3T3PA

A novel high affinity integrin alphaiibbeta3 receptor antagonist that unexpectedly displaces mg2+ from the beta3 midas
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
454
structure length
454
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
molecule tags Cell adhesion
source organism Homo sapiens
publication title Structure-Guided Design of a High-Affinity Platelet Integrin alphaIIbbeta3 Receptor Antagonist That Disrupts Mg2+ Binding to the MIDAS
pubmed doi rcsb
total genus 110
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3t3pA00
2VC2A 4MMYA 4O02A 2VDOA 3V4VA 3ZE1A 4Z7OA 3K6SA 3ZDYA 3K72A 3IJEA 4IRZA 3ZE0A 3FCSA 5FFOA 1L5GA 4UM9A 3NIFA 5E6UA 3NIDA 2VDLA 3ZDXA 1U8CA 3VI3A 3ZE2A 2VDNA 4Z7QA 2VDKA 2VDMA 3K71A 2VDPA 4MMZA 1TYEA 3ZDZA 5HDBA 4G1EA 4WK0A 4G1MA 3T3PA 3T3MA 3V4PA 5E6RA 5E6SA 1M1XA 3NIGA 2VDRA 4MMXA 4NENA 4UM8A 4WK2A 5FFGA 4WJKA 4WK4A 3VI4A 2VDQA 1JV2A 3FCUA 4Z7NA
chains in the Genus database with same CATH superfamily
2QR5A 2VDOA 3JZGA 4A08A 2CE8A 4A0BA 1XHMA 3ZDYA 2XL2A 2H9LA 3IURA 4UM9A 2IUQA 4A11A 5HYNB 2H13A 5K19A 3SFZA 5IGOA 2OK4A 2VDNA 3J81g 4JSVC 1GXRA 2VDMA 1JMZB 1OLZA 4CZVA 3JAMg 2QC5A 4GZ8A 2YMUA 3ORVD 5M5TA 4FAVD 4D0KA 3IVMA 3NIGA 4MMXA 4UI9R 3P4FA 2H14A 3DXMC 4FAND 2IUPA 1GP2B 4HDJA 3JPXA 3IJCA 4O02A 1H2WA 3ZE1A 4X60B 2XU7A 4Z7OA 3O4IA 4J0WA 4AN1A 4H5JA 3I7LA 5EMJB 2OVQB 3EI1A 2BBKH 5TF2A 2YBAA 3MKSB 4PBZA 3EWEA 2QZPA 2H6QA 4ERZA 4I79A 5M5SA 5AJAA 2CNXA 2Z2PA 3HFQA 5AMSA 2J56H 3OW8A 3GC3B 3ULEC 1JOFA 4G1MA 2HJ4A 4RE6A 3EI2B 3EQ9A 3EI4B 2VDQA 1ERJA 4J87A 4GGDA 2HESX 3SXTD 4MMYA 3DXKC 3GFCA 4JT6C 2P9LC 3O4JA 5GXIA 3OKTA 3MUOA 1PGUA 4JXMA 4E5ZB 3RRMC 4L1MA 3OL2B 3KCIA 1U8CA 2XL3A 2GC4A 1MDAH 1TYEA 4H5IA 4TZ4A 3K26A 1NEXB 1TYQC 2HU8A 3KRXB 4FA1D 5M5UA 5H1MA 4NENA 4UM8A 3V9FA 3V5WB 3VI4A 1U4CA 3B7FA 4A2MA 2CN2A 5CXBB 3SMRA 3SBQA 4BP8A 2HKRA 4JSPC 4FA5D 4ZN4A 1U2VC 3NVNA 3IJEA 3SLED 3MKQA 3ODTA 5EMKB 5AFU3 5GXHA 4J84A 4E54B 5GSAA 2YNNA 1B9XA 4X3EA 2PBIB 3OKYB 1T2XA 1VE7A 3J80g 2VZ3A 3T3PA 5HQGA 4BP9A 3EQ8A 3EI3A 4A2LA 3PVWB 3UR4A 4ZOVA 4WK4A 4AX4A 2H3XA 4CZXA 1N6DA 3I89A 3IIWA 2OVPB 2HU7A 3EG6A 4JSXC 3K72A 3ZWLB 3I2NA 4CZYA 4DNVA 2P9NC 5FFOA 3FGBA 1XIPA 4PSWB 4CY1A 2G9AA 5IJ8E 3O4HA 4AEZA 1N6EA 3C75H 4CI8A 2IUVA 1UOOA 5CXCB 3N0EA 2CN3A 4EWRA 3V7DB 3UVLA 1QFSA 4BUJC 1C9IA 3L4MD 4J78A 4NBMA 3AL8B 2MTAH 4R7AB 1K8KC 2HYEA 1E8MA 5CYKA 5IJ7E 3EMHA 3EI2A 2P9UC 3CFSB 5HE1B 1FWXA 5CYKB 1B9YA 5E6UA 2H68A 3UVOA 5KDOB 4FA4D 2I0TA 4JHPC 4J86A 3ZE2A 4U7AA 2Z2OA 2IWFA 3DM0A 4L3GD 4CI2A 4QAMA 4FHLA 1JTDB 4FWWA 5HE2B 4GM3A 2CE9A 1QFMA 2EBSA 3AFCA 2H9PA 2UZXB 3UVKA 3FCUA 3IUNA 3EI1B 5FLXg 1OMWB 2VC2A 2G99A 3V4VA 4QL1A 3OKWA 4BCCA 3SVWD 4GGAA 2AGZA 3EQ7A 3W15A 3IJ0A 1BPOA 3O4GA 2VDKA 3IJ1A 4BCBA 2CO0A 3PXSD 4GQ1A 3BWSA 4PC0A 5M5VA 1SHYB 5SXMA 4AOWA 3E0CA 1Q47A 4ESGA 3RSEC 3OKYA 4CY3A 2P9IC 3OL2A 2WQ8A 4Z7NA 5H17A 4IA9A 4A0AB 1E5TA 4YVDA 4IRZA 2XZGA 3SJLD 3CFVA 4XYHA 1QNIA 2VDLA 2Q7QA 3UKRC 1XKSA 3VI3A 4A0AA 4G56B 5EMMB 3FRXA 2VDPA 3I7PA 5HDBA 4AN0A 3C5MA 2HU5A 1M1XA 1PI6A 3SHFA 1GOTB 5I5IA 4A0BB 4WJKA 5TEEA 3NVQA 5FKRA 5IT9g 4MK0B 4O1QD 3PSCB 4Z8LA 3JZHA 4NSXA 1YR2A 4X63B 2P9KC 1GOFA 3AH8B 4GM9A 4RE5A 3ZE0A 4L3HD 1N6FA 2H6NA 4GMBA 2Z2NA 3PVUB 1E8NA 5FKQA 4MMZA 3RN1D 2H6KA 3UKUC 5TDHB 4O2WA 4CC9A 5HE0B 3BG1A 2HXCA 2XE4A 3JB9L 5C2VB 1VYHC 4QRJA 5K1CC 1H2XA 2H9MA 3UVNA 4ZOYA 5C2WB 5C86A 3I7NA 4PNKB 5B4WA 1I2MB 3VGZA 4J79A 3SN6B 2UZYB 3ZDXA 1MG2A 2AGXA 4OWRA 4J81A 4PBYA 2PM6B 2I3TA 3EI4A 4G1EA 4ZOZA 3U4YA 3VA6A 3T3MA 4K3ID 3RLMD 4BH6A 3KRWB 1SQJA 1VE6A 3N0DA 4U1EI 1UOPA 2AGYA 2B4EA 2XYIA 4G55A 3MXXA 2OVRB 4CI3A 5EALA 4LGNA 4GQ2P 5C92A 5FXYA 1JJUB 4N14A 2H47A 1C9LA 3K71A 2PM9A 4CI1A 4IMMA 3F3PA 5A2Qg 3IUQA 2I3SA 3RFGA 4BCDA 3IULA 4ERQA 2VDRA 3MVDK 1A0RB 3GREA 2JKXA 2OJYA 3L4OD 3SCYA 4PXWA 5FKSA 4AMZA 1O6GA 4J82A 5FQDA 5GMKn 3K27A 3I7KA 2P9PC 5CXBA 4LG8A 3NIFA 2IAAA 1MG3A 4A7JA 4NC4A 5EM2A 3RMZD 2AH0A 4O3TB 3BG0A 2QXVA 1YFQA 5FA5B 5I5JA 3CIKB 4J0XA 3PE7A 2OIZA 5I5MA 2HJBA 3IKOA 5EM2B 3QHYB 3NVXA 2BCJB 3A0FA 5E6SA 3I8EA 1UTCA 3DWLC 4LG9A 4XEIC 3MUNA 3F3FA 5HE3B 2YNOA 5FKTA 3I7HA 4ERYA 3EI3B 2OK6A 4ES0A 1VZ2A 2P9SC 1O6FA 3I8CA 2AGLA 2EIDA 3JROA 4QT8A 1P22A 3IIYA 5EMLB 3AL8A 1NR0A 3SWSD 2I0RA 3PXWD 4WK0A 5EAPA 4A08B 1RI6A 3MZLA 5EAMA 5THAA 2IURA 2B5NA 5IC7A 3IUJA 2HKMA 3I7OA 1H2YA 2XDWA 4A11B 1JV2A 2CO0C 3DSMA 1GOGA 2AQ5A 4PSXB 3K6SA 1SQ9A 2B5LA 3JZNA 3JRPA 5H14A 4A09A 1L5GA 3RN0D 3F3GA 1TBGA 3VH0A 4X61B 2GNQA 2J57G 4A09B 1H2ZA 4E5ZA 2VZ1A 4BL0A 3PXTD 5M5RA 5E6RA 4J77A 1PBYB 2H9NA 3PSLA 2YB8B 1GOHA 4DNWA 3C99A 4O3UB 3RFHA 3UVMA 2B5MA 4K3JB 2TRCB 3C9CA 4JHNA 1L0QA 3IUMA 1A12A 3FCSA 3NIDA 4GGCA 4GM8A 4FB1D 4Z7QA 5M61A 4O45A 3OTTA 4AMYA 2AGWA 1K3IA 4J8BA 4D9SA 5IGQA 3ZDZA 1JMXB 2EIEA 5C9ZB 4E54A 3SBPA 4OZUA 5EARA 2I0SA 3AL9A 2EIBA 4L1QD 4L9OA 3SBRA 3MZKA 4JD2C 3EU7A 4J73A 2IWKA 4Y7RA 5JWZA 3GD1I 1R5MA 2J55H 2PM9B 2BKLA 4D6VA 4DNUA 1S4UX 3OF7A 4J8GA 2AH1A 4JT5C 4FA9D 2O9KA 4KFMB 4NAAA 4GQBB 3FM0A 2PM7B 5TEFA 4CY2A 4Y5RD 4ZOXA 1UOQA 2EICA 4O9DA 4CY5A 1K32A 2YNPA 3MMYA 4XYIA 3V4PA 2W18A 3DDUA 5FFGA 4WK2A 1VZ3A 5CXCA 3QI0A 2GC7A 4QQEA 1GG2B 4JSNC 1PEVA
chains in the Genus database with same CATH topology
2VC2A 4MMYA 4O02A 2VDOA 3V4VA 3ZE1A 4Z7OA 3K6SA 3ZDYA 3K72A 3IJEA 4IRZA 3ZE0A 3FCSA 5FFOA 1L5GA 4UM9A 3NIFA 5E6UA 3NIDA 2VDLA 3ZDXA 1U8CA 3VI3A 3ZE2A 2VDNA 4Z7QA 2VDKA 2VDMA 3K71A 2VDPA 4MMZA 1TYEA 3ZDZA 5HDBA 4G1EA 4WK0A 4G1MA 3T3PA 3T3MA 3V4PA 5E6RA 5E6SA 1M1XA 3NIGA 2VDRA 4MMXA 4NENA 4UM8A 4WK2A 5FFGA 4WJKA 4WK4A 3VI4A 2VDQA 1JV2A 3FCUA 4Z7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VC2 A;  4MMY A;  4O02 A;  2VDO A;  3V4V A;  3ZE1 A;  4Z7O A;  3K6S A;  3ZDY A;  3K72 A;  3IJE A;  4IRZ A;  3ZE0 A;  3FCS A;  5FFO A;  1L5G A;  4UM9 A;  3NIF A;  5E6U A;  3NID A;  2VDL A;  3ZDX A;  1U8C A;  3VI3 A;  3ZE2 A;  2VDN A;  4Z7Q A;  2VDK A;  2VDM A;  3K71 A;  2VDP A;  4MMZ A;  1TYE A;  3ZDZ A;  5HDB A;  4G1E A;  4WK0 A;  4G1M A;  3T3P A;  3T3M A;  3V4P A;  5E6R A;  5E6S A;  1M1X A;  3NIG A;  2VDR A;  4MMX A;  4NEN A;  4UM8 A;  4WK2 A;  5FFG A;  4WJK A;  4WK4 A;  3VI4 A;  2VDQ A;  1JV2 A;  3FCU A;  4Z7N A; 
#chains in the Genus database with same CATH topology
 2QR5 A;  2VDO A;  3JZG A;  4A08 A;  2CE8 A;  4A0B A;  1XHM A;  3ZDY A;  2XL2 A;  2H9L A;  3IUR A;  4UM9 A;  2IUQ A;  4A11 A;  5HYN B;  2H13 A;  5K19 A;  3SFZ A;  5IGO A;  2OK4 A;  2VDN A;  3J81 g;  4JSV C;  1GXR A;  2VDM A;  1JMZ B;  1OLZ A;  4CZV A;  3JAM g;  2QC5 A;  4GZ8 A;  2YMU A;  3ORV D;  5M5T A;  4FAV D;  4D0K A;  3IVM A;  3NIG A;  4MMX A;  4UI9 R;  3P4F A;  2H14 A;  3DXM C;  4FAN D;  2IUP A;  1GP2 B;  4HDJ A;  3JPX A;  3IJC A;  4O02 A;  1H2W A;  3ZE1 A;  4X60 B;  2XU7 A;  4Z7O A;  3O4I A;  4J0W A;  4AN1 A;  4H5J A;  3I7L A;  5EMJ B;  2OVQ B;  3EI1 A;  2BBK H;  5TF2 A;  2YBA A;  3MKS B;  4PBZ A;  3EWE A;  2QZP A;  2H6Q A;  4ERZ A;  4I79 A;  5M5S A;  5AJA A;  2CNX A;  2Z2P A;  3HFQ A;  5AMS A;  2J56 H;  3OW8 A;  3GC3 B;  3ULE C;  1JOF A;  4G1M A;  2HJ4 A;  4RE6 A;  3EI2 B;  3EQ9 A;  3EI4 B;  2VDQ A;  1ERJ A;  4J87 A;  4GGD A;  2HES X;  3SXT D;  4MMY A;  3DXK C;  3GFC A;  4JT6 C;  2P9L C;  3O4J A;  5GXI A;  3OKT A;  3MUO A;  1PGU A;  4JXM A;  4E5Z B;  3RRM C;  4L1M A;  3OL2 B;  3KCI A;  1U8C A;  2XL3 A;  2GC4 A;  1MDA H;  1TYE A;  4H5I A;  4TZ4 A;  3K26 A;  1NEX B;  1TYQ C;  2HU8 A;  3KRX B;  4FA1 D;  5M5U A;  5H1M A;  4NEN A;  4UM8 A;  3V9F A;  3V5W B;  3VI4 A;  1U4C A;  3B7F A;  4A2M A;  2CN2 A;  5CXB B;  3SMR A;  3SBQ A;  4BP8 A;  2HKR A;  4JSP C;  4FA5 D;  4ZN4 A;  1U2V C;  3NVN A;  3IJE A;  3SLE D;  3MKQ A;  3ODT A;  5EMK B;  5AFU 3;  5GXH A;  4J84 A;  4E54 B;  5GSA A;  2YNN A;  1B9X A;  4X3E A;  2PBI B;  3OKY B;  1T2X A;  1VE7 A;  3J80 g;  2VZ3 A;  3T3P A;  5HQG A;  4BP9 A;  3EQ8 A;  3EI3 A;  4A2L A;  3PVW B;  3UR4 A;  4ZOV A;  4WK4 A;  4AX4 A;  2H3X A;  4CZX A;  1N6D A;  3I89 A;  3IIW A;  2OVP B;  2HU7 A;  3EG6 A;  4JSX C;  3K72 A;  3ZWL B;  3I2N A;  4CZY A;  4DNV A;  2P9N C;  5FFO A;  3FGB A;  1XIP A;  4PSW B;  4CY1 A;  2G9A A;  5IJ8 E;  3O4H A;  4AEZ A;  1N6E A;  3C75 H;  4CI8 A;  2IUV A;  1UOO A;  5CXC B;  3N0E A;  2CN3 A;  4EWR A;  3V7D B;  3UVL A;  1QFS A;  4BUJ C;  1C9I A;  3L4M D;  4J78 A;  4NBM A;  3AL8 B;  2MTA H;  4R7A B;  1K8K C;  2HYE A;  1E8M A;  5CYK A;  5IJ7 E;  3EMH A;  3EI2 A;  2P9U C;  3CFS B;  5HE1 B;  1FWX A;  5CYK B;  1B9Y A;  5E6U A;  2H68 A;  3UVO A;  5KDO B;  4FA4 D;  2I0T A;  4JHP C;  4J86 A;  3ZE2 A;  4U7A A;  2Z2O A;  2IWF A;  3DM0 A;  4L3G D;  4CI2 A;  4QAM A;  4FHL A;  1JTD B;  4FWW A;  5HE2 B;  4GM3 A;  2CE9 A;  1QFM A;  2EBS A;  3AFC A;  2H9P A;  2UZX B;  3UVK A;  3FCU A;  3IUN A;  3EI1 B;  5FLX g;  1OMW B;  2VC2 A;  2G99 A;  3V4V A;  4QL1 A;  3OKW A;  4BCC A;  3SVW D;  4GGA A;  2AGZ A;  3EQ7 A;  3W15 A;  3IJ0 A;  1BPO A;  3O4G A;  2VDK A;  3IJ1 A;  4BCB A;  2CO0 A;  3PXS D;  4GQ1 A;  3BWS A;  4PC0 A;  5M5V A;  1SHY B;  5SXM A;  4AOW A;  3E0C A;  1Q47 A;  4ESG A;  3RSE C;  3OKY A;  4CY3 A;  2P9I C;  3OL2 A;  2WQ8 A;  4Z7N A;  5H17 A;  4IA9 A;  4A0A B;  1E5T A;  4YVD A;  4IRZ A;  2XZG A;  3SJL D;  3CFV A;  4XYH A;  1QNI A;  2VDL A;  2Q7Q A;  3UKR C;  1XKS A;  3VI3 A;  4A0A A;  4G56 B;  5EMM B;  3FRX A;  2VDP A;  3I7P A;  5HDB A;  4AN0 A;  3C5M A;  2HU5 A;  1M1X A;  1PI6 A;  3SHF A;  1GOT B;  5I5I A;  4A0B B;  4WJK A;  5TEE A;  3NVQ A;  5FKR A;  5IT9 g;  4MK0 B;  4O1Q D;  3PSC B;  4Z8L A;  3JZH A;  4NSX A;  1YR2 A;  4X63 B;  2P9K C;  1GOF A;  3AH8 B;  4GM9 A;  4RE5 A;  3ZE0 A;  4L3H D;  1N6F A;  2H6N A;  4GMB A;  2Z2N A;  3PVU B;  1E8N A;  5FKQ A;  4MMZ A;  3RN1 D;  2H6K A;  3UKU C;  5TDH B;  4O2W A;  4CC9 A;  5HE0 B;  3BG1 A;  2HXC A;  2XE4 A;  3JB9 L;  5C2V B;  1VYH C;  4QRJ A;  5K1C C;  1H2X A;  2H9M A;  3UVN A;  4ZOY A;  5C2W B;  5C86 A;  3I7N A;  4PNK B;  5B4W A;  1I2M B;  3VGZ A;  4J79 A;  3SN6 B;  2UZY B;  3ZDX A;  1MG2 A;  2AGX A;  4OWR A;  4J81 A;  4PBY A;  2PM6 B;  2I3T A;  3EI4 A;  4G1E A;  4ZOZ A;  3U4Y A;  3VA6 A;  3T3M A;  4K3I D;  3RLM D;  4BH6 A;  3KRW B;  1SQJ A;  1VE6 A;  3N0D A;  4U1E I;  1UOP A;  2AGY A;  2B4E A;  2XYI A;  4G55 A;  3MXX A;  2OVR B;  4CI3 A;  5EAL A;  4LGN A;  4GQ2 P;  5C92 A;  5FXY A;  1JJU B;  4N14 A;  2H47 A;  1C9L A;  3K71 A;  2PM9 A;  4CI1 A;  4IMM A;  3F3P A;  5A2Q g;  3IUQ A;  2I3S A;  3RFG A;  4BCD A;  3IUL A;  4ERQ A;  2VDR A;  3MVD K;  1A0R B;  3GRE A;  2JKX A;  2OJY A;  3L4O D;  3SCY A;  4PXW A;  5FKS A;  4AMZ A;  1O6G A;  4J82 A;  5FQD A;  5GMK n;  3K27 A;  3I7K A;  2P9P C;  5CXB A;  4LG8 A;  3NIF A;  2IAA A;  1MG3 A;  4A7J A;  4NC4 A;  5EM2 A;  3RMZ D;  2AH0 A;  4O3T B;  3BG0 A;  2QXV A;  1YFQ A;  5FA5 B;  5I5J A;  3CIK B;  4J0X A;  3PE7 A;  2OIZ A;  5I5M A;  2HJB A;  3IKO A;  5EM2 B;  3QHY B;  3NVX A;  2BCJ B;  3A0F A;  5E6S A;  3I8E A;  1UTC A;  3DWL C;  4LG9 A;  4XEI C;  3MUN A;  3F3F A;  5HE3 B;  2YNO A;  5FKT A;  3I7H A;  4ERY A;  3EI3 B;  2OK6 A;  4ES0 A;  1VZ2 A;  2P9S C;  1O6F A;  3I8C A;  2AGL A;  2EID A;  3JRO A;  4QT8 A;  1P22 A;  3IIY A;  5EML B;  3AL8 A;  1NR0 A;  3SWS D;  2I0R A;  3PXW D;  4WK0 A;  5EAP A;  4A08 B;  1RI6 A;  3MZL A;  5EAM A;  5THA A;  2IUR A;  2B5N A;  5IC7 A;  3IUJ A;  2HKM A;  3I7O A;  1H2Y A;  2XDW A;  4A11 B;  1JV2 A;  2CO0 C;  3DSM A;  1GOG A;  2AQ5 A;  4PSX B;  3K6S A;  1SQ9 A;  2B5L A;  3JZN A;  3JRP A;  5H14 A;  4A09 A;  1L5G A;  3RN0 D;  3F3G A;  1TBG A;  3VH0 A;  4X61 B;  2GNQ A;  2J57 G;  4A09 B;  1H2Z A;  4E5Z A;  2VZ1 A;  4BL0 A;  3PXT D;  5M5R A;  5E6R A;  4J77 A;  1PBY B;  2H9N A;  3PSL A;  2YB8 B;  1GOH A;  4DNW A;  3C99 A;  4O3U B;  3RFH A;  3UVM A;  2B5M A;  4K3J B;  2TRC B;  3C9C A;  4JHN A;  1L0Q A;  3IUM A;  1A12 A;  3FCS A;  3NID A;  4GGC A;  4GM8 A;  4FB1 D;  4Z7Q A;  5M61 A;  4O45 A;  3OTT A;  4AMY A;  2AGW A;  1K3I A;  4J8B A;  4D9S A;  5IGQ A;  3ZDZ A;  1JMX B;  2EIE A;  5C9Z B;  4E54 A;  3SBP A;  4OZU A;  5EAR A;  2I0S A;  3AL9 A;  2EIB A;  4L1Q D;  4L9O A;  3SBR A;  3MZK A;  4JD2 C;  3EU7 A;  4J73 A;  2IWK A;  4Y7R A;  5JWZ A;  3GD1 I;  1R5M A;  2J55 H;  2PM9 B;  2BKL A;  4D6V A;  4DNU A;  1S4U X;  3OF7 A;  4J8G A;  2AH1 A;  4JT5 C;  4FA9 D;  2O9K A;  4KFM B;  4NAA A;  4GQB B;  3FM0 A;  2PM7 B;  5TEF A;  4CY2 A;  4Y5R D;  4ZOX A;  1UOQ A;  2EIC A;  4O9D A;  4CY5 A;  1K32 A;  2YNP A;  3MMY A;  4XYI A;  3V4P A;  2W18 A;  3DDU A;  5FFG A;  4WK2 A;  1VZ3 A;  5CXC A;  3QI0 A;  2GC7 A;  4QQE A;  1GG2 B;  4JSN C;  1PEV A; 
#chains in the Genus database with same CATH homology
 2VC2 A;  4MMY A;  4O02 A;  2VDO A;  3V4V A;  3ZE1 A;  4Z7O A;  3K6S A;  3ZDY A;  3K72 A;  3IJE A;  4IRZ A;  3ZE0 A;  3FCS A;  5FFO A;  1L5G A;  4UM9 A;  3NIF A;  5E6U A;  3NID A;  2VDL A;  3ZDX A;  1U8C A;  3VI3 A;  3ZE2 A;  2VDN A;  4Z7Q A;  2VDK A;  2VDM A;  3K71 A;  2VDP A;  4MMZ A;  1TYE A;  3ZDZ A;  5HDB A;  4G1E A;  4WK0 A;  4G1M A;  3T3P A;  3T3M A;  3V4P A;  5E6R A;  5E6S A;  1M1X A;  3NIG A;  2VDR A;  4MMX A;  4NEN A;  4UM8 A;  4WK2 A;  5FFG A;  4WJK A;  4WK4 A;  3VI4 A;  2VDQ A;  1JV2 A;  3FCU A;  4Z7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...