1PGUA

Yeast actin interacting protein 1 (aip1), se-met protein, monoclinic crystal form
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
612
structure length
606
Chain Sequence
SSISLKEIIPPQPSTQRNFTTHLSYDPTTNAIAYPCGKSAFVRCLDDGDSKVPPVVQFTGHGSSVVTTVKFSPIKGSQYLCSGDESGKVIVWGWTFDKESNSVEVNVKSEFQVLAGPISDISWDFEGRRLCVVGEGRDNFGVFISWDSGNSLGEVSGHSQRINACHLKQSRPMRSMTVGDDGSVVFYQGPPFKFSASDRTHHKQGSFVRDVEFSPDSGEFVITVGSDRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGNQQVGVVATGNGRIISLSLDGTLNFYELGHDEVLKTISGHNKGITALTVNPLISGSYDGRIMEWSSSSMHQDHSNLIVSLDNSKAQEYSSISWDDTLKVNGITKHEFGSQPKVASANNDGFTAVLTNDDDLLILQSFTGDIIKSVRLNSPGSAVSLSQNYVAVGLEEGNTIQVFKLSDLEVSFDLKTPLRAKPSYISISPSETYIAAGDVMGKILLYDLQSREVKTSRWAFRTSKINAISWKPAEEIEEDLVATGSLDTNIFIYSVKRPMKIIKALNAHKDGVNNLLWETPSTLVSSGADACIKRWNVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Actin interacting protein 1
publication title The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 159
structure length 606
sequence length 612
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pguA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pguA01
4A2LA 4ERQA 4ESGA 5CXCB 4FA4D 4K3JB 4K3ID 2H6NA 1GG2B 4FWWA 4JSVC 4O3UB 3NVQA 4CI8A 4A08B 4BL0A 4U1EI 5IGQA 3JPXA 3V5WB 3JZNA 2CE9A 3ODTA 5SXMA 2AH1A 3I8EA 5C2WB 3MZKA 4A0AB 4ZN4A 2YNPA 4A0BA 5THAA 3SJLD 5EM2B 1B9YA 4PBZA 3UVKA 3EI4A 4A2MA 2G99A 1Q47A 2P9LC 3SBQA 5HE1B 1JOFA 3FRXA 4ZOZA 3C99A 4XYHA 4PNKB 2Z2PA 3EMHA 4QL1A 3SLED 2CNXA 3MZLA 4MK0B 5HE0B 1P22A 2J56H 4J78A 4GMBA 4BH6A 1JJUB 4HDJA 2B5NA 3BG1A 4J81A 2H9NA 4L3GD 5EMLB 3SN6B 3C9CA 5K1CC 1TYQC 3N0EA 4ZOVA 5GSAA 5HQGA 3JB9L 2BCJB 3EI2A 4N14A 3DM0A 2CE8A 3RN0D 4L1QD 5H1MA 4A09A 2HYEA 1NR0A 3DXMC 5AJAA 4ZOYA 4GZ8A 3C5MA 4GM9A 4J84A 2I0SA 3VA6A 4FAVD 3EU7A 4GQ2P 2QC5A 4GGAA 4CZYA 2AH0A 3SCYA 3EI1B 2P9IC 2AGXA 1QNIA 5CXBB 3RFGA 3UKRC 3OKWA 3KRXB 3EI3A 3N0DA 4YVDA 4Z8LA 3OL2B 5C9ZB 2OK4A 2O9KA 2OK6A 3DSMA 4LGNA 3EG6A 5K19A 3CFVA 3F3GA 4GQBB 3OKYB 1MG2A 4O1QD 5IT9g 2CO0C 3GFCA 3DXKC 5GMKn 3JRPA 4LG9A 3AH8B 4NSXA 5FLXg 4O45A 2XL2A 5EMKB 1PGUA 2IAAA 1MG3A 2YNNA 4GGCA 4PBYA 3DWLC 2TRCB 4FA9D 4H5JA 4JXMA 3IJCA 4GM3A 4FAND 4A08A 3V9FA 3RLMD 3BWSA 1S4UX 1SQ9A 3FM0A 4A11B 4A0AA 3UKUC 5FKSA 4ERZA 2BBKH 5FA5B 5TEFA 2OVRB 3U4YA 3AL8B 3SBPA 4A0BB 2J55H 3BG0A 3CIKB 4UI9R 4L9OA 2Q7QA 2MTAH 2CN2A 2Z2NA 4D6VA 5H17A 2CO0A 3EI4B 2AGWA 4ZOXA 4AOWA 1GP2B 4QQEA 1MDAH 1PI6A 5C2VB 3GREA 1XHMA 4GGDA 2P9NC 3JZGA 1FWXA 2G9AA 2YMUA 3IJ0A 4IA9A 2H3XA 4CY5A 3B7FA 4ERYA 2PM9A 4PSWB 2PBIB 4O9DA 1PBYB 2I0RA 3L4OD 4OZUA 5EARA 4TZ4A 4KFMB 3V7DB 4J0XA 3SWSD 5B4WA 3KRWB 1SHYB 2UZXB 5IC7A 1B9XA 2AGZA 5I5MA 3UR4A 5I5IA 5A2Qg 4FB1D 2YNOA 1OLZA 4CY1A 1XKSA 3EI2B 1K8KC 3NVNA 3I7LA 5EAMA 1ERJA 3I7OA 3PE7A 2P9PC 3I7PA 3SMRA 3JROA 4J77A 3I2NA 2PM7B 3PSLA 5FQDA 2H9MA 1VYHC 4CZVA 3MMYA 4XEIC 4E54B 5GXIA 3OKTA 2GNQA 5EAPA 4G56B 5FKTA 4E5ZA 1U2VC 3SHFA 1N6EA 3L4MD 3IIWA 3J81g 3EI1A 3OTTA 4XYIA 4CY2A 4JT5C 4GM8A 5JWZA 3OL2A 5TEEA 5GXHA 3PXTD 3ZWLB 2HJBA 2IURA 4FA1D 2H13A 4EWRA 4JSPC 5FXYA 3UVNA 5CYKA 2I0TA 4PSXB 5FKRA 2IWFA 1JMXB 2GC7A 3OKYA 2H6KA 2XYIA 1TBGA 4A7JA 2I3SA 3EWEA 2H14A 2AGYA 4X3EA 3A0FA 5EALA 3I89A 4CY3A 3PSCB 3JAMg 5HYNB 2H47A 5CXCA 5AMSA 1R5MA 3JZHA 5AFU3 2CN3A 4X60B 4PXWA 4JSXC 2OVQB 4CI2A 2HKMA 2P9UC 4D0KA 1YFQA 4CI1A 3MKSB 2OVPB 3FGBA 3I8CA 4J82A 4Y5RD 5EM2A 2H68A 3UVMA 3UVOA 4H5IA 2W18A 3VGZA 2HESX 4A11A 3RRMC 2B5LA 4J8GA 3AL8A 5IJ7E 2YB8B 3ORVD 4QT8A 2XU7A 4LG8A 5TDHB 2IUVA 2OJYA 2YBAA 3HFQA 1GXRA 3I7KA 4J0WA 1RI6A 5KDOB 2H9LA 2H9PA 5HE2B 5IGOA 2EBSA 4FA5D 4BUJC 4J73A 3PXWD 2HKRA 4X61B 1N6FA 5HE3B 4AEZA 4CI3A 2IWKA 2B4EA 4CC9A 1N6DA 5IJ8E 2PM9B 2HJ4A 3J80g 5FKQA 1JMZB 5H14A 1U4CA 3I7HA 4FHLA 3PVUB 3UVLA 3RFHA 5TF2A 4OWRA 3RSEC 4J8BA 4J79A 4JT6C 2P9SC 4QRJA 4I79A 4PC0A 3ULEC 4ES0A 4A09B 3RN1D 5EMMB 3K26A 2I3TA 3SXTD 2PM6B 4E54A 1K32A 2J57G 2IUQA 5EMJB 3E0CA 3SBRA 3IIYA 5CXBA 4GQ1A 3AL9A 1NEXB 5I5JA 3PXSD 4E5ZB 1PEVA 4X63B 2B5MA 1GOTB 3MXXA 1OMWB 4O3TB 2XL3A 2Z2OA 2AQ5A 3IJ1A 3W15A 3F3FA 4JSNC 3EI3B 4JD2C 2UZYB 3NVXA 2P9KC 2GC4A 3AFCA 3K27A 3P4FA 2OIZA 2H6QA 4CZXA 3SFZA 3IKOA 3F3PA 3C75H 3MKQA 1SQJA 4R7AB 2AGLA 3PVWB 4Y7RA 1A0RB 4U7AA 3RMZD 2QXVA 4J86A 1L0QA 4J87A 3SVWD 3I7NA 2HXCA 5CYKB 4L3HD 3OW8A 4IMMA 3CFSB 3VH0A 2IUPA 1XIPA
chains in the Genus database with same CATH superfamily
2VDLA 4A2LA 4ERQA 4WK2A 4ESGA 3O4GA 2VDPA 5CXCB 4FA4D 4JHPC 4K3JB 4K3ID 2H6NA 1GG2B 4FWWA 4JSVC 4O3UB 3NVQA 4CI8A 4A08B 4BL0A 4U1EI 3EQ9A 3JPXA 3V5WB 5IGQA 5M5TA 3JZNA 2CE9A 3ODTA 4WJKA 1H2WA 2AH1A 3I8EA 5SXMA 5C2WB 4UM8A 3MZKA 4A0AB 4ZN4A 2YNPA 4A0BA 5THAA 3SJLD 5EM2B 1B9YA 1O6GA 2VDKA 2XZGA 4BP8A 4PBZA 3UVKA 3GD1I 3EI4A 4A2MA 2G99A 1Q47A 3VI3A 2P9LC 3SBQA 5HE1B 4AN1A 1JOFA 3FRXA 2VZ3A 4ZOZA 4G1EA 3C99A 4XYHA 4PNKB 5M5RA 4JHNA 1E5TA 1UTCA 2Z2PA 3EMHA 2VZ1A 4QL1A 3SLED 1GOHA 4BP9A 2CNXA 3MZLA 4MK0B 3DDUA 2HU7A 5HE0B 1I2MB 1P22A 2J56H 4J78A 4GMBA 4BH6A 1JJUB 4HDJA 2B5NA 3BG1A 4J81A 2H9NA 4G1MA 4L3GD 5EMLB 5HDBA 3SN6B 5E6RA 3C9CA 5K1CC 1TYQC 3GC3B 3N0EA 4ZOVA 5GSAA 5HQGA 3JB9L 2BCJB 1JV2A 1VZ2A 3EI2A 4MMYA 4RE5A 4N14A 4Z7NA 3VI4A 3DM0A 1A12A 2CE8A 3RN0D 4L1QD 4MMZA 3ZDXA 5H1MA 4A09A 2HYEA 1NR0A 3DXMC 5AJAA 4ZOYA 1H2ZA 4GZ8A 3C5MA 4MMXA 3O4HA 4GM9A 1TYEA 4AN0A 4J84A 2I0SA 3VA6A 4FAVD 3EU7A 4GQ2P 2QC5A 4GGAA 4CZYA 1UOOA 2AH0A 3SCYA 3NIDA 2P9IC 3EI1B 2AGXA 1QNIA 5CXBB 3RFGA 3UKRC 3OKWA 3KRXB 1K3IA 3EI3A 2HU5A 3N0DA 4YVDA 4Z8LA 3OL2B 1H2XA 5C9ZB 2OK4A 4Z7OA 2O9KA 2VDMA 2OK6A 3DSMA 3IUQA 4LGNA 3EG6A 5K19A 3CFVA 3F3GA 4GQBB 3OKYB 1MG2A 4O1QD 4Z7QA 2CO0C 3GFCA 3ZE2A 5IT9g 3DXKC 5GMKn 2QR5A 3JRPA 4LG9A 3AH8B 4NSXA 5FLXg 4O45A 2XL2A 5EMKB 2VDQA 1PGUA 2IAAA 1MG3A 2YNNA 4GGCA 1VE6A 4PBYA 3O4IA 3DWLC 3IURA 2TRCB 4FA9D 3MUOA 4H5JA 4JXMA 3IJCA 4AX4A 4GM3A 4FAND 4A08A 3V9FA 3NIFA 3RLMD 3BWSA 1S4UX 1SQ9A 3FM0A 4A11B 4A0AA 3UKUC 5FKSA 4ERZA 2BBKH 5FA5B 5TEFA 2OVRB 3U4YA 3AL8B 3SBPA 4NBMA 4A0BB 2J55H 3ZE0A 1GOGA 1O6FA 3BG0A 3CIKB 4UI9R 4L9OA 2Q7QA 2MTAH 2CN2A 2QZPA 2Z2NA 4D6VA 5H17A 2CO0A 3EI4B 3EQ7A 2AGWA 4ZOXA 4RE6A 4AOWA 1C9IA 1GP2B 4QQEA 3K6SA 1MDAH 1PI6A 5C2VB 3GREA 1XHMA 4GGDA 2P9NC 3JZGA 1FWXA 2G9AA 2YMUA 3IJ0A 4IA9A 2H3XA 4CY5A 3B7FA 4ERYA 2PM9A 4PSWB 2PBIB 4O9DA 1PBYB 2I0RA 3L4OD 3T3MA 4OZUA 5EARA 4TZ4A 4KFMB 3V7DB 4J0XA 3SWSD 5B4WA 3KCIA 1E8MA 3KRWB 1SHYB 2UZXB 5IC7A 3OF7A 1B9XA 2VC2A 2AGZA 5I5MA 3UR4A 5I5IA 5A2Qg 4FB1D 2EIDA 4AMZA 2YNOA 3O4JA 1OLZA 4CY1A 1XKSA 2EIEA 3EI2B 1K8KC 4UM9A 3NVNA 3I7LA 5EAMA 1ERJA 3I7OA 3PE7A 2P9PC 3I7PA 3FCUA 3SMRA 5C86A 3JROA 4J77A 3I2NA 2PM7B 3PSLA 5FQDA 3IVMA 2H9MA 1VYHC 4CZVA 4O02A 3MMYA 4XEIC 4E54B 5GXIA 3OKTA 2GNQA 5EAPA 4G56B 5FKTA 4E5ZA 1U2VC 3SHFA 1N6EA 3L4MD 1L5GA 3IIWA 3J81g 3EI1A 3OTTA 4XYIA 4CY2A 1YR2A 3K72A 1H2YA 2JKXA 4JT5C 4GM8A 5JWZA 3OL2A 5TEEA 5M5SA 3FCSA 5GXHA 3PXTD 4DNVA 5M61A 3ZWLB 2HJBA 2XE4A 3T3PA 2IURA 4FA1D 2H13A 4EWRA 4NENA 4JSPC 4BCCA 4BCBA 1GOFA 5FXYA 3UVNA 5CYKA 2I0TA 4PSXB 1E8NA 5C92A 5FKRA 2IWFA 1JMXB 2GC7A 3OKYA 2H6KA 2XYIA 4NAAA 1TBGA 2VDOA 5FFOA 2I3SA 4A7JA 3EWEA 2H14A 2AGYA 4X3EA 3V4PA 3A0FA 5EALA 3I89A 4CY3A 3PSCB 3JAMg 1QFSA 5HYNB 1T2XA 2H47A 5CXCA 2EIBA 4O2WA 1R5MA 3JZHA 5AMSA 5AFU3 1QFMA 2CN3A 4X60B 4PXWA 3ZDYA 1UOPA 4JSXC 2OVQB 4CI2A 2HKMA 3K71A 4AMYA 2P9UC 4QAMA 4D0KA 1YFQA 4CI1A 3MKSB 2OVPB 3FGBA 4BCDA 3I8CA 4J82A 4Y5RD 5EM2A 2H68A 2HU8A 3EQ8A 3UVOA 3UVMA 4H5IA 2W18A 3VGZA 3NIGA 2HESX 4A11A 3RRMC 1UOQA 2B5LA 3IUNA 4J8GA 1VE7A 3MUNA 3AL8A 5IJ7E 2YB8B 3IJEA 3ORVD 4QT8A 2XU7A 4LG8A 4G55A 5E6UA 5TDHB 2BKLA 2IUVA 1U8CA 2OJYA 2EICA 2YBAA 3HFQA 1GXRA 3I7KA 4IRZA 4J0WA 2WQ8A 1RI6A 5KDOB 2VDRA 2H9LA 2H9PA 5HE2B 5IGOA 2EBSA 4FA5D 4BUJC 4J73A 3PXWD 1JTDB 2HKRA 4X61B 1N6FA 5HE3B 4AEZA 4CI3A 3MVDK 2IWKA 3QHYB 2B4EA 5M5VA 4CC9A 1N6DA 5IJ8E 2PM9B 4L1MA 2HJ4A 3J80g 4DNUA 3QI0A 5FKQA 1JMZB 5H14A 1M1XA 1U4CA 3I7HA 1BPOA 4FHLA 3PVUB 3UVLA 3RFHA 5TF2A 4OWRA 3RSEC 4J8BA 4J79A 4JT6C 2P9SC 3IUMA 4QRJA 4I79A 4PC0A 3ULEC 4ES0A 3V4VA 4A09B 1VZ3A 3RN1D 4D9SA 5EMMB 3K26A 2I3TA 4WK0A 3SXTD 4DNWA 3IUJA 2PM6B 4E54A 1K32A 2J57G 2IUQA 5EMJB 3E0CA 4WK4A 3SBRA 3IIYA 5CXBA 4GQ1A 3AL9A 2VDNA 1NEXB 3ZE1A 5I5JA 3PXSD 4E5ZB 1PEVA 4X63B 3MXXA 1GOTB 2B5MA 2XDWA 1OMWB 4O3TB 2XL3A 2Z2OA 2AQ5A 3IJ1A 3W15A 3F3FA 4JSNC 3EI3B 4JD2C 2UZYB 3IULA 3NVXA 2P9KC 2GC4A 3AFCA 3K27A 3P4FA 2OIZA 2H6QA 4CZXA 3SFZA 3IKOA 3F3PA 4NC4A 3C75H 3MKQA 1SQJA 5M5UA 4R7AB 2AGLA 3PVWB 4Y7RA 5E6SA 1C9LA 1A0RB 4U7AA 3RMZD 3ZDZA 2QXVA 4J86A 1L0QA 4J87A 3SVWD 3I7NA 2HXCA 5CYKB 4L3HD 3OW8A 5FFGA 4IMMA 3CFSB 3VH0A 2IUPA 1XIPA
chains in the Genus database with same CATH topology
4A2LA 4ERQA 4ESGA 5CXCB 4FA4D 4K3JB 4K3ID 2H6NA 1GG2B 4FWWA 4JSVC 4O3UB 3NVQA 4CI8A 4A08B 4BL0A 4U1EI 5IGQA 3JPXA 3V5WB 3JZNA 2CE9A 3ODTA 5SXMA 2AH1A 3I8EA 5C2WB 3MZKA 4A0AB 4ZN4A 2YNPA 4A0BA 5THAA 3SJLD 5EM2B 1B9YA 4PBZA 3UVKA 3EI4A 4A2MA 2G99A 1Q47A 2P9LC 3SBQA 5HE1B 1JOFA 3FRXA 4ZOZA 3C99A 4XYHA 4PNKB 2Z2PA 3EMHA 4QL1A 3SLED 2CNXA 3MZLA 4MK0B 5HE0B 1P22A 2J56H 4J78A 4GMBA 4BH6A 1JJUB 4HDJA 2B5NA 3BG1A 4J81A 2H9NA 4L3GD 5EMLB 3SN6B 3C9CA 5K1CC 1TYQC 3N0EA 4ZOVA 5GSAA 5HQGA 3JB9L 2BCJB 3EI2A 4N14A 3DM0A 2CE8A 3RN0D 4L1QD 5H1MA 4A09A 2HYEA 1NR0A 3DXMC 5AJAA 4ZOYA 4GZ8A 3C5MA 4GM9A 4J84A 2I0SA 3VA6A 4FAVD 3EU7A 4GQ2P 2QC5A 4GGAA 4CZYA 2AH0A 3SCYA 3EI1B 2P9IC 2AGXA 1QNIA 5CXBB 3RFGA 3UKRC 3OKWA 3KRXB 3EI3A 3N0DA 4YVDA 4Z8LA 3OL2B 5C9ZB 2OK4A 2O9KA 2OK6A 3DSMA 4LGNA 3EG6A 5K19A 3CFVA 3F3GA 4GQBB 3OKYB 1MG2A 4O1QD 5IT9g 2CO0C 3GFCA 3DXKC 5GMKn 3JRPA 4LG9A 3AH8B 4NSXA 5FLXg 4O45A 2XL2A 5EMKB 1PGUA 2IAAA 1MG3A 2YNNA 4GGCA 4PBYA 3DWLC 2TRCB 4FA9D 4H5JA 4JXMA 3IJCA 4GM3A 4FAND 4A08A 3V9FA 3RLMD 3BWSA 1S4UX 1SQ9A 3FM0A 4A11B 4A0AA 3UKUC 5FKSA 4ERZA 2BBKH 5FA5B 5TEFA 2OVRB 3U4YA 3AL8B 3SBPA 4A0BB 2J55H 3BG0A 3CIKB 4UI9R 4L9OA 2Q7QA 2MTAH 2CN2A 2Z2NA 4D6VA 5H17A 2CO0A 3EI4B 2AGWA 4ZOXA 4AOWA 1GP2B 4QQEA 1MDAH 1PI6A 5C2VB 3GREA 1XHMA 4GGDA 2P9NC 3JZGA 1FWXA 2G9AA 2YMUA 3IJ0A 4IA9A 2H3XA 4CY5A 3B7FA 4ERYA 2PM9A 4PSWB 2PBIB 4O9DA 1PBYB 2I0RA 3L4OD 4OZUA 5EARA 4TZ4A 4KFMB 3V7DB 4J0XA 3SWSD 5B4WA 3KRWB 1SHYB 2UZXB 5IC7A 1B9XA 2AGZA 5I5MA 3UR4A 5I5IA 5A2Qg 4FB1D 2YNOA 1OLZA 4CY1A 1XKSA 3EI2B 1K8KC 3NVNA 3I7LA 5EAMA 1ERJA 3I7OA 3PE7A 2P9PC 3I7PA 3SMRA 3JROA 4J77A 3I2NA 2PM7B 3PSLA 5FQDA 2H9MA 1VYHC 4CZVA 3MMYA 4XEIC 4E54B 5GXIA 3OKTA 2GNQA 5EAPA 4G56B 5FKTA 4E5ZA 1U2VC 3SHFA 1N6EA 3L4MD 3IIWA 3J81g 3EI1A 3OTTA 4XYIA 4CY2A 4JT5C 4GM8A 5JWZA 3OL2A 5TEEA 5GXHA 3PXTD 3ZWLB 2HJBA 2IURA 4FA1D 2H13A 4EWRA 4JSPC 5FXYA 3UVNA 5CYKA 2I0TA 4PSXB 5FKRA 2IWFA 1JMXB 2GC7A 3OKYA 2H6KA 2XYIA 1TBGA 4A7JA 2I3SA 3EWEA 2H14A 2AGYA 4X3EA 3A0FA 5EALA 3I89A 4CY3A 3PSCB 3JAMg 5HYNB 2H47A 5CXCA 5AMSA 1R5MA 3JZHA 5AFU3 2CN3A 4X60B 4PXWA 4JSXC 2OVQB 4CI2A 2HKMA 2P9UC 4D0KA 1YFQA 4CI1A 3MKSB 2OVPB 3FGBA 3I8CA 4J82A 4Y5RD 5EM2A 2H68A 3UVMA 3UVOA 4H5IA 2W18A 3VGZA 2HESX 4A11A 3RRMC 2B5LA 4J8GA 3AL8A 5IJ7E 2YB8B 3ORVD 4QT8A 2XU7A 4LG8A 5TDHB 2IUVA 2OJYA 2YBAA 3HFQA 1GXRA 3I7KA 4J0WA 1RI6A 5KDOB 2H9LA 2H9PA 5HE2B 5IGOA 2EBSA 4FA5D 4BUJC 4J73A 3PXWD 2HKRA 4X61B 1N6FA 5HE3B 4AEZA 4CI3A 2IWKA 2B4EA 4CC9A 1N6DA 5IJ8E 2PM9B 2HJ4A 3J80g 5FKQA 1JMZB 5H14A 1U4CA 3I7HA 4FHLA 3PVUB 3UVLA 3RFHA 5TF2A 4OWRA 3RSEC 4J8BA 4J79A 4JT6C 2P9SC 4QRJA 4I79A 4PC0A 3ULEC 4ES0A 4A09B 3RN1D 5EMMB 3K26A 2I3TA 3SXTD 2PM6B 4E54A 1K32A 2J57G 2IUQA 5EMJB 3E0CA 3SBRA 3IIYA 5CXBA 4GQ1A 3AL9A 1NEXB 5I5JA 3PXSD 4E5ZB 1PEVA 4X63B 2B5MA 1GOTB 3MXXA 1OMWB 4O3TB 2XL3A 2Z2OA 2AQ5A 3IJ1A 3W15A 3F3FA 4JSNC 3EI3B 4JD2C 2UZYB 3NVXA 2P9KC 2GC4A 3AFCA 3K27A 3P4FA 2OIZA 2H6QA 4CZXA 3SFZA 3IKOA 3F3PA 3C75H 3MKQA 1SQJA 4R7AB 2AGLA 3PVWB 4Y7RA 1A0RB 4U7AA 3RMZD 2QXVA 4J86A 1L0QA 4J87A 3SVWD 3I7NA 2HXCA 5CYKB 4L3HD 3OW8A 4IMMA 3CFSB 3VH0A 2IUPA 1XIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2L A;  4ERQ A;  4ESG A;  5CXC B;  4FA4 D;  4K3J B;  4K3I D;  2H6N A;  1GG2 B;  4FWW A;  4JSV C;  4O3U B;  3NVQ A;  4CI8 A;  4A08 B;  4BL0 A;  4U1E I;  5IGQ A;  3JPX A;  3V5W B;  3JZN A;  2CE9 A;  3ODT A;  5SXM A;  2AH1 A;  3I8E A;  5C2W B;  3MZK A;  4A0A B;  4ZN4 A;  2YNP A;  4A0B A;  5THA A;  3SJL D;  5EM2 B;  1B9Y A;  4PBZ A;  3UVK A;  3EI4 A;  4A2M A;  2G99 A;  1Q47 A;  2P9L C;  3SBQ A;  5HE1 B;  1JOF A;  3FRX A;  4ZOZ A;  3C99 A;  4XYH A;  4PNK B;  2Z2P A;  3EMH A;  4QL1 A;  3SLE D;  2CNX A;  3MZL A;  4MK0 B;  5HE0 B;  1P22 A;  2J56 H;  4J78 A;  4GMB A;  4BH6 A;  1JJU B;  4HDJ A;  2B5N A;  3BG1 A;  4J81 A;  2H9N A;  4L3G D;  5EML B;  3SN6 B;  3C9C A;  5K1C C;  1TYQ C;  3N0E A;  4ZOV A;  5GSA A;  5HQG A;  3JB9 L;  2BCJ B;  3EI2 A;  4N14 A;  3DM0 A;  2CE8 A;  3RN0 D;  4L1Q D;  5H1M A;  4A09 A;  2HYE A;  1NR0 A;  3DXM C;  5AJA A;  4ZOY A;  4GZ8 A;  3C5M A;  4GM9 A;  4J84 A;  2I0S A;  3VA6 A;  4FAV D;  3EU7 A;  4GQ2 P;  2QC5 A;  4GGA A;  4CZY A;  2AH0 A;  3SCY A;  3EI1 B;  2P9I C;  2AGX A;  1QNI A;  5CXB B;  3RFG A;  3UKR C;  3OKW A;  3KRX B;  3EI3 A;  3N0D A;  4YVD A;  4Z8L A;  3OL2 B;  5C9Z B;  2OK4 A;  2O9K A;  2OK6 A;  3DSM A;  4LGN A;  3EG6 A;  5K19 A;  3CFV A;  3F3G A;  4GQB B;  3OKY B;  1MG2 A;  4O1Q D;  5IT9 g;  2CO0 C;  3GFC A;  3DXK C;  5GMK n;  3JRP A;  4LG9 A;  3AH8 B;  4NSX A;  5FLX g;  4O45 A;  2XL2 A;  5EMK B;  1PGU A;  2IAA A;  1MG3 A;  2YNN A;  4GGC A;  4PBY A;  3DWL C;  2TRC B;  4FA9 D;  4H5J A;  4JXM A;  3IJC A;  4GM3 A;  4FAN D;  4A08 A;  3V9F A;  3RLM D;  3BWS A;  1S4U X;  1SQ9 A;  3FM0 A;  4A11 B;  4A0A A;  3UKU C;  5FKS A;  4ERZ A;  2BBK H;  5FA5 B;  5TEF A;  2OVR B;  3U4Y A;  3AL8 B;  3SBP A;  4A0B B;  2J55 H;  3BG0 A;  3CIK B;  4UI9 R;  4L9O A;  2Q7Q A;  2MTA H;  2CN2 A;  2Z2N A;  4D6V A;  5H17 A;  2CO0 A;  3EI4 B;  2AGW A;  4ZOX A;  4AOW A;  1GP2 B;  4QQE A;  1MDA H;  1PI6 A;  5C2V B;  3GRE A;  1XHM A;  4GGD A;  2P9N C;  3JZG A;  1FWX A;  2G9A A;  2YMU A;  3IJ0 A;  4IA9 A;  2H3X A;  4CY5 A;  3B7F A;  4ERY A;  2PM9 A;  4PSW B;  2PBI B;  4O9D A;  1PBY B;  2I0R A;  3L4O D;  4OZU A;  5EAR A;  4TZ4 A;  4KFM B;  3V7D B;  4J0X A;  3SWS D;  5B4W A;  3KRW B;  1SHY B;  2UZX B;  5IC7 A;  1B9X A;  2AGZ A;  5I5M A;  3UR4 A;  5I5I A;  5A2Q g;  4FB1 D;  2YNO A;  1OLZ A;  4CY1 A;  1XKS A;  3EI2 B;  1K8K C;  3NVN A;  3I7L A;  5EAM A;  1ERJ A;  3I7O A;  3PE7 A;  2P9P C;  3I7P A;  3SMR A;  3JRO A;  4J77 A;  3I2N A;  2PM7 B;  3PSL A;  5FQD A;  2H9M A;  1VYH C;  4CZV A;  3MMY A;  4XEI C;  4E54 B;  5GXI A;  3OKT A;  2GNQ A;  5EAP A;  4G56 B;  5FKT A;  4E5Z A;  1U2V C;  3SHF A;  1N6E A;  3L4M D;  3IIW A;  3J81 g;  3EI1 A;  3OTT A;  4XYI A;  4CY2 A;  4JT5 C;  4GM8 A;  5JWZ A;  3OL2 A;  5TEE A;  5GXH A;  3PXT D;  3ZWL B;  2HJB A;  2IUR A;  4FA1 D;  2H13 A;  4EWR A;  4JSP C;  5FXY A;  3UVN A;  5CYK A;  2I0T A;  4PSX B;  5FKR A;  2IWF A;  1JMX B;  2GC7 A;  3OKY A;  2H6K A;  2XYI A;  1TBG A;  4A7J A;  2I3S A;  3EWE A;  2H14 A;  2AGY A;  4X3E A;  3A0F A;  5EAL A;  3I89 A;  4CY3 A;  3PSC B;  3JAM g;  5HYN B;  2H47 A;  5CXC A;  5AMS A;  1R5M A;  3JZH A;  5AFU 3;  2CN3 A;  4X60 B;  4PXW A;  4JSX C;  2OVQ B;  4CI2 A;  2HKM A;  2P9U C;  4D0K A;  1YFQ A;  4CI1 A;  3MKS B;  2OVP B;  3FGB A;  3I8C A;  4J82 A;  4Y5R D;  5EM2 A;  2H68 A;  3UVM A;  3UVO A;  4H5I A;  2W18 A;  3VGZ A;  2HES X;  4A11 A;  3RRM C;  2B5L A;  4J8G A;  3AL8 A;  5IJ7 E;  2YB8 B;  3ORV D;  4QT8 A;  2XU7 A;  4LG8 A;  5TDH B;  2IUV A;  2OJY A;  2YBA A;  3HFQ A;  1GXR A;  3I7K A;  4J0W A;  1RI6 A;  5KDO B;  2H9L A;  2H9P A;  5HE2 B;  5IGO A;  2EBS A;  4FA5 D;  4BUJ C;  4J73 A;  3PXW D;  2HKR A;  4X61 B;  1N6F A;  5HE3 B;  4AEZ A;  4CI3 A;  2IWK A;  2B4E A;  4CC9 A;  1N6D A;  5IJ8 E;  2PM9 B;  2HJ4 A;  3J80 g;  5FKQ A;  1JMZ B;  5H14 A;  1U4C A;  3I7H A;  4FHL A;  3PVU B;  3UVL A;  3RFH A;  5TF2 A;  4OWR A;  3RSE C;  4J8B A;  4J79 A;  4JT6 C;  2P9S C;  4QRJ A;  4I79 A;  4PC0 A;  3ULE C;  4ES0 A;  4A09 B;  3RN1 D;  5EMM B;  3K26 A;  2I3T A;  3SXT D;  2PM6 B;  4E54 A;  1K32 A;  2J57 G;  2IUQ A;  5EMJ B;  3E0C A;  3SBR A;  3IIY A;  5CXB A;  4GQ1 A;  3AL9 A;  1NEX B;  5I5J A;  3PXS D;  4E5Z B;  1PEV A;  4X63 B;  2B5M A;  1GOT B;  3MXX A;  1OMW B;  4O3T B;  2XL3 A;  2Z2O A;  2AQ5 A;  3IJ1 A;  3W15 A;  3F3F A;  4JSN C;  3EI3 B;  4JD2 C;  2UZY B;  3NVX A;  2P9K C;  2GC4 A;  3AFC A;  3K27 A;  3P4F A;  2OIZ A;  2H6Q A;  4CZX A;  3SFZ A;  3IKO A;  3F3P A;  3C75 H;  3MKQ A;  1SQJ A;  4R7A B;  2AGL A;  3PVW B;  4Y7R A;  1A0R B;  4U7A A;  3RMZ D;  2QXV A;  4J86 A;  1L0Q A;  4J87 A;  3SVW D;  3I7N A;  2HXC A;  5CYK B;  4L3H D;  3OW8 A;  4IMM A;  3CFS B;  3VH0 A;  2IUP A;  1XIP A; 
#chains in the Genus database with same CATH topology
 2VDL A;  4A2L A;  4ERQ A;  4WK2 A;  4ESG A;  3O4G A;  2VDP A;  5CXC B;  4FA4 D;  4JHP C;  4K3J B;  4K3I D;  2H6N A;  1GG2 B;  4FWW A;  4JSV C;  4O3U B;  3NVQ A;  4CI8 A;  4A08 B;  4BL0 A;  4U1E I;  3EQ9 A;  3JPX A;  3V5W B;  5IGQ A;  5M5T A;  3JZN A;  2CE9 A;  3ODT A;  4WJK A;  1H2W A;  2AH1 A;  3I8E A;  5SXM A;  5C2W B;  4UM8 A;  3MZK A;  4A0A B;  4ZN4 A;  2YNP A;  4A0B A;  5THA A;  3SJL D;  5EM2 B;  1B9Y A;  1O6G A;  2VDK A;  2XZG A;  4BP8 A;  4PBZ A;  3UVK A;  3GD1 I;  3EI4 A;  4A2M A;  2G99 A;  1Q47 A;  3VI3 A;  2P9L C;  3SBQ A;  5HE1 B;  4AN1 A;  1JOF A;  3FRX A;  2VZ3 A;  4ZOZ A;  4G1E A;  3C99 A;  4XYH A;  4PNK B;  5M5R A;  4JHN A;  1E5T A;  1UTC A;  2Z2P A;  3EMH A;  2VZ1 A;  4QL1 A;  3SLE D;  1GOH A;  4BP9 A;  2CNX A;  3MZL A;  4MK0 B;  3DDU A;  2HU7 A;  5HE0 B;  1I2M B;  1P22 A;  2J56 H;  4J78 A;  4GMB A;  4BH6 A;  1JJU B;  4HDJ A;  2B5N A;  3BG1 A;  4J81 A;  2H9N A;  4G1M A;  4L3G D;  5EML B;  5HDB A;  3SN6 B;  5E6R A;  3C9C A;  5K1C C;  1TYQ C;  3GC3 B;  3N0E A;  4ZOV A;  5GSA A;  5HQG A;  3JB9 L;  2BCJ B;  1JV2 A;  1VZ2 A;  3EI2 A;  4MMY A;  4RE5 A;  4N14 A;  4Z7N A;  3VI4 A;  3DM0 A;  1A12 A;  2CE8 A;  3RN0 D;  4L1Q D;  4MMZ A;  3ZDX A;  5H1M A;  4A09 A;  2HYE A;  1NR0 A;  3DXM C;  5AJA A;  4ZOY A;  1H2Z A;  4GZ8 A;  3C5M A;  4MMX A;  3O4H A;  4GM9 A;  1TYE A;  4AN0 A;  4J84 A;  2I0S A;  3VA6 A;  4FAV D;  3EU7 A;  4GQ2 P;  2QC5 A;  4GGA A;  4CZY A;  1UOO A;  2AH0 A;  3SCY A;  3NID A;  2P9I C;  3EI1 B;  2AGX A;  1QNI A;  5CXB B;  3RFG A;  3UKR C;  3OKW A;  3KRX B;  1K3I A;  3EI3 A;  2HU5 A;  3N0D A;  4YVD A;  4Z8L A;  3OL2 B;  1H2X A;  5C9Z B;  2OK4 A;  4Z7O A;  2O9K A;  2VDM A;  2OK6 A;  3DSM A;  3IUQ A;  4LGN A;  3EG6 A;  5K19 A;  3CFV A;  3F3G A;  4GQB B;  3OKY B;  1MG2 A;  4O1Q D;  4Z7Q A;  2CO0 C;  3GFC A;  3ZE2 A;  5IT9 g;  3DXK C;  5GMK n;  2QR5 A;  3JRP A;  4LG9 A;  3AH8 B;  4NSX A;  5FLX g;  4O45 A;  2XL2 A;  5EMK B;  2VDQ A;  1PGU A;  2IAA A;  1MG3 A;  2YNN A;  4GGC A;  1VE6 A;  4PBY A;  3O4I A;  3DWL C;  3IUR A;  2TRC B;  4FA9 D;  3MUO A;  4H5J A;  4JXM A;  3IJC A;  4AX4 A;  4GM3 A;  4FAN D;  4A08 A;  3V9F A;  3NIF A;  3RLM D;  3BWS A;  1S4U X;  1SQ9 A;  3FM0 A;  4A11 B;  4A0A A;  3UKU C;  5FKS A;  4ERZ A;  2BBK H;  5FA5 B;  5TEF A;  2OVR B;  3U4Y A;  3AL8 B;  3SBP A;  4NBM A;  4A0B B;  2J55 H;  3ZE0 A;  1GOG A;  1O6F A;  3BG0 A;  3CIK B;  4UI9 R;  4L9O A;  2Q7Q A;  2MTA H;  2CN2 A;  2QZP A;  2Z2N A;  4D6V A;  5H17 A;  2CO0 A;  3EI4 B;  3EQ7 A;  2AGW A;  4ZOX A;  4RE6 A;  4AOW A;  1C9I A;  1GP2 B;  4QQE A;  3K6S A;  1MDA H;  1PI6 A;  5C2V B;  3GRE A;  1XHM A;  4GGD A;  2P9N C;  3JZG A;  1FWX A;  2G9A A;  2YMU A;  3IJ0 A;  4IA9 A;  2H3X A;  4CY5 A;  3B7F A;  4ERY A;  2PM9 A;  4PSW B;  2PBI B;  4O9D A;  1PBY B;  2I0R A;  3L4O D;  3T3M A;  4OZU A;  5EAR A;  4TZ4 A;  4KFM B;  3V7D B;  4J0X A;  3SWS D;  5B4W A;  3KCI A;  1E8M A;  3KRW B;  1SHY B;  2UZX B;  5IC7 A;  3OF7 A;  1B9X A;  2VC2 A;  2AGZ A;  5I5M A;  3UR4 A;  5I5I A;  5A2Q g;  4FB1 D;  2EID A;  4AMZ A;  2YNO A;  3O4J A;  1OLZ A;  4CY1 A;  1XKS A;  2EIE A;  3EI2 B;  1K8K C;  4UM9 A;  3NVN A;  3I7L A;  5EAM A;  1ERJ A;  3I7O A;  3PE7 A;  2P9P C;  3I7P A;  3FCU A;  3SMR A;  5C86 A;  3JRO A;  4J77 A;  3I2N A;  2PM7 B;  3PSL A;  5FQD A;  3IVM A;  2H9M A;  1VYH C;  4CZV A;  4O02 A;  3MMY A;  4XEI C;  4E54 B;  5GXI A;  3OKT A;  2GNQ A;  5EAP A;  4G56 B;  5FKT A;  4E5Z A;  1U2V C;  3SHF A;  1N6E A;  3L4M D;  1L5G A;  3IIW A;  3J81 g;  3EI1 A;  3OTT A;  4XYI A;  4CY2 A;  1YR2 A;  3K72 A;  1H2Y A;  2JKX A;  4JT5 C;  4GM8 A;  5JWZ A;  3OL2 A;  5TEE A;  5M5S A;  3FCS A;  5GXH A;  3PXT D;  4DNV A;  5M61 A;  3ZWL B;  2HJB A;  2XE4 A;  3T3P A;  2IUR A;  4FA1 D;  2H13 A;  4EWR A;  4NEN A;  4JSP C;  4BCC A;  4BCB A;  1GOF A;  5FXY A;  3UVN A;  5CYK A;  2I0T A;  4PSX B;  1E8N A;  5C92 A;  5FKR A;  2IWF A;  1JMX B;  2GC7 A;  3OKY A;  2H6K A;  2XYI A;  4NAA A;  1TBG A;  2VDO A;  5FFO A;  2I3S A;  4A7J A;  3EWE A;  2H14 A;  2AGY A;  4X3E A;  3V4P A;  3A0F A;  5EAL A;  3I89 A;  4CY3 A;  3PSC B;  3JAM g;  1QFS A;  5HYN B;  1T2X A;  2H47 A;  5CXC A;  2EIB A;  4O2W A;  1R5M A;  3JZH A;  5AMS A;  5AFU 3;  1QFM A;  2CN3 A;  4X60 B;  4PXW A;  3ZDY A;  1UOP A;  4JSX C;  2OVQ B;  4CI2 A;  2HKM A;  3K71 A;  4AMY A;  2P9U C;  4QAM A;  4D0K A;  1YFQ A;  4CI1 A;  3MKS B;  2OVP B;  3FGB A;  4BCD A;  3I8C A;  4J82 A;  4Y5R D;  5EM2 A;  2H68 A;  2HU8 A;  3EQ8 A;  3UVO A;  3UVM A;  4H5I A;  2W18 A;  3VGZ A;  3NIG A;  2HES X;  4A11 A;  3RRM C;  1UOQ A;  2B5L A;  3IUN A;  4J8G A;  1VE7 A;  3MUN A;  3AL8 A;  5IJ7 E;  2YB8 B;  3IJE A;  3ORV D;  4QT8 A;  2XU7 A;  4LG8 A;  4G55 A;  5E6U A;  5TDH B;  2BKL A;  2IUV A;  1U8C A;  2OJY A;  2EIC A;  2YBA A;  3HFQ A;  1GXR A;  3I7K A;  4IRZ A;  4J0W A;  2WQ8 A;  1RI6 A;  5KDO B;  2VDR A;  2H9L A;  2H9P A;  5HE2 B;  5IGO A;  2EBS A;  4FA5 D;  4BUJ C;  4J73 A;  3PXW D;  1JTD B;  2HKR A;  4X61 B;  1N6F A;  5HE3 B;  4AEZ A;  4CI3 A;  3MVD K;  2IWK A;  3QHY B;  2B4E A;  5M5V A;  4CC9 A;  1N6D A;  5IJ8 E;  2PM9 B;  4L1M A;  2HJ4 A;  3J80 g;  4DNU A;  3QI0 A;  5FKQ A;  1JMZ B;  5H14 A;  1M1X A;  1U4C A;  3I7H A;  1BPO A;  4FHL A;  3PVU B;  3UVL A;  3RFH A;  5TF2 A;  4OWR A;  3RSE C;  4J8B A;  4J79 A;  4JT6 C;  2P9S C;  3IUM A;  4QRJ A;  4I79 A;  4PC0 A;  3ULE C;  4ES0 A;  3V4V A;  4A09 B;  1VZ3 A;  3RN1 D;  4D9S A;  5EMM B;  3K26 A;  2I3T A;  4WK0 A;  3SXT D;  4DNW A;  3IUJ A;  2PM6 B;  4E54 A;  1K32 A;  2J57 G;  2IUQ A;  5EMJ B;  3E0C A;  4WK4 A;  3SBR A;  3IIY A;  5CXB A;  4GQ1 A;  3AL9 A;  2VDN A;  1NEX B;  3ZE1 A;  5I5J A;  3PXS D;  4E5Z B;  1PEV A;  4X63 B;  3MXX A;  1GOT B;  2B5M A;  2XDW A;  1OMW B;  4O3T B;  2XL3 A;  2Z2O A;  2AQ5 A;  3IJ1 A;  3W15 A;  3F3F A;  4JSN C;  3EI3 B;  4JD2 C;  2UZY B;  3IUL A;  3NVX A;  2P9K C;  2GC4 A;  3AFC A;  3K27 A;  3P4F A;  2OIZ A;  2H6Q A;  4CZX A;  3SFZ A;  3IKO A;  3F3P A;  4NC4 A;  3C75 H;  3MKQ A;  1SQJ A;  5M5U A;  4R7A B;  2AGL A;  3PVW B;  4Y7R A;  5E6S A;  1C9L A;  1A0R B;  4U7A A;  3RMZ D;  3ZDZ A;  2QXV A;  4J86 A;  1L0Q A;  4J87 A;  3SVW D;  3I7N A;  2HXC A;  5CYK B;  4L3H D;  3OW8 A;  5FFG A;  4IMM A;  3CFS B;  3VH0 A;  2IUP A;  1XIP A; 
#chains in the Genus database with same CATH homology
 4A2L A;  4ERQ A;  4ESG A;  5CXC B;  4FA4 D;  4K3J B;  4K3I D;  2H6N A;  1GG2 B;  4FWW A;  4JSV C;  4O3U B;  3NVQ A;  4CI8 A;  4A08 B;  4BL0 A;  4U1E I;  5IGQ A;  3JPX A;  3V5W B;  3JZN A;  2CE9 A;  3ODT A;  5SXM A;  2AH1 A;  3I8E A;  5C2W B;  3MZK A;  4A0A B;  4ZN4 A;  2YNP A;  4A0B A;  5THA A;  3SJL D;  5EM2 B;  1B9Y A;  4PBZ A;  3UVK A;  3EI4 A;  4A2M A;  2G99 A;  1Q47 A;  2P9L C;  3SBQ A;  5HE1 B;  1JOF A;  3FRX A;  4ZOZ A;  3C99 A;  4XYH A;  4PNK B;  2Z2P A;  3EMH A;  4QL1 A;  3SLE D;  2CNX A;  3MZL A;  4MK0 B;  5HE0 B;  1P22 A;  2J56 H;  4J78 A;  4GMB A;  4BH6 A;  1JJU B;  4HDJ A;  2B5N A;  3BG1 A;  4J81 A;  2H9N A;  4L3G D;  5EML B;  3SN6 B;  3C9C A;  5K1C C;  1TYQ C;  3N0E A;  4ZOV A;  5GSA A;  5HQG A;  3JB9 L;  2BCJ B;  3EI2 A;  4N14 A;  3DM0 A;  2CE8 A;  3RN0 D;  4L1Q D;  5H1M A;  4A09 A;  2HYE A;  1NR0 A;  3DXM C;  5AJA A;  4ZOY A;  4GZ8 A;  3C5M A;  4GM9 A;  4J84 A;  2I0S A;  3VA6 A;  4FAV D;  3EU7 A;  4GQ2 P;  2QC5 A;  4GGA A;  4CZY A;  2AH0 A;  3SCY A;  3EI1 B;  2P9I C;  2AGX A;  1QNI A;  5CXB B;  3RFG A;  3UKR C;  3OKW A;  3KRX B;  3EI3 A;  3N0D A;  4YVD A;  4Z8L A;  3OL2 B;  5C9Z B;  2OK4 A;  2O9K A;  2OK6 A;  3DSM A;  4LGN A;  3EG6 A;  5K19 A;  3CFV A;  3F3G A;  4GQB B;  3OKY B;  1MG2 A;  4O1Q D;  5IT9 g;  2CO0 C;  3GFC A;  3DXK C;  5GMK n;  3JRP A;  4LG9 A;  3AH8 B;  4NSX A;  5FLX g;  4O45 A;  2XL2 A;  5EMK B;  1PGU A;  2IAA A;  1MG3 A;  2YNN A;  4GGC A;  4PBY A;  3DWL C;  2TRC B;  4FA9 D;  4H5J A;  4JXM A;  3IJC A;  4GM3 A;  4FAN D;  4A08 A;  3V9F A;  3RLM D;  3BWS A;  1S4U X;  1SQ9 A;  3FM0 A;  4A11 B;  4A0A A;  3UKU C;  5FKS A;  4ERZ A;  2BBK H;  5FA5 B;  5TEF A;  2OVR B;  3U4Y A;  3AL8 B;  3SBP A;  4A0B B;  2J55 H;  3BG0 A;  3CIK B;  4UI9 R;  4L9O A;  2Q7Q A;  2MTA H;  2CN2 A;  2Z2N A;  4D6V A;  5H17 A;  2CO0 A;  3EI4 B;  2AGW A;  4ZOX A;  4AOW A;  1GP2 B;  4QQE A;  1MDA H;  1PI6 A;  5C2V B;  3GRE A;  1XHM A;  4GGD A;  2P9N C;  3JZG A;  1FWX A;  2G9A A;  2YMU A;  3IJ0 A;  4IA9 A;  2H3X A;  4CY5 A;  3B7F A;  4ERY A;  2PM9 A;  4PSW B;  2PBI B;  4O9D A;  1PBY B;  2I0R A;  3L4O D;  4OZU A;  5EAR A;  4TZ4 A;  4KFM B;  3V7D B;  4J0X A;  3SWS D;  5B4W A;  3KRW B;  1SHY B;  2UZX B;  5IC7 A;  1B9X A;  2AGZ A;  5I5M A;  3UR4 A;  5I5I A;  5A2Q g;  4FB1 D;  2YNO A;  1OLZ A;  4CY1 A;  1XKS A;  3EI2 B;  1K8K C;  3NVN A;  3I7L A;  5EAM A;  1ERJ A;  3I7O A;  3PE7 A;  2P9P C;  3I7P A;  3SMR A;  3JRO A;  4J77 A;  3I2N A;  2PM7 B;  3PSL A;  5FQD A;  2H9M A;  1VYH C;  4CZV A;  3MMY A;  4XEI C;  4E54 B;  5GXI A;  3OKT A;  2GNQ A;  5EAP A;  4G56 B;  5FKT A;  4E5Z A;  1U2V C;  3SHF A;  1N6E A;  3L4M D;  3IIW A;  3J81 g;  3EI1 A;  3OTT A;  4XYI A;  4CY2 A;  4JT5 C;  4GM8 A;  5JWZ A;  3OL2 A;  5TEE A;  5GXH A;  3PXT D;  3ZWL B;  2HJB A;  2IUR A;  4FA1 D;  2H13 A;  4EWR A;  4JSP C;  5FXY A;  3UVN A;  5CYK A;  2I0T A;  4PSX B;  5FKR A;  2IWF A;  1JMX B;  2GC7 A;  3OKY A;  2H6K A;  2XYI A;  1TBG A;  4A7J A;  2I3S A;  3EWE A;  2H14 A;  2AGY A;  4X3E A;  3A0F A;  5EAL A;  3I89 A;  4CY3 A;  3PSC B;  3JAM g;  5HYN B;  2H47 A;  5CXC A;  5AMS A;  1R5M A;  3JZH A;  5AFU 3;  2CN3 A;  4X60 B;  4PXW A;  4JSX C;  2OVQ B;  4CI2 A;  2HKM A;  2P9U C;  4D0K A;  1YFQ A;  4CI1 A;  3MKS B;  2OVP B;  3FGB A;  3I8C A;  4J82 A;  4Y5R D;  5EM2 A;  2H68 A;  3UVM A;  3UVO A;  4H5I A;  2W18 A;  3VGZ A;  2HES X;  4A11 A;  3RRM C;  2B5L A;  4J8G A;  3AL8 A;  5IJ7 E;  2YB8 B;  3ORV D;  4QT8 A;  2XU7 A;  4LG8 A;  5TDH B;  2IUV A;  2OJY A;  2YBA A;  3HFQ A;  1GXR A;  3I7K A;  4J0W A;  1RI6 A;  5KDO B;  2H9L A;  2H9P A;  5HE2 B;  5IGO A;  2EBS A;  4FA5 D;  4BUJ C;  4J73 A;  3PXW D;  2HKR A;  4X61 B;  1N6F A;  5HE3 B;  4AEZ A;  4CI3 A;  2IWK A;  2B4E A;  4CC9 A;  1N6D A;  5IJ8 E;  2PM9 B;  2HJ4 A;  3J80 g;  5FKQ A;  1JMZ B;  5H14 A;  1U4C A;  3I7H A;  4FHL A;  3PVU B;  3UVL A;  3RFH A;  5TF2 A;  4OWR A;  3RSE C;  4J8B A;  4J79 A;  4JT6 C;  2P9S C;  4QRJ A;  4I79 A;  4PC0 A;  3ULE C;  4ES0 A;  4A09 B;  3RN1 D;  5EMM B;  3K26 A;  2I3T A;  3SXT D;  2PM6 B;  4E54 A;  1K32 A;  2J57 G;  2IUQ A;  5EMJ B;  3E0C A;  3SBR A;  3IIY A;  5CXB A;  4GQ1 A;  3AL9 A;  1NEX B;  5I5J A;  3PXS D;  4E5Z B;  1PEV A;  4X63 B;  2B5M A;  1GOT B;  3MXX A;  1OMW B;  4O3T B;  2XL3 A;  2Z2O A;  2AQ5 A;  3IJ1 A;  3W15 A;  3F3F A;  4JSN C;  3EI3 B;  4JD2 C;  2UZY B;  3NVX A;  2P9K C;  2GC4 A;  3AFC A;  3K27 A;  3P4F A;  2OIZ A;  2H6Q A;  4CZX A;  3SFZ A;  3IKO A;  3F3P A;  3C75 H;  3MKQ A;  1SQJ A;  4R7A B;  2AGL A;  3PVW B;  4Y7R A;  1A0R B;  4U7A A;  3RMZ D;  2QXV A;  4J86 A;  1L0Q A;  4J87 A;  3SVW D;  3I7N A;  2HXC A;  5CYK B;  4L3H D;  3OW8 A;  4IMM A;  3CFS B;  3VH0 A;  2IUP A;  1XIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...