1PGUA

Yeast actin interacting protein 1 (aip1), se-met protein, monoclinic crystal form
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
612
structure length
606
Chain Sequence
SSISLKEIIPPQPSTQRNFTTHLSYDPTTNAIAYPCGKSAFVRCLDDGDSKVPPVVQFTGHGSSVVTTVKFSPIKGSQYLCSGDESGKVIVWGWTFDKESNSVEVNVKSEFQVLAGPISDISWDFEGRRLCVVGEGRDNFGVFISWDSGNSLGEVSGHSQRINACHLKQSRPMRSMTVGDDGSVVFYQGPPFKFSASDRTHHKQGSFVRDVEFSPDSGEFVITVGSDRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGNQQVGVVATGNGRIISLSLDGTLNFYELGHDEVLKTISGHNKGITALTVNPLISGSYDGRIMEWSSSSMHQDHSNLIVSLDNSKAQEYSSISWDDTLKVNGITKHEFGSQPKVASANNDGFTAVLTNDDDLLILQSFTGDIIKSVRLNSPGSAVSLSQNYVAVGLEEGNTIQVFKLSDLEVSFDLKTPLRAKPSYISISPSETYIAAGDVMGKILLYDLQSREVKTSRWAFRTSKINAISWKPAEEIEEDLVATGSLDTNIFIYSVKRPMKIIKALNAHKDGVNNLLWETPSTLVSSGADACIKRWNVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Actin interacting protein 1
publication title The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 159
structure length 606
sequence length 612
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pguA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pguA01
4L9OA 1OLZA 3I7HA 4CY3A 3J81g 1U4CA 4FB1D 2P9NC 1B9XA 3VA6A 1SQJA 2HKRA 3C9CA 4J0XA 3EMHA 3EI4B 3L4MD 3SVWD 3OW8A 5TEFA 3SMRA 5IJ7E 4L3GD 5AFU3 1PGUA 3FRXA 2B5LA 3EI1B 2P9UC 5C2VB 4FA4D 3OL2B 3L4OD 2G99A 4E5ZA 2YBAA 3UKRC 1K32A 1TBGA 4PSXB 4CY1A 2AGYA 3A0FA 4I79A 2H13A 2PM7B 4OWRA 4PSWB 4ERQA 3F3FA 5JWZA 3AL8B 3PSCB 4J87A 2HYEA 4XYHA 2HJ4A 3W15A 3SHFA 2H9NA 5K1CC 3I89A 5EM2B 4O3UB 2H6NA 4GZ8A 1MDAH 5TF2A 2OVRB 4E54A 2IUPA 3IIYA 4LG8A 3I7OA 3AFCA 3C5MA 3RFGA 2YB8B 3BG1A 2H9PA 3EG6A 3E0CA 3I7LA 2OVPB 2I0TA 4GGCA 4JT5C 5HQGA 5GSAA 4A11A 4A09A 3SJLD 3U4YA 3BG0A 3K26A 2AH0A 5CXCB 3BWSA 2Q7QA 2H9MA 3IJ0A 4FAND 3UVOA 1PBYB 2CNXA 4CZXA 1P22A 3PXTD 2I0RA 3SFZA 2H6QA 3UVKA 2HESX 2Z2NA 5EMKB 4K3JB 4CZVA 2AGLA 4O9DA 3DXMC 4GM3A 2XL2A 3PSLA 2HJBA 4NSXA 1Q47A 5SXMA 3J80g 5EMMB 5CYKA 1K8KC 2I3SA 2PM9A 4JSXC 2YNOA 4QRJA 4GQ1A 5EMLB 5FQDA 3FGBA 4QT8A 2IAAA 3CFVA 2J55H 3JZHA 4D0KA 4JT6C 4O45A 2J57G 4X61B 3JB9L 3PVUB 1L0QA 5AMSA 4CZYA 1GOTB 4ES0A 2AH1A 1GP2B 3EU7A 2XU7A 2H6KA 3SWSD 1N6DA 4GGDA 3N0EA 4J78A 4H5IA 3I7NA 5I5JA 3EI3B 1YFQA 2AGZA 3SBRA 4R7AB 2H3XA 4A0BB 5IT9g 4JD2C 2O9KA 3NVNA 5H1MA 5CXBB 5B4WA 3FM0A 2CN2A 3CIKB 3AL9A 3KRWB 5FXYA 3GREA 5H17A 3B7FA 3SCYA 3EWEA 3RRMC 4JSVC 4ZOZA 3PXSD 5FA5B 2B5MA 4XYIA 4J77A 1OMWB 3DXKC 2OJYA 3RMZD 4GM8A 3RFHA 4BUJC 5I5IA 1QNIA 1B9YA 1XKSA 3RN1D 3N0DA 4CY5A 2I3TA 5GXIA 3OKWA 4A11B 4FWWA 4A0AB 4MK0B 3JRPA 1TYQC 1VYHC 3JZNA 4QL1A 2CE9A 5FKSA 4Z8LA 5EALA 5IJ8E 3EI2B 4Y5RD 4K3ID 1SQ9A 3EI4A 3RN0D 3I8EA 3ZWLB 3SN6B 3MKSB 4J84A 2YMUA 2XL3A 3JZGA 3K27A 4J8BA 4J73A 1PEVA 3EI1A 3PVWB 3OL2A 4JSPC 1RI6A 2BBKH 4LG9A 5HE3B 4ERZA 4N14A 2MTAH 4O1QD 3SXTD 3F3PA 2OVQB 1U2VC 1JMXB 2H9LA 3DSMA 4FA9D 5IGOA 3IKOA 4J79A 3HFQA 3AL8A 3F3GA 4AOWA 3OKYB 3MXXA 4FA1D 4KFMB 4JXMA 5EM2A 4ZOYA 4A08B 5H14A 3ULEC 3JAMg 2J56H 3IJ1A 4ZN4A 3ORVD 4TZ4A 2B4EA 5CXCA 2UZYB 3UVLA 3OKTA 3KRXB 4GM9A 5C9ZB 4Y7RA 5I5MA 2PBIB 2OK6A 3P4FA 4ERYA 2GC7A 1XIPA 5EMJB 3IJCA 2GC4A 4LGNA 4O3TB 4U1EI 1N6FA 4PBZA 2AGXA 2P9PC 4BH6A 4PBYA 5TEEA 4ESGA 4D6VA 3VH0A 5IGQA 4J81A 2AGWA 4ZOVA 2P9KC 1FWXA 2B5NA 2G9AA 4E5ZB 3C99A 3GFCA 2IWKA 5HE2B 3SBQA 3OTTA 2YNNA 5FKRA 3V5WB 1JMZB 3PE7A 5THAA 4YVDA 4CY2A 1MG2A 3MZKA 3I2NA 1ERJA 4E54B 4IA9A 3EI3A 4JSNC 4J8GA 4CI8A 4G56B 4XEIC 4A09B 4A0BA 5GXHA 2GNQA 2IUVA 5CXBA 4PNKB 3MKQA 3VGZA 5HYNB 2CN3A 2XYIA 3IIWA 4CI3A 1GG2B 2H47A 2P9LC 4GGAA 3JPXA 3NVQA 2YNPA 2OIZA 4L1QD 2CO0A 4PXWA 1SHYB 2Z2PA 1GXRA 2HXCA 2QC5A 3UR4A 1A0RB 2P9SC 5TDHB 3C75H 4GQ2P 2UZXB 4FA5D 2EBSA 5CYKB 1MG3A 2PM9B 4CC9A 4X63B 2IUQA 2PM6B 4OZUA 3SLED 2OK4A 5C2WB 3MZLA 2QXVA 1NEXB 3MMYA 3AH8B 4A0AA 4EWRA 1JJUB 2H14A 4IMMA 5GMKn 3RLMD 1PI6A 2CO0C 5KDOB 3NVXA 4X3EA 5K19A 1XHMA 5A2Qg 4A7JA 3EI2A 4L3HD 5HE1B 4PC0A 4J82A 4CI1A 5EARA 3V9FA 5EAPA 2W18A 2TRCB 2IURA 4GQBB 4HDJA 3ODTA 3JROA 4H5JA 4A2LA 3UVMA 4CI2A 2I0SA 3SBPA 4J86A 2BCJB 3UKUC 3DWLC 3V7DB 5IC7A 4BL0A 3UVNA 2P9IC 4QQEA 4FAVD 2Z2OA 3DM0A 1S4UX 5FKQA 3I8CA 2CE8A 1NR0A 3RSEC 3OKYA 4J0WA 4ZOXA 2AQ5A 3PXWD 4A2MA 5FLXg 1R5MA 4X60B 1JOFA 4FHLA 4A08A 3CFSB 3I7KA 2H68A 4UI9R 5EAMA 1N6EA 2IWFA 5FKTA 4AEZA 4U7AA 4GMBA 5HE0B 3I7PA 2HKMA 5AJAA
chains in the Genus database with same CATH superfamily
4L9OA 3O4GA 1OLZA 3NIFA 3I7HA 4CY3A 3J81g 1U4CA 4FB1D 2P9NC 1B9XA 3VA6A 1SQJA 3O4JA 4UM9A 1VZ3A 2HKRA 3C9CA 4J0XA 5E6RA 3EMHA 3EI4B 3L4MD 3SVWD 3GC3B 3OW8A 5TEFA 3SMRA 5IJ7E 4L3GD 5AFU3 1PGUA 1QFMA 2QZPA 3FRXA 2B5LA 3EI1B 2P9UC 5C2VB 1UOQA 4FA4D 1E5TA 3OL2B 3L4OD 2G99A 4E5ZA 2YBAA 3UKRC 1K32A 1TBGA 4PSXB 4CY1A 3K6SA 2AGYA 3A0FA 4I79A 2H13A 2PM7B 4OWRA 2XE4A 4PSWB 4ERQA 3F3FA 5JWZA 3AL8B 3PSCB 4JHPC 3MVDK 1I2MB 4JHNA 4J87A 2HYEA 4XYHA 2HJ4A 3W15A 3SHFA 2H9NA 5K1CC 3I89A 5EM2B 4O3UB 2H6NA 4GZ8A 1MDAH 5TF2A 2OVRB 3K72A 4E54A 2IUPA 3IIYA 4LG8A 3I7OA 3AFCA 4AN1A 3ZE0A 3C5MA 3RFGA 5M5UA 4WK2A 1JV2A 2YB8B 2H9PA 3BG1A 3EG6A 3E0CA 2OVPB 2I0TA 3I7LA 4GGCA 5HQGA 5GSAA 4A11A 4A09A 3SJLD 3U4YA 3BG0A 3K26A 2VDKA 2AH0A 5CXCB 3BWSA 2Q7QA 4RE5A 2H9MA 3IJ0A 1GOHA 4FAND 1C9IA 1E8NA 3UVOA 4MMXA 1PBYB 2CNXA 4CZXA 1P22A 3PXTD 4AX4A 2I0RA 5M61A 3ZDXA 2EIBA 3SFZA 2H6QA 3UVKA 2HESX 2Z2NA 5EMKB 2EIDA 4K3JB 3V4PA 4CZVA 2AGLA 4O9DA 4Z7OA 3DXMC 4GM3A 4G1MA 2XL2A 3PSLA 2HJBA 1TYEA 4NSXA 1Q47A 5SXMA 3J80g 5EMMB 5CYKA 1K8KC 2I3SA 2PM9A 4JSXC 3NIDA 2YNOA 4QRJA 1UTCA 5M5TA 4GQ1A 3FCUA 3FCSA 5EMLB 5FQDA 4O02A 3FGBA 4QT8A 3O4IA 2IAAA 3CFVA 1BPOA 2J55H 3JZHA 3IUMA 4D0KA 4Z7QA 4JT6C 3ZDYA 4O45A 2J57G 4X61B 3JB9L 3MUOA 1L0QA 3PVUB 5AMSA 4CZYA 1GOTB 4WJKA 4ES0A 4BP9A 2AH1A 1GP2B 3EU7A 2XU7A 4O2WA 2H6KA 3SWSD 3T3MA 3QI0A 1N6DA 2VDQA 1H2XA 3N0EA 4GGDA 4J78A 3KCIA 4H5IA 3I7NA 5I5JA 2VZ1A 3EI3B 1YFQA 2AGZA 3SBRA 4R7AB 2H3XA 2VDMA 4A0BB 5IT9g 4JD2C 2O9KA 3NVNA 5H1MA 5CXBB 1H2ZA 5B4WA 3FM0A 2CN2A 1O6FA 3CIKB 3AL9A 4L1MA 1A12A 3V4VA 3KRWB 5FXYA 3GREA 3QHYB 4Z7NA 5H17A 3B7FA 3SCYA 3EWEA 3RRMC 1YR2A 4JSVC 4ZOZA 3PXSD 5FA5B 2B5MA 4XYIA 5C92A 2EIEA 4J77A 3ZE1A 3O4HA 1OMWB 3DXKC 2OJYA 3RMZD 4GM8A 3RFHA 4BUJC 3IULA 5I5IA 1QNIA 1B9YA 1E8MA 1XKSA 3RN1D 3N0DA 4CY5A 2I3TA 4BP8A 5GXIA 3OKWA 4A11B 4FWWA 4A0AB 5E6UA 4MK0B 3JRPA 1TYQC 1VYHC 3JZNA 4QL1A 2CE9A 5FKSA 4Z8LA 5EALA 5IJ8E 3EI2B 4Y5RD 4K3ID 1SQ9A 3EI4A 3IUQA 3RN0D 3I8EA 3ZWLB 3SN6B 3MKSB 2YMUA 2XL3A 3JZGA 4J84A 3K27A 4J8BA 4J73A 3VI3A 1PEVA 3EI1A 3PVWB 3OL2A 4JSPC 1RI6A 2BBKH 4LG9A 5HE3B 4ERZA 4N14A 2MTAH 4O1QD 3SXTD 4BCCA 3F3PA 2OVQB 1U2VC 1JMXB 2H9LA 3DSMA 2VC2A 4FA9D 5IGOA 3IKOA 4J79A 4UM8A 3ZDZA 3HFQA 4BCDA 3AL8A 3F3GA 4AOWA 3OKYB 1M1XA 2VDNA 3MXXA 4FA1D 4KFMB 4WK0A 4JXMA 1QFSA 1GOFA 5EM2A 3EQ9A 4ZOYA 4A08B 5H14A 3ULEC 4G55A 3JAMg 5HDBA 5M5SA 2J56H 4NBMA 3IJ1A 4ZN4A 3ORVD 4TZ4A 2B4EA 5CXCA 4G1EA 2UZYB 3UVLA 3OKTA 3OF7A 4NC4A 3KRXB 4GM9A 5C9ZB 4Y7RA 5I5MA 2PBIB 1T2XA 2OK6A 3P4FA 4ERYA 2GC7A 1VZ2A 1XIPA 5EMJB 3IJCA 2GC4A 4LGNA 4O3TB 4U1EI 1N6FA 4PBZA 2AGXA 2P9PC 4BH6A 4PBYA 5TEEA 4ESGA 4D6VA 3VH0A 4NENA 2HU8A 5IGQA 4J81A 2AGWA 4ZOVA 2VDOA 2P9KC 1FWXA 3MUNA 2B5NA 2G9AA 4E5ZB 3VI4A 3C99A 3GFCA 4NAAA 2IWKA 2EICA 5HE2B 3SBQA 4MMZA 3OTTA 2YNNA 5FKRA 4JT5C 3V5WB 1JMZB 3PE7A 5THAA 4YVDA 4CY2A 2VDRA 5M5RA 1MG2A 3MZKA 3I2NA 1ERJA 4RE6A 3EQ7A 5M5VA 4E54B 4IA9A 4D9SA 3EI3A 4JSNC 4J8GA 5E6SA 2QR5A 4CI8A 4G56B 4XEIC 1GOGA 3IUNA 4A09B 4A0BA 5GXHA 2GNQA 2IUVA 3GD1I 5CXBA 4PNKB 3MKQA 3VGZA 5HYNB 2CN3A 2XYIA 3IIWA 5C86A 4CI3A 2VDLA 1GG2B 2H47A 2P9LC 1VE6A 3DDUA 4DNWA 3IVMA 4GGAA 3JPXA 3NVQA 3EQ8A 2YNPA 2OIZA 4L1QD 2CO0A 4PXWA 1VE7A 1SHYB 1GXRA 2Z2PA 1UOOA 2HXCA 2QC5A 3UR4A 1A0RB 2P9SC 5TDHB 3C75H 4DNUA 4GQ2P 3IJEA 2UZXB 1UOPA 4FA5D 2EBSA 1C9LA 3IURA 5CYKB 1MG3A 2PM9B 1H2YA 4CC9A 4X63B 3T3PA 2IUQA 3NIGA 2PM6B 4QAMA 4OZUA 3SLED 2JKXA 2OK4A 5C2WB 2XDWA 3MZLA 2XZGA 2QXVA 1O6GA 1NEXB 3MMYA 3AH8B 4A0AA 5FFOA 4EWRA 1JJUB 2H14A 4IMMA 4BCBA 5GMKn 3RLMD 2WQ8A 1PI6A 4AN0A 2CO0C 5KDOB 3NVXA 4X3EA 5K19A 1XHMA 5A2Qg 4A7JA 3EI2A 2VDPA 4L3HD 4DNVA 2HU7A 5HE1B 4PC0A 4J82A 4CI1A 5EARA 3V9FA 5EAPA 2W18A 4MMYA 2HU5A 2TRCB 2IURA 4GQBB 4HDJA 3ODTA 3JROA 4H5JA 4A2LA 3UVMA 4CI2A 2I0SA 3SBPA 4J86A 2BCJB 3UKUC 3DWLC 3K71A 3V7DB 5IC7A 4BL0A 3UVNA 2P9IC 4QQEA 4FAVD 2Z2OA 3DM0A 1S4UX 5FKQA 1H2WA 2BKLA 3I8CA 2CE8A 1NR0A 3RSEC 3IUJA 5FFGA 4IRZA 3OKYA 4J0WA 4ZOXA 2AQ5A 3PXWD 1U8CA 2VZ3A 4A2MA 1L5GA 5FLXg 1R5MA 4X60B 1JOFA 4FHLA 4AMZA 4A08A 3ZE2A 3CFSB 3I7KA 2H68A 1K3IA 4UI9R 1JTDB 4WK4A 5EAMA 4AMYA 1N6EA 2IWFA 5FKTA 4AEZA 4U7AA 4GMBA 5HE0B 3I7PA 2HKMA 5AJAA
chains in the Genus database with same CATH topology
4L9OA 1OLZA 3I7HA 4CY3A 3J81g 1U4CA 4FB1D 2P9NC 1B9XA 3VA6A 1SQJA 2HKRA 3C9CA 4J0XA 3EMHA 3EI4B 3L4MD 3SVWD 3OW8A 5TEFA 3SMRA 5IJ7E 4L3GD 5AFU3 1PGUA 3FRXA 2B5LA 3EI1B 2P9UC 5C2VB 4FA4D 3OL2B 3L4OD 2G99A 4E5ZA 2YBAA 3UKRC 1K32A 1TBGA 4PSXB 4CY1A 2AGYA 3A0FA 4I79A 2H13A 2PM7B 4OWRA 4PSWB 4ERQA 3F3FA 5JWZA 3AL8B 3PSCB 4J87A 2HYEA 4XYHA 2HJ4A 3W15A 3SHFA 2H9NA 5K1CC 3I89A 5EM2B 4O3UB 2H6NA 4GZ8A 1MDAH 5TF2A 2OVRB 4E54A 2IUPA 3IIYA 4LG8A 3I7OA 3AFCA 3C5MA 3RFGA 2YB8B 3BG1A 2H9PA 3EG6A 3E0CA 3I7LA 2OVPB 2I0TA 4GGCA 4JT5C 5HQGA 5GSAA 4A11A 4A09A 3SJLD 3U4YA 3BG0A 3K26A 2AH0A 5CXCB 3BWSA 2Q7QA 2H9MA 3IJ0A 4FAND 3UVOA 1PBYB 2CNXA 4CZXA 1P22A 3PXTD 2I0RA 3SFZA 2H6QA 3UVKA 2HESX 2Z2NA 5EMKB 4K3JB 4CZVA 2AGLA 4O9DA 3DXMC 4GM3A 2XL2A 3PSLA 2HJBA 4NSXA 1Q47A 5SXMA 3J80g 5EMMB 5CYKA 1K8KC 2I3SA 2PM9A 4JSXC 2YNOA 4QRJA 4GQ1A 5EMLB 5FQDA 3FGBA 4QT8A 2IAAA 3CFVA 2J55H 3JZHA 4D0KA 4JT6C 4O45A 2J57G 4X61B 3JB9L 3PVUB 1L0QA 5AMSA 4CZYA 1GOTB 4ES0A 2AH1A 1GP2B 3EU7A 2XU7A 2H6KA 3SWSD 1N6DA 4GGDA 3N0EA 4J78A 4H5IA 3I7NA 5I5JA 3EI3B 1YFQA 2AGZA 3SBRA 4R7AB 2H3XA 4A0BB 5IT9g 4JD2C 2O9KA 3NVNA 5H1MA 5CXBB 5B4WA 3FM0A 2CN2A 3CIKB 3AL9A 3KRWB 5FXYA 3GREA 5H17A 3B7FA 3SCYA 3EWEA 3RRMC 4JSVC 4ZOZA 3PXSD 5FA5B 2B5MA 4XYIA 4J77A 1OMWB 3DXKC 2OJYA 3RMZD 4GM8A 3RFHA 4BUJC 5I5IA 1QNIA 1B9YA 1XKSA 3RN1D 3N0DA 4CY5A 2I3TA 5GXIA 3OKWA 4A11B 4FWWA 4A0AB 4MK0B 3JRPA 1TYQC 1VYHC 3JZNA 4QL1A 2CE9A 5FKSA 4Z8LA 5EALA 5IJ8E 3EI2B 4Y5RD 4K3ID 1SQ9A 3EI4A 3RN0D 3I8EA 3ZWLB 3SN6B 3MKSB 4J84A 2YMUA 2XL3A 3JZGA 3K27A 4J8BA 4J73A 1PEVA 3EI1A 3PVWB 3OL2A 4JSPC 1RI6A 2BBKH 4LG9A 5HE3B 4ERZA 4N14A 2MTAH 4O1QD 3SXTD 3F3PA 2OVQB 1U2VC 1JMXB 2H9LA 3DSMA 4FA9D 5IGOA 3IKOA 4J79A 3HFQA 3AL8A 3F3GA 4AOWA 3OKYB 3MXXA 4FA1D 4KFMB 4JXMA 5EM2A 4ZOYA 4A08B 5H14A 3ULEC 3JAMg 2J56H 3IJ1A 4ZN4A 3ORVD 4TZ4A 2B4EA 5CXCA 2UZYB 3UVLA 3OKTA 3KRXB 4GM9A 5C9ZB 4Y7RA 5I5MA 2PBIB 2OK6A 3P4FA 4ERYA 2GC7A 1XIPA 5EMJB 3IJCA 2GC4A 4LGNA 4O3TB 4U1EI 1N6FA 4PBZA 2AGXA 2P9PC 4BH6A 4PBYA 5TEEA 4ESGA 4D6VA 3VH0A 5IGQA 4J81A 2AGWA 4ZOVA 2P9KC 1FWXA 2B5NA 2G9AA 4E5ZB 3C99A 3GFCA 2IWKA 5HE2B 3SBQA 3OTTA 2YNNA 5FKRA 3V5WB 1JMZB 3PE7A 5THAA 4YVDA 4CY2A 1MG2A 3MZKA 3I2NA 1ERJA 4E54B 4IA9A 3EI3A 4JSNC 4J8GA 4CI8A 4G56B 4XEIC 4A09B 4A0BA 5GXHA 2GNQA 2IUVA 5CXBA 4PNKB 3MKQA 3VGZA 5HYNB 2CN3A 2XYIA 3IIWA 4CI3A 1GG2B 2H47A 2P9LC 4GGAA 3JPXA 3NVQA 2YNPA 2OIZA 4L1QD 2CO0A 4PXWA 1SHYB 2Z2PA 1GXRA 2HXCA 2QC5A 3UR4A 1A0RB 2P9SC 5TDHB 3C75H 4GQ2P 2UZXB 4FA5D 2EBSA 5CYKB 1MG3A 2PM9B 4CC9A 4X63B 2IUQA 2PM6B 4OZUA 3SLED 2OK4A 5C2WB 3MZLA 2QXVA 1NEXB 3MMYA 3AH8B 4A0AA 4EWRA 1JJUB 2H14A 4IMMA 5GMKn 3RLMD 1PI6A 2CO0C 5KDOB 3NVXA 4X3EA 5K19A 1XHMA 5A2Qg 4A7JA 3EI2A 4L3HD 5HE1B 4PC0A 4J82A 4CI1A 5EARA 3V9FA 5EAPA 2W18A 2TRCB 2IURA 4GQBB 4HDJA 3ODTA 3JROA 4H5JA 4A2LA 3UVMA 4CI2A 2I0SA 3SBPA 4J86A 2BCJB 3UKUC 3DWLC 3V7DB 5IC7A 4BL0A 3UVNA 2P9IC 4QQEA 4FAVD 2Z2OA 3DM0A 1S4UX 5FKQA 3I8CA 2CE8A 1NR0A 3RSEC 3OKYA 4J0WA 4ZOXA 2AQ5A 3PXWD 4A2MA 5FLXg 1R5MA 4X60B 1JOFA 4FHLA 4A08A 3CFSB 3I7KA 2H68A 4UI9R 5EAMA 1N6EA 2IWFA 5FKTA 4AEZA 4U7AA 4GMBA 5HE0B 3I7PA 2HKMA 5AJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9O A;  1OLZ A;  3I7H A;  4CY3 A;  3J81 g;  1U4C A;  4FB1 D;  2P9N C;  1B9X A;  3VA6 A;  1SQJ A;  2HKR A;  3C9C A;  4J0X A;  3EMH A;  3EI4 B;  3L4M D;  3SVW D;  3OW8 A;  5TEF A;  3SMR A;  5IJ7 E;  4L3G D;  5AFU 3;  1PGU A;  3FRX A;  2B5L A;  3EI1 B;  2P9U C;  5C2V B;  4FA4 D;  3OL2 B;  3L4O D;  2G99 A;  4E5Z A;  2YBA A;  3UKR C;  1K32 A;  1TBG A;  4PSX B;  4CY1 A;  2AGY A;  3A0F A;  4I79 A;  2H13 A;  2PM7 B;  4OWR A;  4PSW B;  4ERQ A;  3F3F A;  5JWZ A;  3AL8 B;  3PSC B;  4J87 A;  2HYE A;  4XYH A;  2HJ4 A;  3W15 A;  3SHF A;  2H9N A;  5K1C C;  3I89 A;  5EM2 B;  4O3U B;  2H6N A;  4GZ8 A;  1MDA H;  5TF2 A;  2OVR B;  4E54 A;  2IUP A;  3IIY A;  4LG8 A;  3I7O A;  3AFC A;  3C5M A;  3RFG A;  2YB8 B;  3BG1 A;  2H9P A;  3EG6 A;  3E0C A;  3I7L A;  2OVP B;  2I0T A;  4GGC A;  4JT5 C;  5HQG A;  5GSA A;  4A11 A;  4A09 A;  3SJL D;  3U4Y A;  3BG0 A;  3K26 A;  2AH0 A;  5CXC B;  3BWS A;  2Q7Q A;  2H9M A;  3IJ0 A;  4FAN D;  3UVO A;  1PBY B;  2CNX A;  4CZX A;  1P22 A;  3PXT D;  2I0R A;  3SFZ A;  2H6Q A;  3UVK A;  2HES X;  2Z2N A;  5EMK B;  4K3J B;  4CZV A;  2AGL A;  4O9D A;  3DXM C;  4GM3 A;  2XL2 A;  3PSL A;  2HJB A;  4NSX A;  1Q47 A;  5SXM A;  3J80 g;  5EMM B;  5CYK A;  1K8K C;  2I3S A;  2PM9 A;  4JSX C;  2YNO A;  4QRJ A;  4GQ1 A;  5EML B;  5FQD A;  3FGB A;  4QT8 A;  2IAA A;  3CFV A;  2J55 H;  3JZH A;  4D0K A;  4JT6 C;  4O45 A;  2J57 G;  4X61 B;  3JB9 L;  3PVU B;  1L0Q A;  5AMS A;  4CZY A;  1GOT B;  4ES0 A;  2AH1 A;  1GP2 B;  3EU7 A;  2XU7 A;  2H6K A;  3SWS D;  1N6D A;  4GGD A;  3N0E A;  4J78 A;  4H5I A;  3I7N A;  5I5J A;  3EI3 B;  1YFQ A;  2AGZ A;  3SBR A;  4R7A B;  2H3X A;  4A0B B;  5IT9 g;  4JD2 C;  2O9K A;  3NVN A;  5H1M A;  5CXB B;  5B4W A;  3FM0 A;  2CN2 A;  3CIK B;  3AL9 A;  3KRW B;  5FXY A;  3GRE A;  5H17 A;  3B7F A;  3SCY A;  3EWE A;  3RRM C;  4JSV C;  4ZOZ A;  3PXS D;  5FA5 B;  2B5M A;  4XYI A;  4J77 A;  1OMW B;  3DXK C;  2OJY A;  3RMZ D;  4GM8 A;  3RFH A;  4BUJ C;  5I5I A;  1QNI A;  1B9Y A;  1XKS A;  3RN1 D;  3N0D A;  4CY5 A;  2I3T A;  5GXI A;  3OKW A;  4A11 B;  4FWW A;  4A0A B;  4MK0 B;  3JRP A;  1TYQ C;  1VYH C;  3JZN A;  4QL1 A;  2CE9 A;  5FKS A;  4Z8L A;  5EAL A;  5IJ8 E;  3EI2 B;  4Y5R D;  4K3I D;  1SQ9 A;  3EI4 A;  3RN0 D;  3I8E A;  3ZWL B;  3SN6 B;  3MKS B;  4J84 A;  2YMU A;  2XL3 A;  3JZG A;  3K27 A;  4J8B A;  4J73 A;  1PEV A;  3EI1 A;  3PVW B;  3OL2 A;  4JSP C;  1RI6 A;  2BBK H;  4LG9 A;  5HE3 B;  4ERZ A;  4N14 A;  2MTA H;  4O1Q D;  3SXT D;  3F3P A;  2OVQ B;  1U2V C;  1JMX B;  2H9L A;  3DSM A;  4FA9 D;  5IGO A;  3IKO A;  4J79 A;  3HFQ A;  3AL8 A;  3F3G A;  4AOW A;  3OKY B;  3MXX A;  4FA1 D;  4KFM B;  4JXM A;  5EM2 A;  4ZOY A;  4A08 B;  5H14 A;  3ULE C;  3JAM g;  2J56 H;  3IJ1 A;  4ZN4 A;  3ORV D;  4TZ4 A;  2B4E A;  5CXC A;  2UZY B;  3UVL A;  3OKT A;  3KRX B;  4GM9 A;  5C9Z B;  4Y7R A;  5I5M A;  2PBI B;  2OK6 A;  3P4F A;  4ERY A;  2GC7 A;  1XIP A;  5EMJ B;  3IJC A;  2GC4 A;  4LGN A;  4O3T B;  4U1E I;  1N6F A;  4PBZ A;  2AGX A;  2P9P C;  4BH6 A;  4PBY A;  5TEE A;  4ESG A;  4D6V A;  3VH0 A;  5IGQ A;  4J81 A;  2AGW A;  4ZOV A;  2P9K C;  1FWX A;  2B5N A;  2G9A A;  4E5Z B;  3C99 A;  3GFC A;  2IWK A;  5HE2 B;  3SBQ A;  3OTT A;  2YNN A;  5FKR A;  3V5W B;  1JMZ B;  3PE7 A;  5THA A;  4YVD A;  4CY2 A;  1MG2 A;  3MZK A;  3I2N A;  1ERJ A;  4E54 B;  4IA9 A;  3EI3 A;  4JSN C;  4J8G A;  4CI8 A;  4G56 B;  4XEI C;  4A09 B;  4A0B A;  5GXH A;  2GNQ A;  2IUV A;  5CXB A;  4PNK B;  3MKQ A;  3VGZ A;  5HYN B;  2CN3 A;  2XYI A;  3IIW A;  4CI3 A;  1GG2 B;  2H47 A;  2P9L C;  4GGA A;  3JPX A;  3NVQ A;  2YNP A;  2OIZ A;  4L1Q D;  2CO0 A;  4PXW A;  1SHY B;  2Z2P A;  1GXR A;  2HXC A;  2QC5 A;  3UR4 A;  1A0R B;  2P9S C;  5TDH B;  3C75 H;  4GQ2 P;  2UZX B;  4FA5 D;  2EBS A;  5CYK B;  1MG3 A;  2PM9 B;  4CC9 A;  4X63 B;  2IUQ A;  2PM6 B;  4OZU A;  3SLE D;  2OK4 A;  5C2W B;  3MZL A;  2QXV A;  1NEX B;  3MMY A;  3AH8 B;  4A0A A;  4EWR A;  1JJU B;  2H14 A;  4IMM A;  5GMK n;  3RLM D;  1PI6 A;  2CO0 C;  5KDO B;  3NVX A;  4X3E A;  5K19 A;  1XHM A;  5A2Q g;  4A7J A;  3EI2 A;  4L3H D;  5HE1 B;  4PC0 A;  4J82 A;  4CI1 A;  5EAR A;  3V9F A;  5EAP A;  2W18 A;  2TRC B;  2IUR A;  4GQB B;  4HDJ A;  3ODT A;  3JRO A;  4H5J A;  4A2L A;  3UVM A;  4CI2 A;  2I0S A;  3SBP A;  4J86 A;  2BCJ B;  3UKU C;  3DWL C;  3V7D B;  5IC7 A;  4BL0 A;  3UVN A;  2P9I C;  4QQE A;  4FAV D;  2Z2O A;  3DM0 A;  1S4U X;  5FKQ A;  3I8C A;  2CE8 A;  1NR0 A;  3RSE C;  3OKY A;  4J0W A;  4ZOX A;  2AQ5 A;  3PXW D;  4A2M A;  5FLX g;  1R5M A;  4X60 B;  1JOF A;  4FHL A;  4A08 A;  3CFS B;  3I7K A;  2H68 A;  4UI9 R;  5EAM A;  1N6E A;  2IWF A;  5FKT A;  4AEZ A;  4U7A A;  4GMB A;  5HE0 B;  3I7P A;  2HKM A;  5AJA A; 
#chains in the Genus database with same CATH topology
 4L9O A;  3O4G A;  1OLZ A;  3NIF A;  3I7H A;  4CY3 A;  3J81 g;  1U4C A;  4FB1 D;  2P9N C;  1B9X A;  3VA6 A;  1SQJ A;  3O4J A;  4UM9 A;  1VZ3 A;  2HKR A;  3C9C A;  4J0X A;  5E6R A;  3EMH A;  3EI4 B;  3L4M D;  3SVW D;  3GC3 B;  3OW8 A;  5TEF A;  3SMR A;  5IJ7 E;  4L3G D;  5AFU 3;  1PGU A;  1QFM A;  2QZP A;  3FRX A;  2B5L A;  3EI1 B;  2P9U C;  5C2V B;  1UOQ A;  4FA4 D;  1E5T A;  3OL2 B;  3L4O D;  2G99 A;  4E5Z A;  2YBA A;  3UKR C;  1K32 A;  1TBG A;  4PSX B;  4CY1 A;  3K6S A;  2AGY A;  3A0F A;  4I79 A;  2H13 A;  2PM7 B;  4OWR A;  2XE4 A;  4PSW B;  4ERQ A;  3F3F A;  5JWZ A;  3AL8 B;  3PSC B;  4JHP C;  3MVD K;  1I2M B;  4JHN A;  4J87 A;  2HYE A;  4XYH A;  2HJ4 A;  3W15 A;  3SHF A;  2H9N A;  5K1C C;  3I89 A;  5EM2 B;  4O3U B;  2H6N A;  4GZ8 A;  1MDA H;  5TF2 A;  2OVR B;  3K72 A;  4E54 A;  2IUP A;  3IIY A;  4LG8 A;  3I7O A;  3AFC A;  4AN1 A;  3ZE0 A;  3C5M A;  3RFG A;  5M5U A;  4WK2 A;  1JV2 A;  2YB8 B;  2H9P A;  3BG1 A;  3EG6 A;  3E0C A;  2OVP B;  2I0T A;  3I7L A;  4GGC A;  5HQG A;  5GSA A;  4A11 A;  4A09 A;  3SJL D;  3U4Y A;  3BG0 A;  3K26 A;  2VDK A;  2AH0 A;  5CXC B;  3BWS A;  2Q7Q A;  4RE5 A;  2H9M A;  3IJ0 A;  1GOH A;  4FAN D;  1C9I A;  1E8N A;  3UVO A;  4MMX A;  1PBY B;  2CNX A;  4CZX A;  1P22 A;  3PXT D;  4AX4 A;  2I0R A;  5M61 A;  3ZDX A;  2EIB A;  3SFZ A;  2H6Q A;  3UVK A;  2HES X;  2Z2N A;  5EMK B;  2EID A;  4K3J B;  3V4P A;  4CZV A;  2AGL A;  4O9D A;  4Z7O A;  3DXM C;  4GM3 A;  4G1M A;  2XL2 A;  3PSL A;  2HJB A;  1TYE A;  4NSX A;  1Q47 A;  5SXM A;  3J80 g;  5EMM B;  5CYK A;  1K8K C;  2I3S A;  2PM9 A;  4JSX C;  3NID A;  2YNO A;  4QRJ A;  1UTC A;  5M5T A;  4GQ1 A;  3FCU A;  3FCS A;  5EML B;  5FQD A;  4O02 A;  3FGB A;  4QT8 A;  3O4I A;  2IAA A;  3CFV A;  1BPO A;  2J55 H;  3JZH A;  3IUM A;  4D0K A;  4Z7Q A;  4JT6 C;  3ZDY A;  4O45 A;  2J57 G;  4X61 B;  3JB9 L;  3MUO A;  1L0Q A;  3PVU B;  5AMS A;  4CZY A;  1GOT B;  4WJK A;  4ES0 A;  4BP9 A;  2AH1 A;  1GP2 B;  3EU7 A;  2XU7 A;  4O2W A;  2H6K A;  3SWS D;  3T3M A;  3QI0 A;  1N6D A;  2VDQ A;  1H2X A;  3N0E A;  4GGD A;  4J78 A;  3KCI A;  4H5I A;  3I7N A;  5I5J A;  2VZ1 A;  3EI3 B;  1YFQ A;  2AGZ A;  3SBR A;  4R7A B;  2H3X A;  2VDM A;  4A0B B;  5IT9 g;  4JD2 C;  2O9K A;  3NVN A;  5H1M A;  5CXB B;  1H2Z A;  5B4W A;  3FM0 A;  2CN2 A;  1O6F A;  3CIK B;  3AL9 A;  4L1M A;  1A12 A;  3V4V A;  3KRW B;  5FXY A;  3GRE A;  3QHY B;  4Z7N A;  5H17 A;  3B7F A;  3SCY A;  3EWE A;  3RRM C;  1YR2 A;  4JSV C;  4ZOZ A;  3PXS D;  5FA5 B;  2B5M A;  4XYI A;  5C92 A;  2EIE A;  4J77 A;  3ZE1 A;  3O4H A;  1OMW B;  3DXK C;  2OJY A;  3RMZ D;  4GM8 A;  3RFH A;  4BUJ C;  3IUL A;  5I5I A;  1QNI A;  1B9Y A;  1E8M A;  1XKS A;  3RN1 D;  3N0D A;  4CY5 A;  2I3T A;  4BP8 A;  5GXI A;  3OKW A;  4A11 B;  4FWW A;  4A0A B;  5E6U A;  4MK0 B;  3JRP A;  1TYQ C;  1VYH C;  3JZN A;  4QL1 A;  2CE9 A;  5FKS A;  4Z8L A;  5EAL A;  5IJ8 E;  3EI2 B;  4Y5R D;  4K3I D;  1SQ9 A;  3EI4 A;  3IUQ A;  3RN0 D;  3I8E A;  3ZWL B;  3SN6 B;  3MKS B;  2YMU A;  2XL3 A;  3JZG A;  4J84 A;  3K27 A;  4J8B A;  4J73 A;  3VI3 A;  1PEV A;  3EI1 A;  3PVW B;  3OL2 A;  4JSP C;  1RI6 A;  2BBK H;  4LG9 A;  5HE3 B;  4ERZ A;  4N14 A;  2MTA H;  4O1Q D;  3SXT D;  4BCC A;  3F3P A;  2OVQ B;  1U2V C;  1JMX B;  2H9L A;  3DSM A;  2VC2 A;  4FA9 D;  5IGO A;  3IKO A;  4J79 A;  4UM8 A;  3ZDZ A;  3HFQ A;  4BCD A;  3AL8 A;  3F3G A;  4AOW A;  3OKY B;  1M1X A;  2VDN A;  3MXX A;  4FA1 D;  4KFM B;  4WK0 A;  4JXM A;  1QFS A;  1GOF A;  5EM2 A;  3EQ9 A;  4ZOY A;  4A08 B;  5H14 A;  3ULE C;  4G55 A;  3JAM g;  5HDB A;  5M5S A;  2J56 H;  4NBM A;  3IJ1 A;  4ZN4 A;  3ORV D;  4TZ4 A;  2B4E A;  5CXC A;  4G1E A;  2UZY B;  3UVL A;  3OKT A;  3OF7 A;  4NC4 A;  3KRX B;  4GM9 A;  5C9Z B;  4Y7R A;  5I5M A;  2PBI B;  1T2X A;  2OK6 A;  3P4F A;  4ERY A;  2GC7 A;  1VZ2 A;  1XIP A;  5EMJ B;  3IJC A;  2GC4 A;  4LGN A;  4O3T B;  4U1E I;  1N6F A;  4PBZ A;  2AGX A;  2P9P C;  4BH6 A;  4PBY A;  5TEE A;  4ESG A;  4D6V A;  3VH0 A;  4NEN A;  2HU8 A;  5IGQ A;  4J81 A;  2AGW A;  4ZOV A;  2VDO A;  2P9K C;  1FWX A;  3MUN A;  2B5N A;  2G9A A;  4E5Z B;  3VI4 A;  3C99 A;  3GFC A;  4NAA A;  2IWK A;  2EIC A;  5HE2 B;  3SBQ A;  4MMZ A;  3OTT A;  2YNN A;  5FKR A;  4JT5 C;  3V5W B;  1JMZ B;  3PE7 A;  5THA A;  4YVD A;  4CY2 A;  2VDR A;  5M5R A;  1MG2 A;  3MZK A;  3I2N A;  1ERJ A;  4RE6 A;  3EQ7 A;  5M5V A;  4E54 B;  4IA9 A;  4D9S A;  3EI3 A;  4JSN C;  4J8G A;  5E6S A;  2QR5 A;  4CI8 A;  4G56 B;  4XEI C;  1GOG A;  3IUN A;  4A09 B;  4A0B A;  5GXH A;  2GNQ A;  2IUV A;  3GD1 I;  5CXB A;  4PNK B;  3MKQ A;  3VGZ A;  5HYN B;  2CN3 A;  2XYI A;  3IIW A;  5C86 A;  4CI3 A;  2VDL A;  1GG2 B;  2H47 A;  2P9L C;  1VE6 A;  3DDU A;  4DNW A;  3IVM A;  4GGA A;  3JPX A;  3NVQ A;  3EQ8 A;  2YNP A;  2OIZ A;  4L1Q D;  2CO0 A;  4PXW A;  1VE7 A;  1SHY B;  1GXR A;  2Z2P A;  1UOO A;  2HXC A;  2QC5 A;  3UR4 A;  1A0R B;  2P9S C;  5TDH B;  3C75 H;  4DNU A;  4GQ2 P;  3IJE A;  2UZX B;  1UOP A;  4FA5 D;  2EBS A;  1C9L A;  3IUR A;  5CYK B;  1MG3 A;  2PM9 B;  1H2Y A;  4CC9 A;  4X63 B;  3T3P A;  2IUQ A;  3NIG A;  2PM6 B;  4QAM A;  4OZU A;  3SLE D;  2JKX A;  2OK4 A;  5C2W B;  2XDW A;  3MZL A;  2XZG A;  2QXV A;  1O6G A;  1NEX B;  3MMY A;  3AH8 B;  4A0A A;  5FFO A;  4EWR A;  1JJU B;  2H14 A;  4IMM A;  4BCB A;  5GMK n;  3RLM D;  2WQ8 A;  1PI6 A;  4AN0 A;  2CO0 C;  5KDO B;  3NVX A;  4X3E A;  5K19 A;  1XHM A;  5A2Q g;  4A7J A;  3EI2 A;  2VDP A;  4L3H D;  4DNV A;  2HU7 A;  5HE1 B;  4PC0 A;  4J82 A;  4CI1 A;  5EAR A;  3V9F A;  5EAP A;  2W18 A;  4MMY A;  2HU5 A;  2TRC B;  2IUR A;  4GQB B;  4HDJ A;  3ODT A;  3JRO A;  4H5J A;  4A2L A;  3UVM A;  4CI2 A;  2I0S A;  3SBP A;  4J86 A;  2BCJ B;  3UKU C;  3DWL C;  3K71 A;  3V7D B;  5IC7 A;  4BL0 A;  3UVN A;  2P9I C;  4QQE A;  4FAV D;  2Z2O A;  3DM0 A;  1S4U X;  5FKQ A;  1H2W A;  2BKL A;  3I8C A;  2CE8 A;  1NR0 A;  3RSE C;  3IUJ A;  5FFG A;  4IRZ A;  3OKY A;  4J0W A;  4ZOX A;  2AQ5 A;  3PXW D;  1U8C A;  2VZ3 A;  4A2M A;  1L5G A;  5FLX g;  1R5M A;  4X60 B;  1JOF A;  4FHL A;  4AMZ A;  4A08 A;  3ZE2 A;  3CFS B;  3I7K A;  2H68 A;  1K3I A;  4UI9 R;  1JTD B;  4WK4 A;  5EAM A;  4AMY A;  1N6E A;  2IWF A;  5FKT A;  4AEZ A;  4U7A A;  4GMB A;  5HE0 B;  3I7P A;  2HKM A;  5AJA A; 
#chains in the Genus database with same CATH homology
 4L9O A;  1OLZ A;  3I7H A;  4CY3 A;  3J81 g;  1U4C A;  4FB1 D;  2P9N C;  1B9X A;  3VA6 A;  1SQJ A;  2HKR A;  3C9C A;  4J0X A;  3EMH A;  3EI4 B;  3L4M D;  3SVW D;  3OW8 A;  5TEF A;  3SMR A;  5IJ7 E;  4L3G D;  5AFU 3;  1PGU A;  3FRX A;  2B5L A;  3EI1 B;  2P9U C;  5C2V B;  4FA4 D;  3OL2 B;  3L4O D;  2G99 A;  4E5Z A;  2YBA A;  3UKR C;  1K32 A;  1TBG A;  4PSX B;  4CY1 A;  2AGY A;  3A0F A;  4I79 A;  2H13 A;  2PM7 B;  4OWR A;  4PSW B;  4ERQ A;  3F3F A;  5JWZ A;  3AL8 B;  3PSC B;  4J87 A;  2HYE A;  4XYH A;  2HJ4 A;  3W15 A;  3SHF A;  2H9N A;  5K1C C;  3I89 A;  5EM2 B;  4O3U B;  2H6N A;  4GZ8 A;  1MDA H;  5TF2 A;  2OVR B;  4E54 A;  2IUP A;  3IIY A;  4LG8 A;  3I7O A;  3AFC A;  3C5M A;  3RFG A;  2YB8 B;  3BG1 A;  2H9P A;  3EG6 A;  3E0C A;  3I7L A;  2OVP B;  2I0T A;  4GGC A;  4JT5 C;  5HQG A;  5GSA A;  4A11 A;  4A09 A;  3SJL D;  3U4Y A;  3BG0 A;  3K26 A;  2AH0 A;  5CXC B;  3BWS A;  2Q7Q A;  2H9M A;  3IJ0 A;  4FAN D;  3UVO A;  1PBY B;  2CNX A;  4CZX A;  1P22 A;  3PXT D;  2I0R A;  3SFZ A;  2H6Q A;  3UVK A;  2HES X;  2Z2N A;  5EMK B;  4K3J B;  4CZV A;  2AGL A;  4O9D A;  3DXM C;  4GM3 A;  2XL2 A;  3PSL A;  2HJB A;  4NSX A;  1Q47 A;  5SXM A;  3J80 g;  5EMM B;  5CYK A;  1K8K C;  2I3S A;  2PM9 A;  4JSX C;  2YNO A;  4QRJ A;  4GQ1 A;  5EML B;  5FQD A;  3FGB A;  4QT8 A;  2IAA A;  3CFV A;  2J55 H;  3JZH A;  4D0K A;  4JT6 C;  4O45 A;  2J57 G;  4X61 B;  3JB9 L;  3PVU B;  1L0Q A;  5AMS A;  4CZY A;  1GOT B;  4ES0 A;  2AH1 A;  1GP2 B;  3EU7 A;  2XU7 A;  2H6K A;  3SWS D;  1N6D A;  4GGD A;  3N0E A;  4J78 A;  4H5I A;  3I7N A;  5I5J A;  3EI3 B;  1YFQ A;  2AGZ A;  3SBR A;  4R7A B;  2H3X A;  4A0B B;  5IT9 g;  4JD2 C;  2O9K A;  3NVN A;  5H1M A;  5CXB B;  5B4W A;  3FM0 A;  2CN2 A;  3CIK B;  3AL9 A;  3KRW B;  5FXY A;  3GRE A;  5H17 A;  3B7F A;  3SCY A;  3EWE A;  3RRM C;  4JSV C;  4ZOZ A;  3PXS D;  5FA5 B;  2B5M A;  4XYI A;  4J77 A;  1OMW B;  3DXK C;  2OJY A;  3RMZ D;  4GM8 A;  3RFH A;  4BUJ C;  5I5I A;  1QNI A;  1B9Y A;  1XKS A;  3RN1 D;  3N0D A;  4CY5 A;  2I3T A;  5GXI A;  3OKW A;  4A11 B;  4FWW A;  4A0A B;  4MK0 B;  3JRP A;  1TYQ C;  1VYH C;  3JZN A;  4QL1 A;  2CE9 A;  5FKS A;  4Z8L A;  5EAL A;  5IJ8 E;  3EI2 B;  4Y5R D;  4K3I D;  1SQ9 A;  3EI4 A;  3RN0 D;  3I8E A;  3ZWL B;  3SN6 B;  3MKS B;  4J84 A;  2YMU A;  2XL3 A;  3JZG A;  3K27 A;  4J8B A;  4J73 A;  1PEV A;  3EI1 A;  3PVW B;  3OL2 A;  4JSP C;  1RI6 A;  2BBK H;  4LG9 A;  5HE3 B;  4ERZ A;  4N14 A;  2MTA H;  4O1Q D;  3SXT D;  3F3P A;  2OVQ B;  1U2V C;  1JMX B;  2H9L A;  3DSM A;  4FA9 D;  5IGO A;  3IKO A;  4J79 A;  3HFQ A;  3AL8 A;  3F3G A;  4AOW A;  3OKY B;  3MXX A;  4FA1 D;  4KFM B;  4JXM A;  5EM2 A;  4ZOY A;  4A08 B;  5H14 A;  3ULE C;  3JAM g;  2J56 H;  3IJ1 A;  4ZN4 A;  3ORV D;  4TZ4 A;  2B4E A;  5CXC A;  2UZY B;  3UVL A;  3OKT A;  3KRX B;  4GM9 A;  5C9Z B;  4Y7R A;  5I5M A;  2PBI B;  2OK6 A;  3P4F A;  4ERY A;  2GC7 A;  1XIP A;  5EMJ B;  3IJC A;  2GC4 A;  4LGN A;  4O3T B;  4U1E I;  1N6F A;  4PBZ A;  2AGX A;  2P9P C;  4BH6 A;  4PBY A;  5TEE A;  4ESG A;  4D6V A;  3VH0 A;  5IGQ A;  4J81 A;  2AGW A;  4ZOV A;  2P9K C;  1FWX A;  2B5N A;  2G9A A;  4E5Z B;  3C99 A;  3GFC A;  2IWK A;  5HE2 B;  3SBQ A;  3OTT A;  2YNN A;  5FKR A;  3V5W B;  1JMZ B;  3PE7 A;  5THA A;  4YVD A;  4CY2 A;  1MG2 A;  3MZK A;  3I2N A;  1ERJ A;  4E54 B;  4IA9 A;  3EI3 A;  4JSN C;  4J8G A;  4CI8 A;  4G56 B;  4XEI C;  4A09 B;  4A0B A;  5GXH A;  2GNQ A;  2IUV A;  5CXB A;  4PNK B;  3MKQ A;  3VGZ A;  5HYN B;  2CN3 A;  2XYI A;  3IIW A;  4CI3 A;  1GG2 B;  2H47 A;  2P9L C;  4GGA A;  3JPX A;  3NVQ A;  2YNP A;  2OIZ A;  4L1Q D;  2CO0 A;  4PXW A;  1SHY B;  2Z2P A;  1GXR A;  2HXC A;  2QC5 A;  3UR4 A;  1A0R B;  2P9S C;  5TDH B;  3C75 H;  4GQ2 P;  2UZX B;  4FA5 D;  2EBS A;  5CYK B;  1MG3 A;  2PM9 B;  4CC9 A;  4X63 B;  2IUQ A;  2PM6 B;  4OZU A;  3SLE D;  2OK4 A;  5C2W B;  3MZL A;  2QXV A;  1NEX B;  3MMY A;  3AH8 B;  4A0A A;  4EWR A;  1JJU B;  2H14 A;  4IMM A;  5GMK n;  3RLM D;  1PI6 A;  2CO0 C;  5KDO B;  3NVX A;  4X3E A;  5K19 A;  1XHM A;  5A2Q g;  4A7J A;  3EI2 A;  4L3H D;  5HE1 B;  4PC0 A;  4J82 A;  4CI1 A;  5EAR A;  3V9F A;  5EAP A;  2W18 A;  2TRC B;  2IUR A;  4GQB B;  4HDJ A;  3ODT A;  3JRO A;  4H5J A;  4A2L A;  3UVM A;  4CI2 A;  2I0S A;  3SBP A;  4J86 A;  2BCJ B;  3UKU C;  3DWL C;  3V7D B;  5IC7 A;  4BL0 A;  3UVN A;  2P9I C;  4QQE A;  4FAV D;  2Z2O A;  3DM0 A;  1S4U X;  5FKQ A;  3I8C A;  2CE8 A;  1NR0 A;  3RSE C;  3OKY A;  4J0W A;  4ZOX A;  2AQ5 A;  3PXW D;  4A2M A;  5FLX g;  1R5M A;  4X60 B;  1JOF A;  4FHL A;  4A08 A;  3CFS B;  3I7K A;  2H68 A;  4UI9 R;  5EAM A;  1N6E A;  2IWF A;  5FKT A;  4AEZ A;  4U7A A;  4GMB A;  5HE0 B;  3I7P A;  2HKM A;  5AJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...