1PGUA

Yeast actin interacting protein 1 (aip1), se-met protein, monoclinic crystal form
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
612
structure length
606
Chain Sequence
SSISLKEIIPPQPSTQRNFTTHLSYDPTTNAIAYPCGKSAFVRCLDDGDSKVPPVVQFTGHGSSVVTTVKFSPIKGSQYLCSGDESGKVIVWGWTFDKESNSVEVNVKSEFQVLAGPISDISWDFEGRRLCVVGEGRDNFGVFISWDSGNSLGEVSGHSQRINACHLKQSRPMRSMTVGDDGSVVFYQGPPFKFSASDRTHHKQGSFVRDVEFSPDSGEFVITVGSDRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGNQQVGVVATGNGRIISLSLDGTLNFYELGHDEVLKTISGHNKGITALTVNPLISGSYDGRIMEWSSSSMHQDHSNLIVSLDNSKAQEYSSISWDDTLKVNGITKHEFGSQPKVASANNDGFTAVLTNDDDLLILQSFTGDIIKSVRLNSPGSAVSLSQNYVAVGLEEGNTIQVFKLSDLEVSFDLKTPLRAKPSYISISPSETYIAAGDVMGKILLYDLQSREVKTSRWAFRTSKINAISWKPAEEIEEDLVATGSLDTNIFIYSVKRPMKIIKALNAHKDGVNNLLWETPSTLVSSGADACIKRWNVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Actin interacting protein 1
publication title The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 159
structure length 606
sequence length 612
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pguA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pguA01
2AQ5A 2AH1A 3AL9A 5EMKB 2CN3A 4A0AA 4JSPC 5EM2A 2PM9B 3AFCA 4CC9A 3MZKA 3OKYB 3EI2B 5FKRA 4HDJA 4K3ID 3F3FA 2IAAA 2AGWA 5HE3B 2XU7A 5EMLB 5CXBB 2P9KC 3PVUB 4GQBB 1PBYB 2AGYA 4QL1A 4JSVC 4L9OA 4E54A 3PVWB 3C99A 3MZLA 1VYHC 3EMHA 3SVWD 3RSEC 4FB1D 3RFHA 4LG8A 4O3TB 2MTAH 5FQDA 2TRCB 2H9LA 4OZUA 3RRMC 1SHYB 4ERQA 4ES0A 3DM0A 4Y5RD 2YMUA 2H13A 1TBGA 2J55H 3NVNA 2P9LC 2J57G 4AEZA 4H5IA 2H68A 4EWRA 2H6QA 1K8KC 3CFSB 2HKRA 3UKRC 1N6DA 2B5MA 3PSCB 1JMXB 3SWSD 3GREA 5H17A 4FA4D 3EI4A 4A0BB 5CYKA 4N14A 5HE0B 4X3EA 3U4YA 4E54B 1RI6A 4CZYA 4TZ4A 4H5JA 2HJBA 1N6EA 3V7DB 4J0WA 4PBZA 3PXSD 4ZOXA 5TEEA 3DXMC 5EARA 4ERZA 4D0KA 3N0DA 4X63B 3AL8A 3DXKC 3ORVD 3UR4A 4J86A 5IGQA 4FAVD 2OIZA 2CE8A 2Z2NA 1Q47A 4L3GD 2H6KA 5AFU3 3EI1B 1JOFA 3NVXA 5FKQA 2CO0A 3IJCA 3K27A 4J8GA 1SQ9A 1OLZA 4BUJC 4A11A 1QNIA 3EI3A 4E5ZA 4QT8A 4FA5D 3I7NA 4CI1A 3RMZD 3DSMA 5SXMA 5GMKn 4PSXB 3SXTD 3KRXB 3EG6A 4FA9D 3MMYA 1ERJA 1GOTB 2PM7B 4A09A 3GFCA 3UVLA 3AH8B 4J87A 5HE1B 3F3PA 2IWFA 4FHLA 4GM8A 2W18A 4CZXA 3SCYA 3RLMD 2PM6B 4O45A 4X60B 2OVQB 5H1MA 3A0FA 1XIPA 3N0EA 5HE2B 2P9PC 2AGLA 4GZ8A 2IUVA 3EU7A 4OWRA 2GC4A 5C2WB 1U4CA 3SBPA 2G9AA 2J56H 4J79A 4LGNA 3JROA 4PC0A 3VGZA 3V9FA 3B7FA 3RFGA 4JSNC 4J78A 1K32A 4BH6A 3OKWA 3JZNA 3OL2B 1MG3A 4CY1A 5A2Qg 4UI9R 3CIKB 3SBRA 5I5IA 4A08A 3UVOA 2XL2A 1MG2A 2B5LA 3NVQA 4A0AB 5EM2B 3OW8A 4IA9A 4CI8A 2AGXA 4JSXC 5GXHA 1B9XA 3K26A 1PEVA 3MXXA 1PGUA 4GGCA 4NSXA 5EMJB 4ZN4A 3FRXA 1NR0A 3BG1A 3CFVA 3SBQA 2BBKH 5AMSA 1P22A 4YVDA 1JJUB 2I0SA 3C5MA 4D6VA 2OVRB 1N6FA 1FWXA 4FWWA 2HESX 5FKSA 5KDOB 4MK0B 2H9NA 4PXWA 3JB9L 2CO0C 3VH0A 4O3UB 2B4EA 2HYEA 4O1QD 3ZWLB 2P9SC 2HJ4A 4ESGA 5AJAA 2QC5A 4U7AA 4LG9A 5I5MA 1GXRA 5CXCA 3I89A 4Y7RA 4J8BA 5HYNB 3PE7A 3IIWA 1GG2B 1U2VC 3KRWB 4L1QD 3VA6A 2CN2A 4L3HD 1XKSA 1PI6A 2H9PA 2P9UC 4IMMA 2BCJB 2OK6A 5K1CC 2YNNA 4XYHA 2PM9A 2YB8B 2QXVA 3OKYA 5FLXg 2P9NC 1A0RB 2I3TA 3EI4B 5CYKB 5EAMA 5TEFA 3JPXA 4GGAA 2IUPA 4FAND 3IIYA 4KFMB 3UKUC 5HQGA 3SFZA 3UVMA 1GP2B 4GM3A 3FGBA 5TF2A 2I0TA 5TDHB 5CXBA 5H14A 1TYQC 4Z8LA 5THAA 3AL8B 4J73A 3SJLD 3ODTA 2H9MA 2IWKA 4PNKB 1R5MA 2H47A 2P9IC 4J0XA 4I79A 4ZOYA 3SLED 2GNQA 2H6NA 2OVPB 5JWZA 4J77A 3PXWD 2G99A 4PSWB 2H14A 4X61B 2CNXA 3I8EA 3V5WB 2H3XA 3JZHA 4A2LA 2YNOA 2I3SA 3J80g 1OMWB 4A11B 3FM0A 3EI3B 4JXMA 4CZVA 4E5ZB 2OK4A 3PXTD 3W15A 5C9ZB 5IJ8E 4CI3A 2IUQA 4A7JA 3UVKA 4CI2A 3IKOA 5I5JA 4A09B 4JD2C 4A0BA 3MKQA 4J81A 3HFQA 2OJYA 4J82A 2Z2OA 4JT5C 3I7LA 4FA1D 4GGDA 1NEXB 2HXCA 5IGOA 3L4OD 3MKSB 5GXIA 4GQ2P 5IT9g 2CE9A 3C75H 5C2VB 5FKTA 4G56B 3BWSA 3UVNA 3JRPA 4ZOVA 3SHFA 1B9YA 3I7KA 4J84A 5B4WA 3DWLC 4GMBA 3EWEA 3PSLA 3IJ1A 3I2NA 4XEIC 1JMZB 3C9CA 2EBSA 2O9KA 2Z2PA 5K19A 3EI1A 2Q7QA 4K3JB 3J81g 5EMMB 4U1EI 4A2MA 4A08B 3E0CA 3I8CA 2B5NA 1MDAH 3P4FA 5GSAA 1S4UX 5EAPA 5IJ7E 1L0QA 2XL3A 4QRJA 2XYIA 2UZXB 3OTTA 4R7AB 2HKMA 3I7OA 2PBIB 1XHMA 4JT6C 4ERYA 3I7HA 2AGZA 4BL0A 3IJ0A 3EI2A 3OKTA 4PBYA 1YFQA 4O9DA 4XYIA 4CY2A 2YBAA 4CY5A 3RN0D 5IC7A 3JZGA 2GC7A 3BG0A 3F3GA 4GQ1A 3RN1D 4CY3A 5CXCB 2AH0A 3JAMg 5FA5B 3SN6B 4AOWA 4QQEA 2UZYB 4GM9A 3L4MD 2I0RA 1SQJA 4ZOZA 3OL2A 3I7PA 5FXYA 5EALA 2YNPA 2IURA 3SMRA 3ULEC
chains in the Genus database with same CATH superfamily
4BCBA 2AQ5A 4G55A 2AH1A 3AL9A 5EMKB 4AMZA 2CN3A 4A0AA 4JSPC 5EM2A 2PM9B 3AFCA 4CC9A 3MZKA 3OKYB 2XDWA 4DNWA 3EI2B 4WK2A 5FKRA 3T3MA 2VDLA 4HDJA 4K3ID 3EQ7A 1I2MB 1C9LA 1VE6A 3F3FA 2IAAA 2AGWA 5HE3B 2QZPA 1GOHA 2XU7A 5EMLB 3QHYB 5CXBB 2P9KC 3PVUB 4GQBB 1PBYB 3MVDK 2AGYA 4QL1A 1UOPA 4JSVC 4L9OA 4E54A 3PVWB 4JHPC 3C99A 3MZLA 1VYHC 3EMHA 3SVWD 3RSEC 3FCUA 4FB1D 3RFHA 1YR2A 4LG8A 4O3TB 4BP9A 2MTAH 5FQDA 2TRCB 2H9LA 4IRZA 4OZUA 3RRMC 1M1XA 1VE7A 1SHYB 4ERQA 2EIDA 4ES0A 3DM0A 4Y5RD 2YMUA 5M5TA 2H13A 1TBGA 2J55H 3NVNA 1T2XA 2P9LC 2J57G 4AEZA 4H5IA 4BP8A 4WJKA 4NC4A 2H68A 4EWRA 2H6QA 1K8KC 3CFSB 2HKRA 3EQ8A 3UKRC 1N6DA 2B5MA 3PSCB 1JMXB 4Z7NA 3SWSD 3GREA 4BCCA 5M5UA 5H17A 4FA4D 3IUMA 3EI4A 4A0BB 5CYKA 4AN0A 4N14A 1QFSA 5HE0B 4X3EA 3KCIA 3U4YA 1A12A 5E6UA 4E54B 1RI6A 4CZYA 4TZ4A 4H5JA 2HJBA 1N6EA 4RE6A 5M5RA 3V7DB 4J0WA 1GOFA 3IUNA 4PBZA 3PXSD 4ZOXA 5TEEA 3DXMC 5EARA 4ERZA 4D0KA 3N0DA 4X63B 3AL8A 3DXKC 3ORVD 3MUNA 3IJEA 3VI3A 1H2WA 3UR4A 4J86A 3ZDZA 5IGQA 4FAVD 4JHNA 5C92A 2OIZA 2CE8A 3FCSA 3ULEC 2Z2NA 1UOQA 1Q47A 4L3GD 2H6KA 2VDMA 5AFU3 4Z7OA 3EI1B 3ZE0A 1JOFA 3NVXA 5FKQA 2CO0A 3IJCA 3K27A 4J8GA 1SQ9A 1OLZA 4BUJC 4AN1A 4A11A 1QNIA 3VI4A 2VDPA 3EI3A 2XE4A 4E5ZA 4QT8A 5M5SA 4FA5D 3I7NA 5C86A 4CI1A 3RMZD 3DSMA 5SXMA 5GMKn 4PSXB 3SXTD 3KRXB 3EG6A 3IUJA 4FA9D 3MMYA 1ERJA 1GOTB 2PM7B 3OF7A 4A09A 3GFCA 3UVLA 3AH8B 4UM8A 4J87A 5HE1B 3F3PA 2IWFA 4FHLA 4GM8A 2W18A 4CZXA 3SCYA 3RLMD 2PM6B 4O45A 4X60B 2OVQB 5H1MA 2XZGA 3A0FA 4RE5A 1XIPA 3IVMA 4WK4A 3N0EA 2VDOA 5HE2B 4G1MA 2P9PC 2AGLA 4GZ8A 2IUVA 3EU7A 4OWRA 2GC4A 5C2WB 1U4CA 3SBPA 2G9AA 2J56H 4J79A 3EQ9A 4LGNA 3JROA 4PC0A 3VGZA 3V9FA 3B7FA 3RFGA 4JSNC 4J78A 1K32A 4BH6A 3OKWA 3JZNA 1TYEA 1MG3A 3OL2B 4CY1A 5A2Qg 4UI9R 3CIKB 3SBRA 5I5IA 4A08A 3UVOA 2XL2A 3GC3B 2VDNA 5FFGA 1MG2A 2B5LA 3NVQA 4A0AB 5EM2B 2JKXA 3OW8A 4IA9A 4UM9A 5HDBA 4CI8A 2AGXA 4JSXC 5GXHA 1B9XA 3GD1I 3K26A 1PEVA 3MXXA 1PGUA 4GGCA 4NSXA 1E8MA 5EMJB 4ZN4A 3DDUA 3FRXA 1NR0A 3BG1A 3CFVA 3SBQA 2BBKH 5AMSA 1P22A 4YVDA 1JJUB 2I0SA 5M5VA 3C5MA 4D6VA 2OVRB 1N6FA 1FWXA 1GOGA 3K6SA 4FWWA 1JTDB 2HESX 5FKSA 5KDOB 4MK0B 3IUQA 2H9NA 4PXWA 3JB9L 2CO0C 3VH0A 2HU7A 4O3UB 2B4EA 4Z7QA 2HYEA 4O1QD 1E8NA 3ZWLB 2P9SC 1VZ2A 2HJ4A 4ESGA 5AJAA 2QC5A 4U7AA 4LG9A 5I5MA 1GXRA 5CXCA 3I89A 4Y7RA 3ZE1A 4J8BA 4O2WA 5HYNB 3PE7A 4BCDA 3IIWA 4DNVA 3K71A 3ZDXA 2EIEA 1GG2B 4NENA 1U2VC 3KRWB 3QI0A 4L1QD 3VA6A 2CN2A 4L3HD 1XKSA 1PI6A 3O4HA 2BKLA 3NIFA 3T3PA 1H2ZA 2H9PA 2P9UC 4IMMA 2BCJB 2OK6A 5K1CC 2YNNA 4XYHA 2PM9A 2YB8B 2HU5A 2QXVA 3OKYA 5FLXg 2P9NC 1A0RB 2I3TA 3EI4B 5CYKB 5EAMA 5TEFA 3JPXA 5FFOA 4GGAA 2IUPA 3O4GA 1O6FA 4FAND 3IIYA 4KFMB 3UKUC 4AX4A 1JV2A 3O4IA 5HQGA 3SFZA 3UVMA 1GP2B 4GM3A 1O6GA 3FGBA 5TF2A 2I0TA 5TDHB 5CXBA 5H14A 1TYQC 4Z8LA 5THAA 2WQ8A 2VDRA 2VDKA 3AL8B 4J73A 3SJLD 4D9SA 1UOOA 3ODTA 2H9MA 2IWKA 4PNKB 1R5MA 2H47A 2P9IC 4J0XA 4I79A 5E6RA 4ZOYA 3SLED 2GNQA 2H6NA 2OVPB 2QR5A 3K72A 5JWZA 4J77A 3PXWD 2G99A 4PSWB 2H14A 4X61B 2CNXA 3I8EA 3V5WB 2H3XA 3JZHA 4WK0A 5M61A 4A2LA 2YNOA 2I3SA 3J80g 1OMWB 4A11B 3FM0A 3EI3B 4JXMA 4CZVA 4E5ZB 2OK4A 3PXTD 3W15A 5C9ZB 5IJ8E 4CI3A 1H2YA 4AMYA 2IUQA 4A7JA 3UVKA 4CI2A 3IKOA 1U8CA 5I5JA 4L1MA 4A09B 4JD2C 4A0BA 3MKQA 4J81A 3HFQA 2OJYA 4J82A 2Z2OA 4JT5C 3I7LA 4FA1D 4GGDA 4MMZA 5E6SA 1NEXB 1C9IA 4O02A 2HXCA 5IGOA 3L4OD 3MKSB 5GXIA 4GQ2P 5IT9g 2CE9A 3ZDYA 1K3IA 3C75H 5C2VB 3ZE2A 5FKTA 4G56B 3BWSA 3UVNA 3JRPA 4ZOVA 3SHFA 1B9YA 1L5GA 3I7KA 4J84A 5B4WA 2EICA 3DWLC 4GMBA 3EWEA 3PSLA 3IJ1A 3I2NA 4XEIC 1JMZB 3C9CA 3NIDA 2EBSA 2O9KA 2Z2PA 5K19A 3EI1A 2VC2A 4NBMA 3MUOA 2Q7QA 4K3JB 3J81g 5EMMB 4U1EI 4A2MA 4A08B 3V4VA 3E0CA 3I8CA 2B5NA 1MDAH 3P4FA 5GSAA 1S4UX 5EAPA 3IULA 5IJ7E 1L0QA 3IURA 2XL3A 4QRJA 2VDQA 2XYIA 1VZ3A 2UZXB 4QAMA 3OTTA 4G1EA 4R7AB 2VZ3A 2HKMA 3I7OA 2PBIB 1XHMA 4JT6C 4ERYA 3I7HA 2AGZA 4BL0A 1UTCA 3IJ0A 3EI2A 3OKTA 4PBYA 1YFQA 4O9DA 4XYIA 4CY2A 2YBAA 4CY5A 4NAAA 3RN0D 5IC7A 3JZGA 2GC7A 4DNUA 3O4JA 2HU8A 3BG0A 3F3GA 4GQ1A 3RN1D 4CY3A 1H2XA 5CXCB 2AH0A 4MMXA 1BPOA 3NIGA 3JAMg 3V4PA 5FA5B 3SN6B 1E5TA 4AOWA 4QQEA 2UZYB 4GM9A 3L4MD 2I0RA 1SQJA 4ZOZA 3OL2A 3I7PA 5FXYA 2EIBA 5EALA 1QFMA 2YNPA 2VZ1A 2IURA 3SMRA 4MMYA
chains in the Genus database with same CATH topology
2AQ5A 2AH1A 3AL9A 5EMKB 2CN3A 4A0AA 4JSPC 5EM2A 2PM9B 3AFCA 4CC9A 3MZKA 3OKYB 3EI2B 5FKRA 4HDJA 4K3ID 3F3FA 2IAAA 2AGWA 5HE3B 2XU7A 5EMLB 5CXBB 2P9KC 3PVUB 4GQBB 1PBYB 2AGYA 4QL1A 4JSVC 4L9OA 4E54A 3PVWB 3C99A 3MZLA 1VYHC 3EMHA 3SVWD 3RSEC 4FB1D 3RFHA 4LG8A 4O3TB 2MTAH 5FQDA 2TRCB 2H9LA 4OZUA 3RRMC 1SHYB 4ERQA 4ES0A 3DM0A 4Y5RD 2YMUA 2H13A 1TBGA 2J55H 3NVNA 2P9LC 2J57G 4AEZA 4H5IA 2H68A 4EWRA 2H6QA 1K8KC 3CFSB 2HKRA 3UKRC 1N6DA 2B5MA 3PSCB 1JMXB 3SWSD 3GREA 5H17A 4FA4D 3EI4A 4A0BB 5CYKA 4N14A 5HE0B 4X3EA 3U4YA 4E54B 1RI6A 4CZYA 4TZ4A 4H5JA 2HJBA 1N6EA 3V7DB 4J0WA 4PBZA 3PXSD 4ZOXA 5TEEA 3DXMC 5EARA 4ERZA 4D0KA 3N0DA 4X63B 3AL8A 3DXKC 3ORVD 3UR4A 4J86A 5IGQA 4FAVD 2OIZA 2CE8A 2Z2NA 1Q47A 4L3GD 2H6KA 5AFU3 3EI1B 1JOFA 3NVXA 5FKQA 2CO0A 3IJCA 3K27A 4J8GA 1SQ9A 1OLZA 4BUJC 4A11A 1QNIA 3EI3A 4E5ZA 4QT8A 4FA5D 3I7NA 4CI1A 3RMZD 3DSMA 5SXMA 5GMKn 4PSXB 3SXTD 3KRXB 3EG6A 4FA9D 3MMYA 1ERJA 1GOTB 2PM7B 4A09A 3GFCA 3UVLA 3AH8B 4J87A 5HE1B 3F3PA 2IWFA 4FHLA 4GM8A 2W18A 4CZXA 3SCYA 3RLMD 2PM6B 4O45A 4X60B 2OVQB 5H1MA 3A0FA 1XIPA 3N0EA 5HE2B 2P9PC 2AGLA 4GZ8A 2IUVA 3EU7A 4OWRA 2GC4A 5C2WB 1U4CA 3SBPA 2G9AA 2J56H 4J79A 4LGNA 3JROA 4PC0A 3VGZA 3V9FA 3B7FA 3RFGA 4JSNC 4J78A 1K32A 4BH6A 3OKWA 3JZNA 3OL2B 1MG3A 4CY1A 5A2Qg 4UI9R 3CIKB 3SBRA 5I5IA 4A08A 3UVOA 2XL2A 1MG2A 2B5LA 3NVQA 4A0AB 5EM2B 3OW8A 4IA9A 4CI8A 2AGXA 4JSXC 5GXHA 1B9XA 3K26A 1PEVA 3MXXA 1PGUA 4GGCA 4NSXA 5EMJB 4ZN4A 3FRXA 1NR0A 3BG1A 3CFVA 3SBQA 2BBKH 5AMSA 1P22A 4YVDA 1JJUB 2I0SA 3C5MA 4D6VA 2OVRB 1N6FA 1FWXA 4FWWA 2HESX 5FKSA 5KDOB 4MK0B 2H9NA 4PXWA 3JB9L 2CO0C 3VH0A 4O3UB 2B4EA 2HYEA 4O1QD 3ZWLB 2P9SC 2HJ4A 4ESGA 5AJAA 2QC5A 4U7AA 4LG9A 5I5MA 1GXRA 5CXCA 3I89A 4Y7RA 4J8BA 5HYNB 3PE7A 3IIWA 1GG2B 1U2VC 3KRWB 4L1QD 3VA6A 2CN2A 4L3HD 1XKSA 1PI6A 2H9PA 2P9UC 4IMMA 2BCJB 2OK6A 5K1CC 2YNNA 4XYHA 2PM9A 2YB8B 2QXVA 3OKYA 5FLXg 2P9NC 1A0RB 2I3TA 3EI4B 5CYKB 5EAMA 5TEFA 3JPXA 4GGAA 2IUPA 4FAND 3IIYA 4KFMB 3UKUC 5HQGA 3SFZA 3UVMA 1GP2B 4GM3A 3FGBA 5TF2A 2I0TA 5TDHB 5CXBA 5H14A 1TYQC 4Z8LA 5THAA 3AL8B 4J73A 3SJLD 3ODTA 2H9MA 2IWKA 4PNKB 1R5MA 2H47A 2P9IC 4J0XA 4I79A 4ZOYA 3SLED 2GNQA 2H6NA 2OVPB 5JWZA 4J77A 3PXWD 2G99A 4PSWB 2H14A 4X61B 2CNXA 3I8EA 3V5WB 2H3XA 3JZHA 4A2LA 2YNOA 2I3SA 3J80g 1OMWB 4A11B 3FM0A 3EI3B 4JXMA 4CZVA 4E5ZB 2OK4A 3PXTD 3W15A 5C9ZB 5IJ8E 4CI3A 2IUQA 4A7JA 3UVKA 4CI2A 3IKOA 5I5JA 4A09B 4JD2C 4A0BA 3MKQA 4J81A 3HFQA 2OJYA 4J82A 2Z2OA 4JT5C 3I7LA 4FA1D 4GGDA 1NEXB 2HXCA 5IGOA 3L4OD 3MKSB 5GXIA 4GQ2P 5IT9g 2CE9A 3C75H 5C2VB 5FKTA 4G56B 3BWSA 3UVNA 3JRPA 4ZOVA 3SHFA 1B9YA 3I7KA 4J84A 5B4WA 3DWLC 4GMBA 3EWEA 3PSLA 3IJ1A 3I2NA 4XEIC 1JMZB 3C9CA 2EBSA 2O9KA 2Z2PA 5K19A 3EI1A 2Q7QA 4K3JB 3J81g 5EMMB 4U1EI 4A2MA 4A08B 3E0CA 3I8CA 2B5NA 1MDAH 3P4FA 5GSAA 1S4UX 5EAPA 5IJ7E 1L0QA 2XL3A 4QRJA 2XYIA 2UZXB 3OTTA 4R7AB 2HKMA 3I7OA 2PBIB 1XHMA 4JT6C 4ERYA 3I7HA 2AGZA 4BL0A 3IJ0A 3EI2A 3OKTA 4PBYA 1YFQA 4O9DA 4XYIA 4CY2A 2YBAA 4CY5A 3RN0D 5IC7A 3JZGA 2GC7A 3BG0A 3F3GA 4GQ1A 3RN1D 4CY3A 5CXCB 2AH0A 3JAMg 5FA5B 3SN6B 4AOWA 4QQEA 2UZYB 4GM9A 3L4MD 2I0RA 1SQJA 4ZOZA 3OL2A 3I7PA 5FXYA 5EALA 2YNPA 2IURA 3SMRA 3ULEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQ5 A;  2AH1 A;  3AL9 A;  5EMK B;  2CN3 A;  4A0A A;  4JSP C;  5EM2 A;  2PM9 B;  3AFC A;  4CC9 A;  3MZK A;  3OKY B;  3EI2 B;  5FKR A;  4HDJ A;  4K3I D;  3F3F A;  2IAA A;  2AGW A;  5HE3 B;  2XU7 A;  5EML B;  5CXB B;  2P9K C;  3PVU B;  4GQB B;  1PBY B;  2AGY A;  4QL1 A;  4JSV C;  4L9O A;  4E54 A;  3PVW B;  3C99 A;  3MZL A;  1VYH C;  3EMH A;  3SVW D;  3RSE C;  4FB1 D;  3RFH A;  4LG8 A;  4O3T B;  2MTA H;  5FQD A;  2TRC B;  2H9L A;  4OZU A;  3RRM C;  1SHY B;  4ERQ A;  4ES0 A;  3DM0 A;  4Y5R D;  2YMU A;  2H13 A;  1TBG A;  2J55 H;  3NVN A;  2P9L C;  2J57 G;  4AEZ A;  4H5I A;  2H68 A;  4EWR A;  2H6Q A;  1K8K C;  3CFS B;  2HKR A;  3UKR C;  1N6D A;  2B5M A;  3PSC B;  1JMX B;  3SWS D;  3GRE A;  5H17 A;  4FA4 D;  3EI4 A;  4A0B B;  5CYK A;  4N14 A;  5HE0 B;  4X3E A;  3U4Y A;  4E54 B;  1RI6 A;  4CZY A;  4TZ4 A;  4H5J A;  2HJB A;  1N6E A;  3V7D B;  4J0W A;  4PBZ A;  3PXS D;  4ZOX A;  5TEE A;  3DXM C;  5EAR A;  4ERZ A;  4D0K A;  3N0D A;  4X63 B;  3AL8 A;  3DXK C;  3ORV D;  3UR4 A;  4J86 A;  5IGQ A;  4FAV D;  2OIZ A;  2CE8 A;  2Z2N A;  1Q47 A;  4L3G D;  2H6K A;  5AFU 3;  3EI1 B;  1JOF A;  3NVX A;  5FKQ A;  2CO0 A;  3IJC A;  3K27 A;  4J8G A;  1SQ9 A;  1OLZ A;  4BUJ C;  4A11 A;  1QNI A;  3EI3 A;  4E5Z A;  4QT8 A;  4FA5 D;  3I7N A;  4CI1 A;  3RMZ D;  3DSM A;  5SXM A;  5GMK n;  4PSX B;  3SXT D;  3KRX B;  3EG6 A;  4FA9 D;  3MMY A;  1ERJ A;  1GOT B;  2PM7 B;  4A09 A;  3GFC A;  3UVL A;  3AH8 B;  4J87 A;  5HE1 B;  3F3P A;  2IWF A;  4FHL A;  4GM8 A;  2W18 A;  4CZX A;  3SCY A;  3RLM D;  2PM6 B;  4O45 A;  4X60 B;  2OVQ B;  5H1M A;  3A0F A;  1XIP A;  3N0E A;  5HE2 B;  2P9P C;  2AGL A;  4GZ8 A;  2IUV A;  3EU7 A;  4OWR A;  2GC4 A;  5C2W B;  1U4C A;  3SBP A;  2G9A A;  2J56 H;  4J79 A;  4LGN A;  3JRO A;  4PC0 A;  3VGZ A;  3V9F A;  3B7F A;  3RFG A;  4JSN C;  4J78 A;  1K32 A;  4BH6 A;  3OKW A;  3JZN A;  3OL2 B;  1MG3 A;  4CY1 A;  5A2Q g;  4UI9 R;  3CIK B;  3SBR A;  5I5I A;  4A08 A;  3UVO A;  2XL2 A;  1MG2 A;  2B5L A;  3NVQ A;  4A0A B;  5EM2 B;  3OW8 A;  4IA9 A;  4CI8 A;  2AGX A;  4JSX C;  5GXH A;  1B9X A;  3K26 A;  1PEV A;  3MXX A;  1PGU A;  4GGC A;  4NSX A;  5EMJ B;  4ZN4 A;  3FRX A;  1NR0 A;  3BG1 A;  3CFV A;  3SBQ A;  2BBK H;  5AMS A;  1P22 A;  4YVD A;  1JJU B;  2I0S A;  3C5M A;  4D6V A;  2OVR B;  1N6F A;  1FWX A;  4FWW A;  2HES X;  5FKS A;  5KDO B;  4MK0 B;  2H9N A;  4PXW A;  3JB9 L;  2CO0 C;  3VH0 A;  4O3U B;  2B4E A;  2HYE A;  4O1Q D;  3ZWL B;  2P9S C;  2HJ4 A;  4ESG A;  5AJA A;  2QC5 A;  4U7A A;  4LG9 A;  5I5M A;  1GXR A;  5CXC A;  3I89 A;  4Y7R A;  4J8B A;  5HYN B;  3PE7 A;  3IIW A;  1GG2 B;  1U2V C;  3KRW B;  4L1Q D;  3VA6 A;  2CN2 A;  4L3H D;  1XKS A;  1PI6 A;  2H9P A;  2P9U C;  4IMM A;  2BCJ B;  2OK6 A;  5K1C C;  2YNN A;  4XYH A;  2PM9 A;  2YB8 B;  2QXV A;  3OKY A;  5FLX g;  2P9N C;  1A0R B;  2I3T A;  3EI4 B;  5CYK B;  5EAM A;  5TEF A;  3JPX A;  4GGA A;  2IUP A;  4FAN D;  3IIY A;  4KFM B;  3UKU C;  5HQG A;  3SFZ A;  3UVM A;  1GP2 B;  4GM3 A;  3FGB A;  5TF2 A;  2I0T A;  5TDH B;  5CXB A;  5H14 A;  1TYQ C;  4Z8L A;  5THA A;  3AL8 B;  4J73 A;  3SJL D;  3ODT A;  2H9M A;  2IWK A;  4PNK B;  1R5M A;  2H47 A;  2P9I C;  4J0X A;  4I79 A;  4ZOY A;  3SLE D;  2GNQ A;  2H6N A;  2OVP B;  5JWZ A;  4J77 A;  3PXW D;  2G99 A;  4PSW B;  2H14 A;  4X61 B;  2CNX A;  3I8E A;  3V5W B;  2H3X A;  3JZH A;  4A2L A;  2YNO A;  2I3S A;  3J80 g;  1OMW B;  4A11 B;  3FM0 A;  3EI3 B;  4JXM A;  4CZV A;  4E5Z B;  2OK4 A;  3PXT D;  3W15 A;  5C9Z B;  5IJ8 E;  4CI3 A;  2IUQ A;  4A7J A;  3UVK A;  4CI2 A;  3IKO A;  5I5J A;  4A09 B;  4JD2 C;  4A0B A;  3MKQ A;  4J81 A;  3HFQ A;  2OJY A;  4J82 A;  2Z2O A;  4JT5 C;  3I7L A;  4FA1 D;  4GGD A;  1NEX B;  2HXC A;  5IGO A;  3L4O D;  3MKS B;  5GXI A;  4GQ2 P;  5IT9 g;  2CE9 A;  3C75 H;  5C2V B;  5FKT A;  4G56 B;  3BWS A;  3UVN A;  3JRP A;  4ZOV A;  3SHF A;  1B9Y A;  3I7K A;  4J84 A;  5B4W A;  3DWL C;  4GMB A;  3EWE A;  3PSL A;  3IJ1 A;  3I2N A;  4XEI C;  1JMZ B;  3C9C A;  2EBS A;  2O9K A;  2Z2P A;  5K19 A;  3EI1 A;  2Q7Q A;  4K3J B;  3J81 g;  5EMM B;  4U1E I;  4A2M A;  4A08 B;  3E0C A;  3I8C A;  2B5N A;  1MDA H;  3P4F A;  5GSA A;  1S4U X;  5EAP A;  5IJ7 E;  1L0Q A;  2XL3 A;  4QRJ A;  2XYI A;  2UZX B;  3OTT A;  4R7A B;  2HKM A;  3I7O A;  2PBI B;  1XHM A;  4JT6 C;  4ERY A;  3I7H A;  2AGZ A;  4BL0 A;  3IJ0 A;  3EI2 A;  3OKT A;  4PBY A;  1YFQ A;  4O9D A;  4XYI A;  4CY2 A;  2YBA A;  4CY5 A;  3RN0 D;  5IC7 A;  3JZG A;  2GC7 A;  3BG0 A;  3F3G A;  4GQ1 A;  3RN1 D;  4CY3 A;  5CXC B;  2AH0 A;  3JAM g;  5FA5 B;  3SN6 B;  4AOW A;  4QQE A;  2UZY B;  4GM9 A;  3L4M D;  2I0R A;  1SQJ A;  4ZOZ A;  3OL2 A;  3I7P A;  5FXY A;  5EAL A;  2YNP A;  2IUR A;  3SMR A;  3ULE C; 
#chains in the Genus database with same CATH topology
 4BCB A;  2AQ5 A;  4G55 A;  2AH1 A;  3AL9 A;  5EMK B;  4AMZ A;  2CN3 A;  4A0A A;  4JSP C;  5EM2 A;  2PM9 B;  3AFC A;  4CC9 A;  3MZK A;  3OKY B;  2XDW A;  4DNW A;  3EI2 B;  4WK2 A;  5FKR A;  3T3M A;  2VDL A;  4HDJ A;  4K3I D;  3EQ7 A;  1I2M B;  1C9L A;  1VE6 A;  3F3F A;  2IAA A;  2AGW A;  5HE3 B;  2QZP A;  1GOH A;  2XU7 A;  5EML B;  3QHY B;  5CXB B;  2P9K C;  3PVU B;  4GQB B;  1PBY B;  3MVD K;  2AGY A;  4QL1 A;  1UOP A;  4JSV C;  4L9O A;  4E54 A;  3PVW B;  4JHP C;  3C99 A;  3MZL A;  1VYH C;  3EMH A;  3SVW D;  3RSE C;  3FCU A;  4FB1 D;  3RFH A;  1YR2 A;  4LG8 A;  4O3T B;  4BP9 A;  2MTA H;  5FQD A;  2TRC B;  2H9L A;  4IRZ A;  4OZU A;  3RRM C;  1M1X A;  1VE7 A;  1SHY B;  4ERQ A;  2EID A;  4ES0 A;  3DM0 A;  4Y5R D;  2YMU A;  5M5T A;  2H13 A;  1TBG A;  2J55 H;  3NVN A;  1T2X A;  2P9L C;  2J57 G;  4AEZ A;  4H5I A;  4BP8 A;  4WJK A;  4NC4 A;  2H68 A;  4EWR A;  2H6Q A;  1K8K C;  3CFS B;  2HKR A;  3EQ8 A;  3UKR C;  1N6D A;  2B5M A;  3PSC B;  1JMX B;  4Z7N A;  3SWS D;  3GRE A;  4BCC A;  5M5U A;  5H17 A;  4FA4 D;  3IUM A;  3EI4 A;  4A0B B;  5CYK A;  4AN0 A;  4N14 A;  1QFS A;  5HE0 B;  4X3E A;  3KCI A;  3U4Y A;  1A12 A;  5E6U A;  4E54 B;  1RI6 A;  4CZY A;  4TZ4 A;  4H5J A;  2HJB A;  1N6E A;  4RE6 A;  5M5R A;  3V7D B;  4J0W A;  1GOF A;  3IUN A;  4PBZ A;  3PXS D;  4ZOX A;  5TEE A;  3DXM C;  5EAR A;  4ERZ A;  4D0K A;  3N0D A;  4X63 B;  3AL8 A;  3DXK C;  3ORV D;  3MUN A;  3IJE A;  3VI3 A;  1H2W A;  3UR4 A;  4J86 A;  3ZDZ A;  5IGQ A;  4FAV D;  4JHN A;  5C92 A;  2OIZ A;  2CE8 A;  3FCS A;  3ULE C;  2Z2N A;  1UOQ A;  1Q47 A;  4L3G D;  2H6K A;  2VDM A;  5AFU 3;  4Z7O A;  3EI1 B;  3ZE0 A;  1JOF A;  3NVX A;  5FKQ A;  2CO0 A;  3IJC A;  3K27 A;  4J8G A;  1SQ9 A;  1OLZ A;  4BUJ C;  4AN1 A;  4A11 A;  1QNI A;  3VI4 A;  2VDP A;  3EI3 A;  2XE4 A;  4E5Z A;  4QT8 A;  5M5S A;  4FA5 D;  3I7N A;  5C86 A;  4CI1 A;  3RMZ D;  3DSM A;  5SXM A;  5GMK n;  4PSX B;  3SXT D;  3KRX B;  3EG6 A;  3IUJ A;  4FA9 D;  3MMY A;  1ERJ A;  1GOT B;  2PM7 B;  3OF7 A;  4A09 A;  3GFC A;  3UVL A;  3AH8 B;  4UM8 A;  4J87 A;  5HE1 B;  3F3P A;  2IWF A;  4FHL A;  4GM8 A;  2W18 A;  4CZX A;  3SCY A;  3RLM D;  2PM6 B;  4O45 A;  4X60 B;  2OVQ B;  5H1M A;  2XZG A;  3A0F A;  4RE5 A;  1XIP A;  3IVM A;  4WK4 A;  3N0E A;  2VDO A;  5HE2 B;  4G1M A;  2P9P C;  2AGL A;  4GZ8 A;  2IUV A;  3EU7 A;  4OWR A;  2GC4 A;  5C2W B;  1U4C A;  3SBP A;  2G9A A;  2J56 H;  4J79 A;  3EQ9 A;  4LGN A;  3JRO A;  4PC0 A;  3VGZ A;  3V9F A;  3B7F A;  3RFG A;  4JSN C;  4J78 A;  1K32 A;  4BH6 A;  3OKW A;  3JZN A;  1TYE A;  1MG3 A;  3OL2 B;  4CY1 A;  5A2Q g;  4UI9 R;  3CIK B;  3SBR A;  5I5I A;  4A08 A;  3UVO A;  2XL2 A;  3GC3 B;  2VDN A;  5FFG A;  1MG2 A;  2B5L A;  3NVQ A;  4A0A B;  5EM2 B;  2JKX A;  3OW8 A;  4IA9 A;  4UM9 A;  5HDB A;  4CI8 A;  2AGX A;  4JSX C;  5GXH A;  1B9X A;  3GD1 I;  3K26 A;  1PEV A;  3MXX A;  1PGU A;  4GGC A;  4NSX A;  1E8M A;  5EMJ B;  4ZN4 A;  3DDU A;  3FRX A;  1NR0 A;  3BG1 A;  3CFV A;  3SBQ A;  2BBK H;  5AMS A;  1P22 A;  4YVD A;  1JJU B;  2I0S A;  5M5V A;  3C5M A;  4D6V A;  2OVR B;  1N6F A;  1FWX A;  1GOG A;  3K6S A;  4FWW A;  1JTD B;  2HES X;  5FKS A;  5KDO B;  4MK0 B;  3IUQ A;  2H9N A;  4PXW A;  3JB9 L;  2CO0 C;  3VH0 A;  2HU7 A;  4O3U B;  2B4E A;  4Z7Q A;  2HYE A;  4O1Q D;  1E8N A;  3ZWL B;  2P9S C;  1VZ2 A;  2HJ4 A;  4ESG A;  5AJA A;  2QC5 A;  4U7A A;  4LG9 A;  5I5M A;  1GXR A;  5CXC A;  3I89 A;  4Y7R A;  3ZE1 A;  4J8B A;  4O2W A;  5HYN B;  3PE7 A;  4BCD A;  3IIW A;  4DNV A;  3K71 A;  3ZDX A;  2EIE A;  1GG2 B;  4NEN A;  1U2V C;  3KRW B;  3QI0 A;  4L1Q D;  3VA6 A;  2CN2 A;  4L3H D;  1XKS A;  1PI6 A;  3O4H A;  2BKL A;  3NIF A;  3T3P A;  1H2Z A;  2H9P A;  2P9U C;  4IMM A;  2BCJ B;  2OK6 A;  5K1C C;  2YNN A;  4XYH A;  2PM9 A;  2YB8 B;  2HU5 A;  2QXV A;  3OKY A;  5FLX g;  2P9N C;  1A0R B;  2I3T A;  3EI4 B;  5CYK B;  5EAM A;  5TEF A;  3JPX A;  5FFO A;  4GGA A;  2IUP A;  3O4G A;  1O6F A;  4FAN D;  3IIY A;  4KFM B;  3UKU C;  4AX4 A;  1JV2 A;  3O4I A;  5HQG A;  3SFZ A;  3UVM A;  1GP2 B;  4GM3 A;  1O6G A;  3FGB A;  5TF2 A;  2I0T A;  5TDH B;  5CXB A;  5H14 A;  1TYQ C;  4Z8L A;  5THA A;  2WQ8 A;  2VDR A;  2VDK A;  3AL8 B;  4J73 A;  3SJL D;  4D9S A;  1UOO A;  3ODT A;  2H9M A;  2IWK A;  4PNK B;  1R5M A;  2H47 A;  2P9I C;  4J0X A;  4I79 A;  5E6R A;  4ZOY A;  3SLE D;  2GNQ A;  2H6N A;  2OVP B;  2QR5 A;  3K72 A;  5JWZ A;  4J77 A;  3PXW D;  2G99 A;  4PSW B;  2H14 A;  4X61 B;  2CNX A;  3I8E A;  3V5W B;  2H3X A;  3JZH A;  4WK0 A;  5M61 A;  4A2L A;  2YNO A;  2I3S A;  3J80 g;  1OMW B;  4A11 B;  3FM0 A;  3EI3 B;  4JXM A;  4CZV A;  4E5Z B;  2OK4 A;  3PXT D;  3W15 A;  5C9Z B;  5IJ8 E;  4CI3 A;  1H2Y A;  4AMY A;  2IUQ A;  4A7J A;  3UVK A;  4CI2 A;  3IKO A;  1U8C A;  5I5J A;  4L1M A;  4A09 B;  4JD2 C;  4A0B A;  3MKQ A;  4J81 A;  3HFQ A;  2OJY A;  4J82 A;  2Z2O A;  4JT5 C;  3I7L A;  4FA1 D;  4GGD A;  4MMZ A;  5E6S A;  1NEX B;  1C9I A;  4O02 A;  2HXC A;  5IGO A;  3L4O D;  3MKS B;  5GXI A;  4GQ2 P;  5IT9 g;  2CE9 A;  3ZDY A;  1K3I A;  3C75 H;  5C2V B;  3ZE2 A;  5FKT A;  4G56 B;  3BWS A;  3UVN A;  3JRP A;  4ZOV A;  3SHF A;  1B9Y A;  1L5G A;  3I7K A;  4J84 A;  5B4W A;  2EIC A;  3DWL C;  4GMB A;  3EWE A;  3PSL A;  3IJ1 A;  3I2N A;  4XEI C;  1JMZ B;  3C9C A;  3NID A;  2EBS A;  2O9K A;  2Z2P A;  5K19 A;  3EI1 A;  2VC2 A;  4NBM A;  3MUO A;  2Q7Q A;  4K3J B;  3J81 g;  5EMM B;  4U1E I;  4A2M A;  4A08 B;  3V4V A;  3E0C A;  3I8C A;  2B5N A;  1MDA H;  3P4F A;  5GSA A;  1S4U X;  5EAP A;  3IUL A;  5IJ7 E;  1L0Q A;  3IUR A;  2XL3 A;  4QRJ A;  2VDQ A;  2XYI A;  1VZ3 A;  2UZX B;  4QAM A;  3OTT A;  4G1E A;  4R7A B;  2VZ3 A;  2HKM A;  3I7O A;  2PBI B;  1XHM A;  4JT6 C;  4ERY A;  3I7H A;  2AGZ A;  4BL0 A;  1UTC A;  3IJ0 A;  3EI2 A;  3OKT A;  4PBY A;  1YFQ A;  4O9D A;  4XYI A;  4CY2 A;  2YBA A;  4CY5 A;  4NAA A;  3RN0 D;  5IC7 A;  3JZG A;  2GC7 A;  4DNU A;  3O4J A;  2HU8 A;  3BG0 A;  3F3G A;  4GQ1 A;  3RN1 D;  4CY3 A;  1H2X A;  5CXC B;  2AH0 A;  4MMX A;  1BPO A;  3NIG A;  3JAM g;  3V4P A;  5FA5 B;  3SN6 B;  1E5T A;  4AOW A;  4QQE A;  2UZY B;  4GM9 A;  3L4M D;  2I0R A;  1SQJ A;  4ZOZ A;  3OL2 A;  3I7P A;  5FXY A;  2EIB A;  5EAL A;  1QFM A;  2YNP A;  2VZ1 A;  2IUR A;  3SMR A;  4MMY A; 
#chains in the Genus database with same CATH homology
 2AQ5 A;  2AH1 A;  3AL9 A;  5EMK B;  2CN3 A;  4A0A A;  4JSP C;  5EM2 A;  2PM9 B;  3AFC A;  4CC9 A;  3MZK A;  3OKY B;  3EI2 B;  5FKR A;  4HDJ A;  4K3I D;  3F3F A;  2IAA A;  2AGW A;  5HE3 B;  2XU7 A;  5EML B;  5CXB B;  2P9K C;  3PVU B;  4GQB B;  1PBY B;  2AGY A;  4QL1 A;  4JSV C;  4L9O A;  4E54 A;  3PVW B;  3C99 A;  3MZL A;  1VYH C;  3EMH A;  3SVW D;  3RSE C;  4FB1 D;  3RFH A;  4LG8 A;  4O3T B;  2MTA H;  5FQD A;  2TRC B;  2H9L A;  4OZU A;  3RRM C;  1SHY B;  4ERQ A;  4ES0 A;  3DM0 A;  4Y5R D;  2YMU A;  2H13 A;  1TBG A;  2J55 H;  3NVN A;  2P9L C;  2J57 G;  4AEZ A;  4H5I A;  2H68 A;  4EWR A;  2H6Q A;  1K8K C;  3CFS B;  2HKR A;  3UKR C;  1N6D A;  2B5M A;  3PSC B;  1JMX B;  3SWS D;  3GRE A;  5H17 A;  4FA4 D;  3EI4 A;  4A0B B;  5CYK A;  4N14 A;  5HE0 B;  4X3E A;  3U4Y A;  4E54 B;  1RI6 A;  4CZY A;  4TZ4 A;  4H5J A;  2HJB A;  1N6E A;  3V7D B;  4J0W A;  4PBZ A;  3PXS D;  4ZOX A;  5TEE A;  3DXM C;  5EAR A;  4ERZ A;  4D0K A;  3N0D A;  4X63 B;  3AL8 A;  3DXK C;  3ORV D;  3UR4 A;  4J86 A;  5IGQ A;  4FAV D;  2OIZ A;  2CE8 A;  2Z2N A;  1Q47 A;  4L3G D;  2H6K A;  5AFU 3;  3EI1 B;  1JOF A;  3NVX A;  5FKQ A;  2CO0 A;  3IJC A;  3K27 A;  4J8G A;  1SQ9 A;  1OLZ A;  4BUJ C;  4A11 A;  1QNI A;  3EI3 A;  4E5Z A;  4QT8 A;  4FA5 D;  3I7N A;  4CI1 A;  3RMZ D;  3DSM A;  5SXM A;  5GMK n;  4PSX B;  3SXT D;  3KRX B;  3EG6 A;  4FA9 D;  3MMY A;  1ERJ A;  1GOT B;  2PM7 B;  4A09 A;  3GFC A;  3UVL A;  3AH8 B;  4J87 A;  5HE1 B;  3F3P A;  2IWF A;  4FHL A;  4GM8 A;  2W18 A;  4CZX A;  3SCY A;  3RLM D;  2PM6 B;  4O45 A;  4X60 B;  2OVQ B;  5H1M A;  3A0F A;  1XIP A;  3N0E A;  5HE2 B;  2P9P C;  2AGL A;  4GZ8 A;  2IUV A;  3EU7 A;  4OWR A;  2GC4 A;  5C2W B;  1U4C A;  3SBP A;  2G9A A;  2J56 H;  4J79 A;  4LGN A;  3JRO A;  4PC0 A;  3VGZ A;  3V9F A;  3B7F A;  3RFG A;  4JSN C;  4J78 A;  1K32 A;  4BH6 A;  3OKW A;  3JZN A;  3OL2 B;  1MG3 A;  4CY1 A;  5A2Q g;  4UI9 R;  3CIK B;  3SBR A;  5I5I A;  4A08 A;  3UVO A;  2XL2 A;  1MG2 A;  2B5L A;  3NVQ A;  4A0A B;  5EM2 B;  3OW8 A;  4IA9 A;  4CI8 A;  2AGX A;  4JSX C;  5GXH A;  1B9X A;  3K26 A;  1PEV A;  3MXX A;  1PGU A;  4GGC A;  4NSX A;  5EMJ B;  4ZN4 A;  3FRX A;  1NR0 A;  3BG1 A;  3CFV A;  3SBQ A;  2BBK H;  5AMS A;  1P22 A;  4YVD A;  1JJU B;  2I0S A;  3C5M A;  4D6V A;  2OVR B;  1N6F A;  1FWX A;  4FWW A;  2HES X;  5FKS A;  5KDO B;  4MK0 B;  2H9N A;  4PXW A;  3JB9 L;  2CO0 C;  3VH0 A;  4O3U B;  2B4E A;  2HYE A;  4O1Q D;  3ZWL B;  2P9S C;  2HJ4 A;  4ESG A;  5AJA A;  2QC5 A;  4U7A A;  4LG9 A;  5I5M A;  1GXR A;  5CXC A;  3I89 A;  4Y7R A;  4J8B A;  5HYN B;  3PE7 A;  3IIW A;  1GG2 B;  1U2V C;  3KRW B;  4L1Q D;  3VA6 A;  2CN2 A;  4L3H D;  1XKS A;  1PI6 A;  2H9P A;  2P9U C;  4IMM A;  2BCJ B;  2OK6 A;  5K1C C;  2YNN A;  4XYH A;  2PM9 A;  2YB8 B;  2QXV A;  3OKY A;  5FLX g;  2P9N C;  1A0R B;  2I3T A;  3EI4 B;  5CYK B;  5EAM A;  5TEF A;  3JPX A;  4GGA A;  2IUP A;  4FAN D;  3IIY A;  4KFM B;  3UKU C;  5HQG A;  3SFZ A;  3UVM A;  1GP2 B;  4GM3 A;  3FGB A;  5TF2 A;  2I0T A;  5TDH B;  5CXB A;  5H14 A;  1TYQ C;  4Z8L A;  5THA A;  3AL8 B;  4J73 A;  3SJL D;  3ODT A;  2H9M A;  2IWK A;  4PNK B;  1R5M A;  2H47 A;  2P9I C;  4J0X A;  4I79 A;  4ZOY A;  3SLE D;  2GNQ A;  2H6N A;  2OVP B;  5JWZ A;  4J77 A;  3PXW D;  2G99 A;  4PSW B;  2H14 A;  4X61 B;  2CNX A;  3I8E A;  3V5W B;  2H3X A;  3JZH A;  4A2L A;  2YNO A;  2I3S A;  3J80 g;  1OMW B;  4A11 B;  3FM0 A;  3EI3 B;  4JXM A;  4CZV A;  4E5Z B;  2OK4 A;  3PXT D;  3W15 A;  5C9Z B;  5IJ8 E;  4CI3 A;  2IUQ A;  4A7J A;  3UVK A;  4CI2 A;  3IKO A;  5I5J A;  4A09 B;  4JD2 C;  4A0B A;  3MKQ A;  4J81 A;  3HFQ A;  2OJY A;  4J82 A;  2Z2O A;  4JT5 C;  3I7L A;  4FA1 D;  4GGD A;  1NEX B;  2HXC A;  5IGO A;  3L4O D;  3MKS B;  5GXI A;  4GQ2 P;  5IT9 g;  2CE9 A;  3C75 H;  5C2V B;  5FKT A;  4G56 B;  3BWS A;  3UVN A;  3JRP A;  4ZOV A;  3SHF A;  1B9Y A;  3I7K A;  4J84 A;  5B4W A;  3DWL C;  4GMB A;  3EWE A;  3PSL A;  3IJ1 A;  3I2N A;  4XEI C;  1JMZ B;  3C9C A;  2EBS A;  2O9K A;  2Z2P A;  5K19 A;  3EI1 A;  2Q7Q A;  4K3J B;  3J81 g;  5EMM B;  4U1E I;  4A2M A;  4A08 B;  3E0C A;  3I8C A;  2B5N A;  1MDA H;  3P4F A;  5GSA A;  1S4U X;  5EAP A;  5IJ7 E;  1L0Q A;  2XL3 A;  4QRJ A;  2XYI A;  2UZX B;  3OTT A;  4R7A B;  2HKM A;  3I7O A;  2PBI B;  1XHM A;  4JT6 C;  4ERY A;  3I7H A;  2AGZ A;  4BL0 A;  3IJ0 A;  3EI2 A;  3OKT A;  4PBY A;  1YFQ A;  4O9D A;  4XYI A;  4CY2 A;  2YBA A;  4CY5 A;  3RN0 D;  5IC7 A;  3JZG A;  2GC7 A;  3BG0 A;  3F3G A;  4GQ1 A;  3RN1 D;  4CY3 A;  5CXC B;  2AH0 A;  3JAM g;  5FA5 B;  3SN6 B;  4AOW A;  4QQE A;  2UZY B;  4GM9 A;  3L4M D;  2I0R A;  1SQJ A;  4ZOZ A;  3OL2 A;  3I7P A;  5FXY A;  5EAL A;  2YNP A;  2IUR A;  3SMR A;  3ULE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...