W B;  2QR5 A;  2BBK H;  3EQ8 A;  2VDM A;  3EI4 B;  3KRX B;  4U1E I;  4Z7N A;  4FAN D;  4ERZ A;  3SHF A;  2HKM A;  3VGZ A;  2WQ8 A;  2VDN A;  3IJ1 A;  1T2X A;  1U4C A;  2PM6 B;  5AMS A;  2G99 A;  4QT8 A;  2QZP A;  3JRP A;  2HJB A;  4MMZ A;  3JB9 L;  4AMY A;  5THA A;  1L0Q A;  3ZE1 A;  1O6G A;  3K6S A;  5C2W B;  3OF7 A;  2AGW A;  5I5J A;  4FB1 D;  4A08 B;  4J77 A;  5M5U A;  2CN2 A;  3DSM A;  4FA9 D;  4Z7Q A;  4JD2 C;  2GC7 A;  3SLE D;  5E6U A;  2HXC A;  3SVW D;  1K3I A;  3OKW A;  4A09 B;  3PVU B;  3C75 H;  5CXC B;  4AN0 A;  5IJ7 E;  2XL3 A;  4XYH A;  3RLM D;  2EIC A;  1SQJ A;  2CE8 A;  4J87 A;  3UVK A;  4CZY A;  2VZ1 A;  2I0T A;  4KFM B;  4JT5 C;  1JMZ B;  3HFQ A;  1XKS A;  1U8C A;  5FXY A;  4J84 A;  2P9I C;  3F3G A;  1L5G A;  4PNK B;  4J78 A;  3SBR A;  3MXX A;  4H5J A;  2B5M A;  3RFG A;  3OKT A;  4ZOX A;  1MG3 A;  3IUN A;  5M61 A;  4Y5R D;  4GGC A;  2YMU A;  3RRM C;  4QRJ A;  5H17 A;  3I7N A;  2PBI B;  4XEI C;  2BKL A;  2XYI A;  3F3F A;  4O3U B;  5FQD A;  2EBS A;  4ES0 A;  3DDU A;  4G1M A;  3VI3 A;  1JTD B;  3ZE2 A;  5C9Z B;  3I8C A;  5AJA A;  1TBG A;  3BG0 A;  1C9I A;  3A0F A;  3MKQ A;  3I7P A;  4UM8 A;  4CY3 A;  1OLZ A;  2H6Q A;  4GGA A;  2I0S A;  2VDO A;  3UVL A;  3AH8 B;  3VI4 A;  2IUR A;  3SJL D;  4AN1 A;  3PXW D;  1GOT B;  4ZOZ A;  1P22 A;  3EI1 B;  3CIK B;  1S4U X;  2YNN A;  3SCY A;  4OWR A;  4G55 A;  4XYI A;  5A2Q g;  3K71 A;  3ULE C;  4Y7R A;  1UOP A;  4H5I A;  2I3S A;  1JV2 A;  2TRC B;  4NSX A;  4WJK A;  1O6F A;  2OK6 A;  2P9K C;  4PXW A;  2H9M A;  5SXM A;  2CO0 C;  5M5V A;  4G1E A;  4FAV D;  2HES X;  4NEN A;  5HQG A;  5FKQ A;  1BPO A;  3B7F A;  2W18 A;  5TEF A;  3EI2 A;  1UOQ A;  4GM9 A;  4GM8 A;  1N6F A;  2GC4 A;  4GM3 A;  2QC5 A;  4NC4 A;  2EIE A;  5GXH A;  1E8M A;  4FHL A;  2OJY A;  1UOO A;  4D6V A;  1ERJ A;  4O1Q D;  5GMK n;  4WK0 A;  4BP9 A;  5FKR A;  3OKY B;  1PBY B;  2Z2P A;  4J86 A;  2OIZ A;  3ORV D;  5CYK A;  3PXS D;  2VDR A;  5IT9 g;  4CI1 A;  1A12 A;  4JHP C;  5EM2 B;  1QFM A;  5K1C C;  2YNO A;  3C9C A;  3IUL A;  3PSL A;  4O45 A;  2XDW A;  4O2W A;  2H68 A;  4I79 A;  3NIF A;  3EWE A;  4LG8 A;  4ZN4 A;  2PM9 A;  2IUV A;  3L4M D;  2O9K A;  1FWX A;  3MKS B;  3AL8 A;  1XIP A;  4A2M A;  2B5N A;  1MG2 A;  3OL2 A;  4CY5 A;  2IWF A;  4A0B A;  5EAR A;  2UZX B;  4J8G A;  4AX4 A;  5M5R A;  3EG6 A;  2VDP A;  4GZ8 A;  2H9N A;  4DNV A;  4E54 A;  1B9Y A;  4G56 B;  1E8N A;  4O02 A;  3NVQ A;  1GOH A;  2H6K A;  2EID A;  5I5I A;  1PGU A;  2H6N A;  3O4H A;  1JMX B;  2P9U C;  5E6S A;  4J73 A;  1NEX B;  4A0A A;  3J80 g;  3EQ9 A;  5E6R A;  4WK4 A;  4CI3 A;  4PBY A;  3EMH A;  5FKT A;  4DNU A;  3MUN A;  4J0W A;  2XZG A;  2AGY A;  1N6D A;  4R7A B;  4FWW A;  3IUQ A;  3ZDY A;  4CC9 A;  5FKS A;  4DNW A;  4JXM A;  3DWL C;  3EU7 A;  3K27 A;  1GG2 B;  4RE6 A;  5HYN B;  4U7A A;  3O4G A;  4TZ4 A;  3V7D B;  3UR4 A;  1VE7 A;  3T3M A;  2J56 H;  4ERQ A;  4UM9 A;  2CO0 A;  1PEV A;  2AH1 A;  2H13 A;  4L3G D;  5FFO A;  3JPX A;  3IJC A;  4QAM A;  2MTA H;  3FCS A;  3RFH A;  2B5L A;  1OMW B;  1GOF A;  1K32 A;  4UI9 R;  5HE1 B;  3PSC B;  3RN0 D;  3EI3 A;  2HU7 A;  1TYQ C;  1M1X A;  3RN1 D;  2B4E A;  3UVO A;  2AGX A;  3W15 A;  3GC3 B;  4PSX B;  4JHN A;  3JZG A;  2HU8 A;  3K72 A;  3C5M A;  5H1M A;  4X60 B;  1U2V C;  2PM7 B;  2AQ5 A;  3BG1 A;  4A11 A;  4ZOY A;  2XL2 A;  3IJ0 A;  3SWS D;  4GMB A;  4A7J A;  3I8E A;  3I89 A;  3QI0 A;  2HKR A;  4O3T B;  4J81 A;  1GP2 B;  2QXV A;  1JOF A;  1UTC A;  2EIB A;  1H2Z A;  1E5T A;  5EMK B;  3T3P A;  4AOW A;  3IJE A;  3NID A;  1QFS A;  2IAA A;  3PVW B;  3GRE A;  3GD1 I;  3IIW A;  3JZH A;  3PXT D;  3EQ7 A;  5GSA A;  5H14 A; 
#chains in the Genus database with same CATH homology
 3P4F A;  3AL9 A;  3FGB A;  3NVX A;  5I5M A;  2YBA A;  2BCJ B;  4N14 A;  2YNP A;  4A2L A;  4E5Z A;  4D0K A;  4O9D A;  4CY2 A;  3JAM g;  2AGZ A;  3EI2 B;  2H47 A;  2IUQ A;  5IJ8 E;  2IWK A;  2YB8 B;  5CXB A;  4LGN A;  3MZK A;  3EI4 A;  4GGD A;  5HE2 B;  1JJU B;  5C2V B;  3FRX A;  2J57 G;  1NR0 A;  5AFU 3;  5CYK B;  4BL0 A;  5EAP A;  5K19 A;  3E0C A;  5FLX g;  2P9S C;  5EAM A;  3BWS A;  4CZV A;  2OVP B;  1A0R B;  3JZN A;  3MMY A;  4LG9 A;  4L1Q D;  2PM9 B;  5FA5 B;  3I7O A;  1K8K C;  2AH0 A;  3AL8 B;  1GXR A;  3DXM C;  1B9X A;  2OVR B;  4J79 A;  2GNQ A;  3OL2 B;  4X3E A;  4A08 A;  4IMM A;  3SXT D;  4A0B B;  3UVM A;  5IC7 A;  5EMJ B;  5EAL A;  3SBP A;  4BUJ C;  4E54 B;  5IGO A;  4A09 A;  3MZL A;  4K3I D;  5CXC A;  4J82 A;  5KDO B;  4CY1 A;  2P9N C;  3SBQ A;  3RMZ D;  4PC0 A;  1PI6 A;  2P9P C;  2XU7 A;  2HYE A;  5EML B;  4A0A B;  3DXK C;  4X61 B;  3RSE C;  3OTT A;  3F3P A;  4YVD A;  3L4O D;  3V9F A;  3JRO A;  4ERY A;  5TDH B;  2OVQ B;  4CZX A;  2CN3 A;  3UKU C;  2H3X A;  4JSX C;  1Q47 A;  2H14 A;  4IA9 A;  3IKO A;  1RI6 A;  3I7K A;  3IIY A;  4L9O A;  2HJ4 A;  4J8B A;  3I2N A;  4HDJ A;  2H9P A;  2Z2O A;  3CFS B;  2CE9 A;  3U4Y A;  5IGQ A;  4GQ1 A;  5TEE A;  3KRW B;  4EWR A;  4Z8L A;  3PE7 A;  4AEZ A;  4J0X A;  3I7H A;  3OW8 A;  4OZU A;  4ESG A;  3EI1 A;  3EI3 B;  3GFC A;  3K26 A;  4QQE A;  2CNX A;  4GQ2 P;  4MK0 B;  3C99 A;  5HE3 B;  3NVN A;  3ODT A;  1SHY B;  2Z2N A;  4ZOV A;  3VA6 A;  2H9L A;  4JSP C;  4L3H D;  4A11 B;  3N0E A;  3SMR A;  3CFV A;  4PBZ A;  2OK4 A;  2Q7Q A;  4BH6 A;  4QL1 A;  4X63 B;  3DM0 A;  3AFC A;  2IUP A;  5TF2 A;  5GXI A;  2J55 H;  2P9L C;  3VH0 A;  4JSN C;  3OKY A;  4JT6 C;  3UVN A;  2G9A A;  1QNI A;  4K3J B;  2I3T A;  4FA4 D;  4E5Z B;  4GQB B;  3ZWL B;  2AGL A;  3SFZ A;  3I7L A;  4FA5 D;  5EM2 A;  1YFQ A;  5HE0 B;  5JWZ A;  2I0R A;  4CI2 A;  4CI8 A;  1SQ9 A;  3N0D A;  5EMM B;  3FM0 A;  1XHM A;  3J81 g;  1MDA H;  4JSV C;  4FA1 D;  3UKR C;  3SN6 B;  1R5M A;  1N6E A;  5B4W A;  2UZY B;  5CXB B;  1VYH C;  4PSW B;  3V5W B;  2BBK H;  3KRX B;  4U1E I;  3EI4 B;  4FAN D;  4ERZ A;  3SHF A;  2HKM A;  3VGZ A;  3IJ1 A;  1U4C A;  2PM6 B;  5AMS A;  2G99 A;  4QT8 A;  3JRP A;  2HJB A;  3JB9 L;  5THA A;  1L0Q A;  5C2W B;  2AGW A;  5I5J A;  4FB1 D;  4A08 B;  4J77 A;  2CN2 A;  3DSM A;  4FA9 D;  4JD2 C;  2GC7 A;  3SLE D;  2HXC A;  3SVW D;  3OKW A;  4A09 B;  3PVU B;  3C75 H;  5CXC B;  5IJ7 E;  2XL3 A;  4XYH A;  3RLM D;  1SQJ A;  2CE8 A;  4J87 A;  3UVK A;  4CZY A;  2I0T A;  4KFM B;  4JT5 C;  1JMZ B;  3HFQ A;  1XKS A;  5FXY A;  4J84 A;  2P9I C;  3F3G A;  4PNK B;  4J78 A;  3SBR A;  3MXX A;  4H5J A;  2B5M A;  3RFG A;  3OKT A;  4ZOX A;  1MG3 A;  4Y5R D;  4GGC A;  2YMU A;  3RRM C;  4QRJ A;  5H17 A;  3I7N A;  2PBI B;  4XEI C;  2XYI A;  3F3F A;  4O3U B;  5FQD A;  2EBS A;  4ES0 A;  5C9Z B;  3I8C A;  5AJA A;  1TBG A;  3BG0 A;  3A0F A;  3MKQ A;  3I7P A;  4CY3 A;  1OLZ A;  2H6Q A;  4GGA A;  2I0S A;  3UVL A;  3AH8 B;  2IUR A;  3SJL D;  3PXW D;  1GOT B;  4ZOZ A;  1P22 A;  3EI1 B;  3CIK B;  1S4U X;  2YNN A;  3SCY A;  4OWR A;  4XYI A;  5A2Q g;  3ULE C;  4Y7R A;  4H5I A;  2I3S A;  2TRC B;  4NSX A;  2OK6 A;  2P9K C;  4PXW A;  2H9M A;  5SXM A;  2CO0 C;  4FAV D;  2HES X;  5HQG A;  5FKQ A;  3B7F A;  5TEF A;  2W18 A;  3EI2 A;  4GM9 A;  4GM8 A;  1N6F A;  2GC4 A;  4GM3 A;  2QC5 A;  5GXH A;  4FHL A;  2OJY A;  4D6V A;  1ERJ A;  4O1Q D;  5GMK n;  5FKR A;  3OKY B;  1PBY B;  2Z2P A;  4J86 A;  2OIZ A;  3ORV D;  5CYK A;  3PXS D;  5IT9 g;  4CI1 A;  5EM2 B;  5K1C C;  2YNO A;  3C9C A;  3PSL A;  4O45 A;  2H68 A;  4I79 A;  3EWE A;  4LG8 A;  4ZN4 A;  2PM9 A;  2IUV A;  3L4M D;  2O9K A;  1FWX A;  3MKS B;  3AL8 A;  1XIP A;  4A2M A;  2B5N A;  1MG2 A;  3OL2 A;  4CY5 A;  2IWF A;  4A0B A;  5EAR A;  2UZX B;  4J8G A;  3EG6 A;  4GZ8 A;  2H9N A;  4E54 A;  1B9Y A;  4G56 B;  3NVQ A;  2H6K A;  5I5I A;  1PGU A;  2H6N A;  1JMX B;  2P9U C;  4J73 A;  1NEX B;  4A0A A;  3J80 g;  4CI3 A;  4PBY A;  3EMH A;  5FKT A;  4J0W A;  4R7A B;  2AGY A;  1N6D A;  4FWW A;  4CC9 A;  5FKS A;  4JXM A;  3DWL C;  3EU7 A;  3K27 A;  1GG2 B;  5HYN B;  4U7A A;  4TZ4 A;  3V7D B;  3UR4 A;  2J56 H;  4ERQ A;  2CO0 A;  1PEV A;  2AH1 A;  2H13 A;  4L3G D;  3JPX A;  3IJC A;  2MTA H;  3RFH A;  2B5L A;  1OMW B;  1K32 A;  5HE1 B;  4UI9 R;  3RN0 D;  3PSC B;  3EI3 A;  1TYQ C;  3RN1 D;  2B4E A;  3UVO A;  2AGX A;  3W15 A;  4PSX B;  3JZG A;  3C5M A;  5H1M A;  4X60 B;  1U2V C;  2PM7 B;  2AQ5 A;  3BG1 A;  4A11 A;  4ZOY A;  2XL2 A;  3IJ0 A;  3SWS D;  4GMB A;  4A7J A;  3I8E A;  3I89 A;  2HKR A;  4O3T B;  4J81 A;  1GP2 B;  2QXV A;  1JOF A;  5EMK B;  4AOW A;  3PVW B;  2IAA A;  3GRE A;  3IIW A;  3JZH A;  3PXT D;  5GSA A;  5H14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...