3T3PA

A novel high affinity integrin alphaiibbeta3 receptor antagonist that unexpectedly displaces mg2+ from the beta3 midas
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Structure-Guided Design of a High-Affinity Platelet Integrin alphaIIbbeta3 Receptor Antagonist That Disrupts Mg2+ Binding to the MIDAS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 110
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3t3pA00
4NENA 4Z7QA 3FCUA 3ZDXA 3VI3A 2VDPA 3T3MA 1L5GA 4IRZA 4O02A 3FCSA 5HDBA 2VC2A 2VDRA 2VDKA 3ZDZA 4WK0A 3V4VA 3NIFA 4MMYA 4Z7OA 3IJEA 3ZE0A 1U8CA 4G1EA 3T3PA 4UM8A 4WK2A 2VDOA 1JV2A 1M1XA 4Z7NA 1TYEA 2VDQA 4MMZA 5FFOA 5E6RA 3K6SA 4MMXA 3ZE2A 4WK4A 3VI4A 3K72A 2VDLA 3NIGA 4G1MA 3ZE1A 5E6UA 4UM9A 2VDNA 4WJKA 3K71A 3V4PA 2VDMA 5E6SA 5FFGA 3NIDA 3ZDYA
chains in the Genus database with same CATH superfamily
4PBZA 1GOTB 4ES0A 4U7AA 1L5GA 4GM3A 4D6VA 2VZ3A 4J81A 3OF7A 1K32A 5FLXg 4JHPC 3K27A 2Z2OA 3NIFA 5GMKn 3ZE0A 1SQJA 2VDOA 4ZOYA 2IAAA 2P9UC 5I5IA 5C86A 4R7AB 2B4EA 1U4CA 2Q7QA 3AL8B 3ORVD 4PSXB 2H9MA 1UOQA 3IJCA 4XEIC 3UR4A 3EI4A 3MUOA 3I8CA 1JMZB 5I5JA 2PM6B 3MZLA 4Y5RD 4ZOVA 1UTCA 3UKRC 2AGXA 2H9PA 1XIPA 5CXBA 4KFMB 1SQ9A 2B5NA 3SN6B 4WK0A 3RFGA 2OVPB 3FGBA 4AN0A 4MMZA 5TEFA 4RE6A 2JKXA 2I3TA 3I7NA 2IWKA 3EQ9A 1OLZA 1S4UX 4J0WA 4LG9A 4Y7RA 3IVMA 2I0RA 5AJAA 5GSAA 1OMWB 4MK0B 5M5TA 4K3JB 3OW8A 3UVLA 4GGAA 5M5SA 4FHLA 4Z8LA 4PC0A 4ERZA 5FFGA 3AFCA 1PBYB 5FKQA 4GGCA 1BPOA 4G55A 2H14A 3DDUA 4J8BA 4CI2A 4FAND 3GD1I 3OL2A 3QHYB 3O4HA 4HDJA 2VC2A 2HJBA 1UOOA 4BH6A 1P22A 4O3UB 1JMXB 1TYEA 3PXSD 3U4YA 1PGUA 3N0EA 4E5ZB 3ZE2A 3EI4B 4LG8A 2H6NA 3GC3B 4GQ1A 5IT9g 3UVNA 3OKTA 4CZVA 4CC9A 5EAMA 2G99A 5IC7A 4ERQA 2IWFA 2YNNA 2B5MA 4D9SA 3SBPA 4JT5C 4JSVC 5CXBB 4CY3A 1A0RB 4BL0A 3V4VA 3HFQA 5THAA 1C9LA 2P9PC 1NEXB 3GREA 2HESX 3IIYA 2YNOA 1H2XA 1RI6A 2OJYA 1E5TA 3OTTA 4GGDA 4X61B 5FKRA 2CN3A 3DWLC 1A12A 2CE8A 4BP9A 4A09A 1B9XA 4CZXA 3SCYA 2XDWA 2H9LA 3N0DA 4QAMA 5EMMB 5E6SA 3IUMA 1H2WA 5H1MA 3RSEC 4GMBA 5GXHA 2XU7A 3C9CA 5FQDA 5CYKA 4O9DA 5HDBA 4J79A 5M5VA 3ZDZA 2VDKA 4A0AB 1JJUB 3UVMA 3F3PA 1GOFA 4WK2A 4L1QD 2YBAA 3K6SA 3BG1A 3IJ1A 4I79A 3ZE1A 3DXMC 2XL3A 3IUQA 4GZ8A 5IGQA 2O9KA 2VDNA 4WJKA 5K19A 3OKYA 4AMYA 2HYEA 4FB1D 5C92A 2GC4A 3P4FA 1GG2B 3QI0A 4NENA 3UKUC 2UZXB 3JZGA 2P9LC 4L3GD 5M5RA 4O2WA 4O02A 3FCSA 3MXXA 4O1QD 2Z2PA 3ZWLB 3W15A 4DNVA 1E8NA 2CO0C 2HU8A 2XYIA 5EMLB 4L3HD 3IJEA 4AEZA 4G1EA 4JD2C 5IJ7E 4A08A 1JV2A 2HKMA 5FFOA 4IMMA 3K26A 2PM9B 3F3FA 5A2Qg 1QFSA 2H47A 3RRMC 5EMKB 2EIBA 3EI1B 2AGWA 4MMXA 2MTAH 3VH0A 2OIZA 4J77A 3RMZD 4FA9D 1XHMA 1FWXA 1H2YA 3V9FA 2TRCB 2H9NA 3ZDXA 4JXMA 4AMZA 4N14A 4FA4D 1SHYB 2CNXA 3I7OA 5H14A 3FM0A 3KCIA 3ULEC 4Z7NA 2I0SA 2HU5A 4JT6C 2VDQA 2CO0A 1T2XA 4J82A 4JHNA 4A0BB 1VZ2A 3EI3B 2IUQA 4E54A 1GP2B 3K72A 4G1MA 3OKYB 3J80g 2B5LA 4BCBA 5GXIA 2VDMA 3SXTD 2P9SC 5CXCA 3ZDYA 1B9YA 4Z7QA 2VDPA 3I2NA 2P9KC 4FA1D 5FKTA 4CI1A 3EMHA 4ZN4A 3PE7A 3MKSB 1YR2A 5TDHB 1I2MB 2YB8B 5I5MA 2XZGA 5E6RA 3BWSA 5K1CC 2HXCA 5FA5B 2I0TA 4L9OA 3JRPA 4QL1A 2VDLA 3EG6A 3C75H 3RLMD 4CY2A 2CE9A 3K71A 3EI2A 3RFHA 5TEEA 3EWEA 3SWSD 2AGYA 4GM8A 5SXMA 3GFCA 3IULA 3T3MA 2EICA 4CY1A 4IA9A 4BP8A 1MG2A 2AQ5A 2EIEA 5HYNB 3FRXA 4BUJC 3SMRA 4E54B 5EM2A 5FKSA 1U2VC 5JWZA 4WK4A 5HE2B 4OWRA 5M61A 3I7KA 3PXWD 1UOPA 2CN2A 5IGOA 5IJ8E 5KDOB 3F3GA 4DNWA 3VI3A 3OL2B 4QRJA 1K3IA 1PI6A 4JSNC 3UVOA 2I3SA 3O4GA 4PNKB 2H68A 3SBQA 1NR0A 2BCJB 5C2VB 4O45A 2EBSA 1GOHA 2GNQA 3AL9A 1N6DA 3KRWB 4H5JA 4AX4A 2XL2A 5HE0B 2OK4A 3O4JA 3NVNA 3VI4A 3AL8A 3SBRA 5EAPA 3EI2B 5HQGA 4QT8A 3SJLD 3A0FA 2H13A 3I89A 2H6KA 2BBKH 2H6QA 3IURA 3CIKB 4K3ID 1L0QA 2J55H 2OVRB 4GQ2P 4IRZA 4QQEA 5EMJB 3SFZA 1ERJA 4J78A 1TYQC 4GQBB 1O6FA 3SHFA 3IJ0A 4AOWA 5HE3B 4EWRA 3KRXB 4JSPC 2YNPA 4OZUA 2P9NC 4A7JA 5EM2B 1M1XA 4ZOZA 4YVDA 5M5UA 1VZ3A 2QC5A 1R5MA 4H5IA 4A09B 3IIWA 2HKRA 4FWWA 3JB9L 3EQ7A 1JTDB 1E8MA 1Q47A 3V4PA 3RN0D 1C9IA 3UVKA 2GC7A 4FAVD 2J56H 3MZKA 5CYKB 3JPXA 4X60B 2VZ1A 4UI9R 1QFMA 1K8KC 2QXVA 4CZYA 3PVWB 4LGNA 4X3EA 4TZ4A 3MUNA 5AFU3 3J81g 2BKLA 5C9ZB 4RE5A 3DXKC 4E5ZA 4G56B 5E6UA 5FXYA 3SVWD 3AH8B 1MG3A 5H17A 3DSMA 3JZHA 4NSXA 2AGZA 4FA5D 5C2WB 5EALA 4CI3A 2P9IC 4BCCA 2VDRA 2AH0A 4MMYA 3L4MD 4A08B 1JOFA 3MMYA 3IUNA 3PSCB 2YMUA 5EARA 4PXWA 1H2ZA 3VGZA 4J8GA 2AGLA 4J84A 4A11A 3JAMg 2QR5A 3I8EA 4J0XA 4ERYA 1VYHC 3EQ8A 4O3TB 2QZPA 2J57G 3V7DB 3FCUA 1MDAH 4CY5A 2Z2NA 3C5MA 4L1MA 4XYHA 3I7LA 3NVXA 1GOGA 1QNIA 4NAAA 4A0AA 1U8CA 4UM8A 2UZYB 4DNUA 1TBGA 2W18A 4NBMA 2XE4A 4X63B 4PBYA 3IUJA 4ESGA 3OKWA 4J87A 2IUPA 4NC4A 4UM9A 5CXCB 3CFVA 1XKSA 3ODTA 3BG0A 2IUVA 3NIDA 4BCDA 2PBIB 3DM0A 2EIDA 3EU7A 3L4OD 4U1EI 1VE6A 3MVDK 2OVQB 1N6FA 3T3PA 4JSXC 3RN1D 4J73A 2PM9A 4A11B 3C99A 4XYIA 3EI1A 3NIGA 3MKQA 1O6GA 1YFQA 2HU7A 2AH1A 5AMSA 5TF2A 3I7HA 4AN1A 2IURA 3I7PA 5B4WA 4A2LA 3V5WB 3O4IA 2H3XA 2PM7B 3SLED 1N6EA 4ZOXA 4Z7OA 4GM9A 4PSWB 2WQ8A 3VA6A 2OK6A 3JZNA 5HE1B 3PXTD 1VE7A 3IKOA 3PSLA 4A2MA 4D0KA 4A0BA 3B7FA 1PEVA 2G9AA 3EI3A 3JROA 3NVQA 3PVUB 1GXRA 4J86A 3E0CA 4CI8A 2HJ4A 3CFSB
chains in the Genus database with same CATH topology
4NENA 4Z7QA 3FCUA 3ZDXA 3VI3A 2VDPA 3T3MA 1L5GA 4IRZA 4O02A 3FCSA 5HDBA 2VC2A 2VDRA 2VDKA 3ZDZA 4WK0A 3V4VA 3NIFA 4MMYA 4Z7OA 3IJEA 3ZE0A 1U8CA 4G1EA 3T3PA 4UM8A 4WK2A 2VDOA 1JV2A 1M1XA 4Z7NA 1TYEA 2VDQA 4MMZA 5FFOA 5E6RA 3K6SA 4MMXA 3ZE2A 4WK4A 3VI4A 3K72A 2VDLA 3NIGA 4G1MA 3ZE1A 5E6UA 4UM9A 2VDNA 4WJKA 3K71A 3V4PA 2VDMA 5E6SA 5FFGA 3NIDA 3ZDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEN A;  4Z7Q A;  3FCU A;  3ZDX A;  3VI3 A;  2VDP A;  3T3M A;  1L5G A;  4IRZ A;  4O02 A;  3FCS A;  5HDB A;  2VC2 A;  2VDR A;  2VDK A;  3ZDZ A;  4WK0 A;  3V4V A;  3NIF A;  4MMY A;  4Z7O A;  3IJE A;  3ZE0 A;  1U8C A;  4G1E A;  3T3P A;  4UM8 A;  4WK2 A;  2VDO A;  1JV2 A;  1M1X A;  4Z7N A;  1TYE A;  2VDQ A;  4MMZ A;  5FFO A;  5E6R A;  3K6S A;  4MMX A;  3ZE2 A;  4WK4 A;  3VI4 A;  3K72 A;  2VDL A;  3NIG A;  4G1M A;  3ZE1 A;  5E6U A;  4UM9 A;  2VDN A;  4WJK A;  3K71 A;  3V4P A;  2VDM A;  5E6S A;  5FFG A;  3NID A;  3ZDY A; 
#chains in the Genus database with same CATH topology
 4PBZ A;  1GOT B;  4ES0 A;  4U7A A;  1L5G A;  4GM3 A;  4D6V A;  2VZ3 A;  4J81 A;  3OF7 A;  1K32 A;  5FLX g;  4JHP C;  3K27 A;  2Z2O A;  3NIF A;  5GMK n;  3ZE0 A;  1SQJ A;  2VDO A;  4ZOY A;  2IAA A;  2P9U C;  5I5I A;  5C86 A;  4R7A B;  2B4E A;  1U4C A;  2Q7Q A;  3AL8 B;  3ORV D;  4PSX B;  2H9M A;  1UOQ A;  3IJC A;  4XEI C;  3UR4 A;  3EI4 A;  3MUO A;  3I8C A;  1JMZ B;  5I5J A;  2PM6 B;  3MZL A;  4Y5R D;  4ZOV A;  1UTC A;  3UKR C;  2AGX A;  2H9P A;  1XIP A;  5CXB A;  4KFM B;  1SQ9 A;  2B5N A;  3SN6 B;  4WK0 A;  3RFG A;  2OVP B;  3FGB A;  4AN0 A;  4MMZ A;  5TEF A;  4RE6 A;  2JKX A;  2I3T A;  3I7N A;  2IWK A;  3EQ9 A;  1OLZ A;  1S4U X;  4J0W A;  4LG9 A;  4Y7R A;  3IVM A;  2I0R A;  5AJA A;  5GSA A;  1OMW B;  4MK0 B;  5M5T A;  4K3J B;  3OW8 A;  3UVL A;  4GGA A;  5M5S A;  4FHL A;  4Z8L A;  4PC0 A;  4ERZ A;  5FFG A;  3AFC A;  1PBY B;  5FKQ A;  4GGC A;  1BPO A;  4G55 A;  2H14 A;  3DDU A;  4J8B A;  4CI2 A;  4FAN D;  3GD1 I;  3OL2 A;  3QHY B;  3O4H A;  4HDJ A;  2VC2 A;  2HJB A;  1UOO A;  4BH6 A;  1P22 A;  4O3U B;  1JMX B;  1TYE A;  3PXS D;  3U4Y A;  1PGU A;  3N0E A;  4E5Z B;  3ZE2 A;  3EI4 B;  4LG8 A;  2H6N A;  3GC3 B;  4GQ1 A;  5IT9 g;  3UVN A;  3OKT A;  4CZV A;  4CC9 A;  5EAM A;  2G99 A;  5IC7 A;  4ERQ A;  2IWF A;  2YNN A;  2B5M A;  4D9S A;  3SBP A;  4JT5 C;  4JSV C;  5CXB B;  4CY3 A;  1A0R B;  4BL0 A;  3V4V A;  3HFQ A;  5THA A;  1C9L A;  2P9P C;  1NEX B;  3GRE A;  2HES X;  3IIY A;  2YNO A;  1H2X A;  1RI6 A;  2OJY A;  1E5T A;  3OTT A;  4GGD A;  4X61 B;  5FKR A;  2CN3 A;  3DWL C;  1A12 A;  2CE8 A;  4BP9 A;  4A09 A;  1B9X A;  4CZX A;  3SCY A;  2XDW A;  2H9L A;  3N0D A;  4QAM A;  5EMM B;  5E6S A;  3IUM A;  1H2W A;  5H1M A;  3RSE C;  4GMB A;  5GXH A;  2XU7 A;  3C9C A;  5FQD A;  5CYK A;  4O9D A;  5HDB A;  4J79 A;  5M5V A;  3ZDZ A;  2VDK A;  4A0A B;  1JJU B;  3UVM A;  3F3P A;  1GOF A;  4WK2 A;  4L1Q D;  2YBA A;  3K6S A;  3BG1 A;  3IJ1 A;  4I79 A;  3ZE1 A;  3DXM C;  2XL3 A;  3IUQ A;  4GZ8 A;  5IGQ A;  2O9K A;  2VDN A;  4WJK A;  5K19 A;  3OKY A;  4AMY A;  2HYE A;  4FB1 D;  5C92 A;  2GC4 A;  3P4F A;  1GG2 B;  3QI0 A;  4NEN A;  3UKU C;  2UZX B;  3JZG A;  2P9L C;  4L3G D;  5M5R A;  4O2W A;  4O02 A;  3FCS A;  3MXX A;  4O1Q D;  2Z2P A;  3ZWL B;  3W15 A;  4DNV A;  1E8N A;  2CO0 C;  2HU8 A;  2XYI A;  5EML B;  4L3H D;  3IJE A;  4AEZ A;  4G1E A;  4JD2 C;  5IJ7 E;  4A08 A;  1JV2 A;  2HKM A;  5FFO A;  4IMM A;  3K26 A;  2PM9 B;  3F3F A;  5A2Q g;  1QFS A;  2H47 A;  3RRM C;  5EMK B;  2EIB A;  3EI1 B;  2AGW A;  4MMX A;  2MTA H;  3VH0 A;  2OIZ A;  4J77 A;  3RMZ D;  4FA9 D;  1XHM A;  1FWX A;  1H2Y A;  3V9F A;  2TRC B;  2H9N A;  3ZDX A;  4JXM A;  4AMZ A;  4N14 A;  4FA4 D;  1SHY B;  2CNX A;  3I7O A;  5H14 A;  3FM0 A;  3KCI A;  3ULE C;  4Z7N A;  2I0S A;  2HU5 A;  4JT6 C;  2VDQ A;  2CO0 A;  1T2X A;  4J82 A;  4JHN A;  4A0B B;  1VZ2 A;  3EI3 B;  2IUQ A;  4E54 A;  1GP2 B;  3K72 A;  4G1M A;  3OKY B;  3J80 g;  2B5L A;  4BCB A;  5GXI A;  2VDM A;  3SXT D;  2P9S C;  5CXC A;  3ZDY A;  1B9Y A;  4Z7Q A;  2VDP A;  3I2N A;  2P9K C;  4FA1 D;  5FKT A;  4CI1 A;  3EMH A;  4ZN4 A;  3PE7 A;  3MKS B;  1YR2 A;  5TDH B;  1I2M B;  2YB8 B;  5I5M A;  2XZG A;  5E6R A;  3BWS A;  5K1C C;  2HXC A;  5FA5 B;  2I0T A;  4L9O A;  3JRP A;  4QL1 A;  2VDL A;  3EG6 A;  3C75 H;  3RLM D;  4CY2 A;  2CE9 A;  3K71 A;  3EI2 A;  3RFH A;  5TEE A;  3EWE A;  3SWS D;  2AGY A;  4GM8 A;  5SXM A;  3GFC A;  3IUL A;  3T3M A;  2EIC A;  4CY1 A;  4IA9 A;  4BP8 A;  1MG2 A;  2AQ5 A;  2EIE A;  5HYN B;  3FRX A;  4BUJ C;  3SMR A;  4E54 B;  5EM2 A;  5FKS A;  1U2V C;  5JWZ A;  4WK4 A;  5HE2 B;  4OWR A;  5M61 A;  3I7K A;  3PXW D;  1UOP A;  2CN2 A;  5IGO A;  5IJ8 E;  5KDO B;  3F3G A;  4DNW A;  3VI3 A;  3OL2 B;  4QRJ A;  1K3I A;  1PI6 A;  4JSN C;  3UVO A;  2I3S A;  3O4G A;  4PNK B;  2H68 A;  3SBQ A;  1NR0 A;  2BCJ B;  5C2V B;  4O45 A;  2EBS A;  1GOH A;  2GNQ A;  3AL9 A;  1N6D A;  3KRW B;  4H5J A;  4AX4 A;  2XL2 A;  5HE0 B;  2OK4 A;  3O4J A;  3NVN A;  3VI4 A;  3AL8 A;  3SBR A;  5EAP A;  3EI2 B;  5HQG A;  4QT8 A;  3SJL D;  3A0F A;  2H13 A;  3I89 A;  2H6K A;  2BBK H;  2H6Q A;  3IUR A;  3CIK B;  4K3I D;  1L0Q A;  2J55 H;  2OVR B;  4GQ2 P;  4IRZ A;  4QQE A;  5EMJ B;  3SFZ A;  1ERJ A;  4J78 A;  1TYQ C;  4GQB B;  1O6F A;  3SHF A;  3IJ0 A;  4AOW A;  5HE3 B;  4EWR A;  3KRX B;  4JSP C;  2YNP A;  4OZU A;  2P9N C;  4A7J A;  5EM2 B;  1M1X A;  4ZOZ A;  4YVD A;  5M5U A;  1VZ3 A;  2QC5 A;  1R5M A;  4H5I A;  4A09 B;  3IIW A;  2HKR A;  4FWW A;  3JB9 L;  3EQ7 A;  1JTD B;  1E8M A;  1Q47 A;  3V4P A;  3RN0 D;  1C9I A;  3UVK A;  2GC7 A;  4FAV D;  2J56 H;  3MZK A;  5CYK B;  3JPX A;  4X60 B;  2VZ1 A;  4UI9 R;  1QFM A;  1K8K C;  2QXV A;  4CZY A;  3PVW B;  4LGN A;  4X3E A;  4TZ4 A;  3MUN A;  5AFU 3;  3J81 g;  2BKL A;  5C9Z B;  4RE5 A;  3DXK C;  4E5Z A;  4G56 B;  5E6U A;  5FXY A;  3SVW D;  3AH8 B;  1MG3 A;  5H17 A;  3DSM A;  3JZH A;  4NSX A;  2AGZ A;  4FA5 D;  5C2W B;  5EAL A;  4CI3 A;  2P9I C;  4BCC A;  2VDR A;  2AH0 A;  4MMY A;  3L4M D;  4A08 B;  1JOF A;  3MMY A;  3IUN A;  3PSC B;  2YMU A;  5EAR A;  4PXW A;  1H2Z A;  3VGZ A;  4J8G A;  2AGL A;  4J84 A;  4A11 A;  3JAM g;  2QR5 A;  3I8E A;  4J0X A;  4ERY A;  1VYH C;  3EQ8 A;  4O3T B;  2QZP A;  2J57 G;  3V7D B;  3FCU A;  1MDA H;  4CY5 A;  2Z2N A;  3C5M A;  4L1M A;  4XYH A;  3I7L A;  3NVX A;  1GOG A;  1QNI A;  4NAA A;  4A0A A;  1U8C A;  4UM8 A;  2UZY B;  4DNU A;  1TBG A;  2W18 A;  4NBM A;  2XE4 A;  4X63 B;  4PBY A;  3IUJ A;  4ESG A;  3OKW A;  4J87 A;  2IUP A;  4NC4 A;  4UM9 A;  5CXC B;  3CFV A;  1XKS A;  3ODT A;  3BG0 A;  2IUV A;  3NID A;  4BCD A;  2PBI B;  3DM0 A;  2EID A;  3EU7 A;  3L4O D;  4U1E I;  1VE6 A;  3MVD K;  2OVQ B;  1N6F A;  3T3P A;  4JSX C;  3RN1 D;  4J73 A;  2PM9 A;  4A11 B;  3C99 A;  4XYI A;  3EI1 A;  3NIG A;  3MKQ A;  1O6G A;  1YFQ A;  2HU7 A;  2AH1 A;  5AMS A;  5TF2 A;  3I7H A;  4AN1 A;  2IUR A;  3I7P A;  5B4W A;  4A2L A;  3V5W B;  3O4I A;  2H3X A;  2PM7 B;  3SLE D;  1N6E A;  4ZOX A;  4Z7O A;  4GM9 A;  4PSW B;  2WQ8 A;  3VA6 A;  2OK6 A;  3JZN A;  5HE1 B;  3PXT D;  1VE7 A;  3IKO A;  3PSL A;  4A2M A;  4D0K A;  4A0B A;  3B7F A;  1PEV A;  2G9A A;  3EI3 A;  3JRO A;  3NVQ A;  3PVU B;  1GXR A;  4J86 A;  3E0C A;  4CI8 A;  2HJ4 A;  3CFS B; 
#chains in the Genus database with same CATH homology
 4NEN A;  4Z7Q A;  3FCU A;  3ZDX A;  3VI3 A;  2VDP A;  3T3M A;  1L5G A;  4IRZ A;  4O02 A;  3FCS A;  5HDB A;  2VC2 A;  2VDR A;  2VDK A;  3ZDZ A;  4WK0 A;  3V4V A;  3NIF A;  4MMY A;  4Z7O A;  3IJE A;  3ZE0 A;  1U8C A;  4G1E A;  3T3P A;  4UM8 A;  4WK2 A;  2VDO A;  1JV2 A;  1M1X A;  4Z7N A;  1TYE A;  2VDQ A;  4MMZ A;  5FFO A;  5E6R A;  3K6S A;  4MMX A;  3ZE2 A;  4WK4 A;  3VI4 A;  3K72 A;  2VDL A;  3NIG A;  4G1M A;  3ZE1 A;  5E6U A;  4UM9 A;  2VDN A;  4WJK A;  3K71 A;  3V4P A;  2VDM A;  5E6S A;  5FFG A;  3NID A;  3ZDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...