3T3PA

A novel high affinity integrin alphaiibbeta3 receptor antagonist that unexpectedly displaces mg2+ from the beta3 midas
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
publication title Structure-Guided Design of a High-Affinity Platelet Integrin alphaIIbbeta3 Receptor Antagonist That Disrupts Mg2+ Binding to the MIDAS
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3t3pA00
3ZDXA 3ZE2A 5E6UA 3ZE0A 4IRZA 3ZE1A 2VDMA 1L5GA 4G1EA 3NIDA 3NIGA 2VDPA 4WJKA 3V4VA 3FCSA 3VI3A 1JV2A 4WK2A 5E6RA 4Z7QA 4Z7OA 2VDRA 4UM8A 5FFGA 1U8CA 5HDBA 3K72A 2VDKA 3VI4A 3K71A 4G1MA 3T3PA 4WK4A 4UM9A 4WK0A 4O02A 3V4PA 1M1XA 4Z7NA 2VC2A 3K6SA 2VDNA 3NIFA 4MMXA 3IJEA 4NENA 1TYEA 2VDOA 2VDQA 5E6SA 2VDLA 4MMYA 3ZDYA 3ZDZA 3T3MA 4MMZA 5FFOA 3FCUA
chains in the Genus database with same CATH superfamily
5EM2B 2I3SA 4ERZA 4NAAA 1QNIA 4IRZA 3N0EA 2HU5A 4GGDA 1L5GA 5EMLB 3FCSA 4LGNA 4GGAA 2EBSA 3JZNA 4GGCA 1UOQA 2CE8A 5M5UA 2W18A 2HU8A 2VDKA 3JRPA 2GNQA 5C86A 5IGQA 1VE6A 4I79A 4EWRA 4NBMA 5HE3B 4DNVA 3NIFA 4L1QD 3J80g 3OKYB 3SBPA 1R5MA 3SJLD 4X3EA 3ZWLB 3MMYA 3OL2B 3AFCA 5IGOA 1S4UX 3A0FA 1SQ9A 5CXCA 4E5ZB 4QQEA 5AJAA 4CY2A 4FA1D 4OWRA 2OVQB 4CC9A 5I5JA 4UM8A 3I8EA 3EI2B 1A0RB 1GP2B 5M61A 4O3UB 4WK0A 5CYKA 2I0RA 1PI6A 3EWEA 5AMSA 1GOTB 2XZGA 1E8NA 5CXBB 3OW8A 3FGBA 4A09A 2CNXA 1XHMA 1VZ3A 4A7JA 1H2XA 1N6DA 2YB8B 4D9SA 4BP9A 1QFMA 2VDQA 5FKSA 3N0DA 2O9KA 4E54A 3IULA 4BCBA 1N6EA 3EI4B 3RRMC 3EMHA 3UVOA 3NIGA 2CO0A 4WJKA 4DNUA 4FA5D 2GC7A 1B9XA 1PGUA 4PBZA 4BCDA 3JROA 5C2VB 3AL8A 3U4YA 2OJYA 2AGWA 1FWXA 2CN3A 3PXSD 1ERJA 1JMXB 3V4PA 2VDNA 4KFMB 1GOGA 2P9SC 5FKTA 4Y7RA 2HYEA 2H9NA 2I0SA 2IUQA 3DXKC 2P9KC 4JXMA 4ESGA 4J8BA 3ODTA 1RI6A 2EIEA 4D0KA 4H5IA 3EG6A 4J82A 1TBGA 5EARA 1A12A 2MTAH 4PSXB 3SHFA 4A0AA 3MUOA 1MDAH 4X61B 4LG9A 2AGYA 3K26A 4PC0A 4JD2C 4JSPC 1O6FA 3HFQA 3SFZA 4CY3A 4A0BB 5IC7A 5FLXg 3V5WB 3JB9L 2QZPA 4LG8A 5FFOA 2QC5A 4FAVD 5H17A 3ZE0A 4G55A 2HJ4A 3JZHA 4PBYA 5GXHA 3V4VA 2BKLA 1JOFA 1C9LA 5C9ZB 1U8CA 1QFSA 1TYQC 5HDBA 4BP8A 2UZXB 2XDWA 3KRXB 4BUJC 1M1XA 4QRJA 1NEXB 3IJEA 4NENA 1BPOA 2I3TA 2P9UC 4A11B 1N6FA 3IUNA 3IVMA 2PM9A 4MMZA 3PXWD 3I7LA 1U4CA 5C2WB 5SXMA 2GC4A 4CI8A 4ZOVA 4CY1A 4X60B 4CZVA 2H6NA 4G1EA 4L9OA 2IURA 5CYKB 3I7OA 3SVWD 3NVNA 3I2NA 3OKWA 2YMUA 5I5MA 4O45A 4QT8A 4O9DA 1PEVA 5AFU3 2G9AA 3K72A 2CE9A 2HXCA 3I7KA 3IUQA 3CFVA 3CIKB 2HKRA 4Y5RD 5TEFA 4XEIC 3JZGA 3PE7A 4H5JA 3EI3B 3MXXA 4MMYA 3MZKA 2OK6A 5H14A 2XE4A 3FCUA 3GFCA 5E6UA 3SWSD 4JT6C 3MKQA 2H9MA 2Z2OA 2TRCB 3PVUB 2YBAA 4YVDA 5FA5B 3O4GA 4J81A 4Z8LA 3K27A 3DM0A 4RE5A 4BH6A 1UOOA 2AH1A 5TF2A 3SMRA 5FXYA 1E5TA 3PSCB 2YNNA 2P9IC 3B7FA 3GC3B 3C5MA 3SXTD 4ERYA 1SHYB 2BCJB 4CY5A 4GZ8A 2PBIB 3ZDXA 4ZOYA 1VE7A 5I5IA 3GD1I 4NSXA 3BG1A 3EQ9A 4PXWA 4JHNA 5HE2B 4A08A 2UZYB 3PVWB 5GMKn 5EM2A 3QI0A 4AEZA 5KDOB 4UM9A 3E0CA 2Z2NA 4O02A 5EALA 3SN6B 4FB1D 5C92A 2CN2A 2VC2A 3EI1A 5JWZA 4JSNC 1C9IA 3SLED 3RN1D 3ZDZA 3I7NA 4ZOZA 1MG3A 3OKYA 3FM0A 3RFHA 2H9PA 3OL2A 4AMZA 3KRWB 3DSMA 3IIWA 3O4IA 4CZXA 4O1QD 2B5LA 4GMBA 3W15A 3RSEC 2BBKH 4QAMA 2OVRB 4K3ID 3IIYA 2PM9B 4CZYA 3EI2A 3PSLA 4JSXC 4R7AB 3EU7A 2J56H 5TDHB 5E6SA 1T2XA 4O2WA 5CXBA 1OMWB 2HESX 4J8GA 4HDJA 3J81g 3VH0A 2P9NC 3DXMC 2HJBA 2VZ1A 3MZLA 4J0XA 5B4WA 3IUMA 5E6RA 4JSVC 4O3TB 2YNOA 1MG2A 3EI4A 5FFGA 2QR5A 5EAMA 4CI2A 4ES0A 2XYIA 4MK0B 2IUVA 3V9FA 2H14A 2OIZA 2PM6B 2XU7A 1E8MA 4A2MA 3QHYB 5CXCB 2J57G 1NR0A 4X63B 3O4JA 1O6GA 3ZDYA 3NVQA 4GQBB 1UOPA 5K19A 3IUJA 1GOHA 3O4HA 3ULEC 4GM9A 4ERQA 1H2WA 3IKOA 3ZE1A 3OTTA 3NIDA 2EIDA 2VDPA 1P22A 4CI1A 1JV2A 4AOWA 5TEEA 4PSWB 3L4OD 4ZOXA 4J73A 4BCCA 5HE1B 3K71A 4A09B 4L1MA 2P9PC 3UVLA 3UR4A 4Z7NA 4E54B 3MKSB 1B9YA 4MMXA 4FA4D 3VA6A 2Q7QA 1K32A 1YFQA 4CI3A 3C99A 4A08B 4J0WA 4IMMA 4UI9R 4A0BA 3AL8B 4J84A 3VGZA 3GREA 1JMZB 1JTDB 3JAMg 4G56B 3EI1B 4QL1A 3VI4A 4G1MA 3V7DB 3C9CA 3UVMA 3ORVD 3DWLC 3OKTA 2IWKA 5H1MA 1U2VC 4JHPC 4J79A 5FKRA 1PBYB 1H2ZA 2IWFA 2YNPA 3F3PA 4K3JB 3OF7A 5GXIA 3ZE2A 3MVDK 5IT9g 2OK4A 4OZUA 4A11A 3UVNA 4A0AB 3BG0A 4N14A 3EQ7A 4AN0A 4J87A 2H68A 3UKRC 4WK4A 2J55H 4AX4A 1GG2B 1UTCA 5EMMB 3F3GA 2HKMA 2B5NA 5EMJB 5FKQA 4PNKB 1GXRA 2VDOA 2H3XA 3BWSA 3RFGA 5K1CC 1GOFA 3NVXA 5HYNB 4GQ2P 1VYHC 4U1EI 1K8KC 2QXVA 2AH0A 4FWWA 2G99A 2VDMA 3EI3A 5THAA 3RMZD 3P4FA 1XIPA 2H6QA 4FAND 4Z7QA 4E5ZA 2AGXA 1OLZA 2VDRA 5M5VA 3IURA 2CO0C 4A2LA 2B5MA 5FQDA 2JKXA 3FRXA 3UKUC 3T3PA 2AGZA 3KCIA 5IJ8E 2XL3A 3K6SA 3EQ8A 3JPXA 4ZN4A 1YR2A 1Q47A 3MUNA 2H47A 5M5TA 2VDLA 4AN1A 3CFSB 5EAPA 3RLMD 4L3GD 5GSAA 2H9LA 3I8CA 4XYHA 1JJUB 2XL2A 3L4MD 1XKSA 3VI3A 4TZ4A 3IJ0A 3C75H 4IA9A 4Z7OA 3IJ1A 4L3HD 1L0QA 3IJCA 3DDUA 4D6VA 1H2YA 4XYIA 3SBQA 4GM3A 3AH8B 3AL9A 4FA9D 5IJ7E 1SQJA 5M5RA 3SCYA 3T3MA 2H13A 3I7HA 4AMYA 4U7AA 4J78A 2PM7B 4J77A 2EICA 2Z2PA 3SBRA 2AGLA 2I0TA 2IAAA 1K3IA 4WK2A 4DNWA 5HE0B 3I7PA 4RE6A 2AQ5A 5A2Qg 2WQ8A 4GM8A 4NC4A 5EMKB 4FHLA 3F3FA 2P9LC 2VZ3A 4J86A 4GQ1A 2HU7A 1I2MB 1VZ2A 3I89A 1TYEA 2OVPB 2IUPA 3PXTD 2H6KA 4JT5C 2EIBA 5HQGA 4BL0A 2B4EA 5M5SA 3RN0D 3UVKA
chains in the Genus database with same CATH topology
3ZDXA 3ZE2A 5E6UA 3ZE0A 4IRZA 3ZE1A 2VDMA 1L5GA 4G1EA 3NIDA 3NIGA 2VDPA 4WJKA 3V4VA 3FCSA 3VI3A 1JV2A 4WK2A 5E6RA 4Z7QA 4Z7OA 2VDRA 4UM8A 5FFGA 1U8CA 5HDBA 3K72A 2VDKA 3VI4A 3K71A 4G1MA 3T3PA 4WK4A 4UM9A 4WK0A 4O02A 3V4PA 1M1XA 4Z7NA 2VC2A 3K6SA 2VDNA 3NIFA 4MMXA 3IJEA 4NENA 1TYEA 2VDOA 2VDQA 5E6SA 2VDLA 4MMYA 3ZDYA 3ZDZA 3T3MA 4MMZA 5FFOA 3FCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDX A;  3ZE2 A;  5E6U A;  3ZE0 A;  4IRZ A;  3ZE1 A;  2VDM A;  1L5G A;  4G1E A;  3NID A;  3NIG A;  2VDP A;  4WJK A;  3V4V A;  3FCS A;  3VI3 A;  1JV2 A;  4WK2 A;  5E6R A;  4Z7Q A;  4Z7O A;  2VDR A;  4UM8 A;  5FFG A;  1U8C A;  5HDB A;  3K72 A;  2VDK A;  3VI4 A;  3K71 A;  4G1M A;  3T3P A;  4WK4 A;  4UM9 A;  4WK0 A;  4O02 A;  3V4P A;  1M1X A;  4Z7N A;  2VC2 A;  3K6S A;  2VDN A;  3NIF A;  4MMX A;  3IJE A;  4NEN A;  1TYE A;  2VDO A;  2VDQ A;  5E6S A;  2VDL A;  4MMY A;  3ZDY A;  3ZDZ A;  3T3M A;  4MMZ A;  5FFO A;  3FCU A; 
#chains in the Genus database with same CATH topology
 5EM2 B;  2I3S A;  4ERZ A;  4NAA A;  1QNI A;  4IRZ A;  3N0E A;  2HU5 A;  4GGD A;  1L5G A;  5EML B;  3FCS A;  4LGN A;  4GGA A;  2EBS A;  3JZN A;  4GGC A;  1UOQ A;  2CE8 A;  5M5U A;  2W18 A;  2HU8 A;  2VDK A;  3JRP A;  2GNQ A;  5C86 A;  5IGQ A;  1VE6 A;  4I79 A;  4EWR A;  4NBM A;  5HE3 B;  4DNV A;  3NIF A;  4L1Q D;  3J80 g;  3OKY B;  3SBP A;  1R5M A;  3SJL D;  4X3E A;  3ZWL B;  3MMY A;  3OL2 B;  3AFC A;  5IGO A;  1S4U X;  3A0F A;  1SQ9 A;  5CXC A;  4E5Z B;  4QQE A;  5AJA A;  4CY2 A;  4FA1 D;  4OWR A;  2OVQ B;  4CC9 A;  5I5J A;  4UM8 A;  3I8E A;  3EI2 B;  1A0R B;  1GP2 B;  5M61 A;  4O3U B;  4WK0 A;  5CYK A;  2I0R A;  1PI6 A;  3EWE A;  5AMS A;  1GOT B;  2XZG A;  1E8N A;  5CXB B;  3OW8 A;  3FGB A;  4A09 A;  2CNX A;  1XHM A;  1VZ3 A;  4A7J A;  1H2X A;  1N6D A;  2YB8 B;  4D9S A;  4BP9 A;  1QFM A;  2VDQ A;  5FKS A;  3N0D A;  2O9K A;  4E54 A;  3IUL A;  4BCB A;  1N6E A;  3EI4 B;  3RRM C;  3EMH A;  3UVO A;  3NIG A;  2CO0 A;  4WJK A;  4DNU A;  4FA5 D;  2GC7 A;  1B9X A;  1PGU A;  4PBZ A;  4BCD A;  3JRO A;  5C2V B;  3AL8 A;  3U4Y A;  2OJY A;  2AGW A;  1FWX A;  2CN3 A;  3PXS D;  1ERJ A;  1JMX B;  3V4P A;  2VDN A;  4KFM B;  1GOG A;  2P9S C;  5FKT A;  4Y7R A;  2HYE A;  2H9N A;  2I0S A;  2IUQ A;  3DXK C;  2P9K C;  4JXM A;  4ESG A;  4J8B A;  3ODT A;  1RI6 A;  2EIE A;  4D0K A;  4H5I A;  3EG6 A;  4J82 A;  1TBG A;  5EAR A;  1A12 A;  2MTA H;  4PSX B;  3SHF A;  4A0A A;  3MUO A;  1MDA H;  4X61 B;  4LG9 A;  2AGY A;  3K26 A;  4PC0 A;  4JD2 C;  4JSP C;  1O6F A;  3HFQ A;  3SFZ A;  4CY3 A;  4A0B B;  5IC7 A;  5FLX g;  3V5W B;  3JB9 L;  2QZP A;  4LG8 A;  5FFO A;  2QC5 A;  4FAV D;  5H17 A;  3ZE0 A;  4G55 A;  2HJ4 A;  3JZH A;  4PBY A;  5GXH A;  3V4V A;  2BKL A;  1JOF A;  1C9L A;  5C9Z B;  1U8C A;  1QFS A;  1TYQ C;  5HDB A;  4BP8 A;  2UZX B;  2XDW A;  3KRX B;  4BUJ C;  1M1X A;  4QRJ A;  1NEX B;  3IJE A;  4NEN A;  1BPO A;  2I3T A;  2P9U C;  4A11 B;  1N6F A;  3IUN A;  3IVM A;  2PM9 A;  4MMZ A;  3PXW D;  3I7L A;  1U4C A;  5C2W B;  5SXM A;  2GC4 A;  4CI8 A;  4ZOV A;  4CY1 A;  4X60 B;  4CZV A;  2H6N A;  4G1E A;  4L9O A;  2IUR A;  5CYK B;  3I7O A;  3SVW D;  3NVN A;  3I2N A;  3OKW A;  2YMU A;  5I5M A;  4O45 A;  4QT8 A;  4O9D A;  1PEV A;  5AFU 3;  2G9A A;  3K72 A;  2CE9 A;  2HXC A;  3I7K A;  3IUQ A;  3CFV A;  3CIK B;  2HKR A;  4Y5R D;  5TEF A;  4XEI C;  3JZG A;  3PE7 A;  4H5J A;  3EI3 B;  3MXX A;  4MMY A;  3MZK A;  2OK6 A;  5H14 A;  2XE4 A;  3FCU A;  3GFC A;  5E6U A;  3SWS D;  4JT6 C;  3MKQ A;  2H9M A;  2Z2O A;  2TRC B;  3PVU B;  2YBA A;  4YVD A;  5FA5 B;  3O4G A;  4J81 A;  4Z8L A;  3K27 A;  3DM0 A;  4RE5 A;  4BH6 A;  1UOO A;  2AH1 A;  5TF2 A;  3SMR A;  5FXY A;  1E5T A;  3PSC B;  2YNN A;  2P9I C;  3B7F A;  3GC3 B;  3C5M A;  3SXT D;  4ERY A;  1SHY B;  2BCJ B;  4CY5 A;  4GZ8 A;  2PBI B;  3ZDX A;  4ZOY A;  1VE7 A;  5I5I A;  3GD1 I;  4NSX A;  3BG1 A;  3EQ9 A;  4PXW A;  4JHN A;  5HE2 B;  4A08 A;  2UZY B;  3PVW B;  5GMK n;  5EM2 A;  3QI0 A;  4AEZ A;  5KDO B;  4UM9 A;  3E0C A;  2Z2N A;  4O02 A;  5EAL A;  3SN6 B;  4FB1 D;  5C92 A;  2CN2 A;  2VC2 A;  3EI1 A;  5JWZ A;  4JSN C;  1C9I A;  3SLE D;  3RN1 D;  3ZDZ A;  3I7N A;  4ZOZ A;  1MG3 A;  3OKY A;  3FM0 A;  3RFH A;  2H9P A;  3OL2 A;  4AMZ A;  3KRW B;  3DSM A;  3IIW A;  3O4I A;  4CZX A;  4O1Q D;  2B5L A;  4GMB A;  3W15 A;  3RSE C;  2BBK H;  4QAM A;  2OVR B;  4K3I D;  3IIY A;  2PM9 B;  4CZY A;  3EI2 A;  3PSL A;  4JSX C;  4R7A B;  3EU7 A;  2J56 H;  5TDH B;  5E6S A;  1T2X A;  4O2W A;  5CXB A;  1OMW B;  2HES X;  4J8G A;  4HDJ A;  3J81 g;  3VH0 A;  2P9N C;  3DXM C;  2HJB A;  2VZ1 A;  3MZL A;  4J0X A;  5B4W A;  3IUM A;  5E6R A;  4JSV C;  4O3T B;  2YNO A;  1MG2 A;  3EI4 A;  5FFG A;  2QR5 A;  5EAM A;  4CI2 A;  4ES0 A;  2XYI A;  4MK0 B;  2IUV A;  3V9F A;  2H14 A;  2OIZ A;  2PM6 B;  2XU7 A;  1E8M A;  4A2M A;  3QHY B;  5CXC B;  2J57 G;  1NR0 A;  4X63 B;  3O4J A;  1O6G A;  3ZDY A;  3NVQ A;  4GQB B;  1UOP A;  5K19 A;  3IUJ A;  1GOH A;  3O4H A;  3ULE C;  4GM9 A;  4ERQ A;  1H2W A;  3IKO A;  3ZE1 A;  3OTT A;  3NID A;  2EID A;  2VDP A;  1P22 A;  4CI1 A;  1JV2 A;  4AOW A;  5TEE A;  4PSW B;  3L4O D;  4ZOX A;  4J73 A;  4BCC A;  5HE1 B;  3K71 A;  4A09 B;  4L1M A;  2P9P C;  3UVL A;  3UR4 A;  4Z7N A;  4E54 B;  3MKS B;  1B9Y A;  4MMX A;  4FA4 D;  3VA6 A;  2Q7Q A;  1K32 A;  1YFQ A;  4CI3 A;  3C99 A;  4A08 B;  4J0W A;  4IMM A;  4UI9 R;  4A0B A;  3AL8 B;  4J84 A;  3VGZ A;  3GRE A;  1JMZ B;  1JTD B;  3JAM g;  4G56 B;  3EI1 B;  4QL1 A;  3VI4 A;  4G1M A;  3V7D B;  3C9C A;  3UVM A;  3ORV D;  3DWL C;  3OKT A;  2IWK A;  5H1M A;  1U2V C;  4JHP C;  4J79 A;  5FKR A;  1PBY B;  1H2Z A;  2IWF A;  2YNP A;  3F3P A;  4K3J B;  3OF7 A;  5GXI A;  3ZE2 A;  3MVD K;  5IT9 g;  2OK4 A;  4OZU A;  4A11 A;  3UVN A;  4A0A B;  3BG0 A;  4N14 A;  3EQ7 A;  4AN0 A;  4J87 A;  2H68 A;  3UKR C;  4WK4 A;  2J55 H;  4AX4 A;  1GG2 B;  1UTC A;  5EMM B;  3F3G A;  2HKM A;  2B5N A;  5EMJ B;  5FKQ A;  4PNK B;  1GXR A;  2VDO A;  2H3X A;  3BWS A;  3RFG A;  5K1C C;  1GOF A;  3NVX A;  5HYN B;  4GQ2 P;  1VYH C;  4U1E I;  1K8K C;  2QXV A;  2AH0 A;  4FWW A;  2G99 A;  2VDM A;  3EI3 A;  5THA A;  3RMZ D;  3P4F A;  1XIP A;  2H6Q A;  4FAN D;  4Z7Q A;  4E5Z A;  2AGX A;  1OLZ A;  2VDR A;  5M5V A;  3IUR A;  2CO0 C;  4A2L A;  2B5M A;  5FQD A;  2JKX A;  3FRX A;  3UKU C;  3T3P A;  2AGZ A;  3KCI A;  5IJ8 E;  2XL3 A;  3K6S A;  3EQ8 A;  3JPX A;  4ZN4 A;  1YR2 A;  1Q47 A;  3MUN A;  2H47 A;  5M5T A;  2VDL A;  4AN1 A;  3CFS B;  5EAP A;  3RLM D;  4L3G D;  5GSA A;  2H9L A;  3I8C A;  4XYH A;  1JJU B;  2XL2 A;  3L4M D;  1XKS A;  3VI3 A;  4TZ4 A;  3IJ0 A;  3C75 H;  4IA9 A;  4Z7O A;  3IJ1 A;  4L3H D;  1L0Q A;  3IJC A;  3DDU A;  4D6V A;  1H2Y A;  4XYI A;  3SBQ A;  4GM3 A;  3AH8 B;  3AL9 A;  4FA9 D;  5IJ7 E;  1SQJ A;  5M5R A;  3SCY A;  3T3M A;  2H13 A;  3I7H A;  4AMY A;  4U7A A;  4J78 A;  2PM7 B;  4J77 A;  2EIC A;  2Z2P A;  3SBR A;  2AGL A;  2I0T A;  2IAA A;  1K3I A;  4WK2 A;  4DNW A;  5HE0 B;  3I7P A;  4RE6 A;  2AQ5 A;  5A2Q g;  2WQ8 A;  4GM8 A;  4NC4 A;  5EMK B;  4FHL A;  3F3F A;  2P9L C;  2VZ3 A;  4J86 A;  4GQ1 A;  2HU7 A;  1I2M B;  1VZ2 A;  3I89 A;  1TYE A;  2OVP B;  2IUP A;  3PXT D;  2H6K A;  4JT5 C;  2EIB A;  5HQG A;  4BL0 A;  2B4E A;  5M5S A;  3RN0 D;  3UVK A; 
#chains in the Genus database with same CATH homology
 3ZDX A;  3ZE2 A;  5E6U A;  3ZE0 A;  4IRZ A;  3ZE1 A;  2VDM A;  1L5G A;  4G1E A;  3NID A;  3NIG A;  2VDP A;  4WJK A;  3V4V A;  3FCS A;  3VI3 A;  1JV2 A;  4WK2 A;  5E6R A;  4Z7Q A;  4Z7O A;  2VDR A;  4UM8 A;  5FFG A;  1U8C A;  5HDB A;  3K72 A;  2VDK A;  3VI4 A;  3K71 A;  4G1M A;  3T3P A;  4WK4 A;  4UM9 A;  4WK0 A;  4O02 A;  3V4P A;  1M1X A;  4Z7N A;  2VC2 A;  3K6S A;  2VDN A;  3NIF A;  4MMX A;  3IJE A;  4NEN A;  1TYE A;  2VDO A;  2VDQ A;  5E6S A;  2VDL A;  4MMY A;  3ZDY A;  3ZDZ A;  3T3M A;  4MMZ A;  5FFO A;  3FCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...