3T3PA

A novel high affinity integrin alphaiibbeta3 receptor antagonist that unexpectedly displaces mg2+ from the beta3 midas
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Guided Design of a High-Affinity Platelet Integrin alphaIIbbeta3 Receptor Antagonist That Disrupts Mg2+ Binding to the MIDAS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
total genus 110
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3t3pA00
4WJKA 3NIGA 5E6RA 4WK2A 5E6UA 1L5GA 3VI4A 5E6SA 3ZDXA 4Z7NA 3K72A 4NENA 3ZDZA 2VDOA 1JV2A 2VDQA 5FFOA 3FCSA 3ZE0A 2VDPA 3VI3A 4G1EA 2VDLA 3K6SA 4IRZA 4O02A 4UM9A 3T3MA 3ZE2A 4WK0A 1U8CA 3NIDA 5FFGA 4G1MA 4MMXA 2VDMA 4UM8A 4MMZA 3ZE1A 2VDKA 4MMYA 3V4VA 4Z7OA 5HDBA 2VDRA 3NIFA 2VC2A 2VDNA 3K71A 3IJEA 4Z7QA 3V4PA 1M1XA 3FCUA 3ZDYA 3T3PA 4WK4A 1TYEA
chains in the Genus database with same CATH superfamily
4WJKA 4WK2A 3DM0A 3FM0A 1U4CA 4A2MA 2AH1A 2CE8A 4GZ8A 2VDOA 3C5MA 3FRXA 2HJBA 2VDPA 3PVUB 2VDLA 4D0KA 4IRZA 2YBAA 1GOTB 3O4GA 3RSEC 2BKLA 2G99A 4E5ZB 1UOPA 2AGXA 4J78A 2EIDA 3JZGA 2EIEA 1E5TA 1A12A 3ZE1A 4NSXA 2GNQA 4JT6C 2GC7A 3JROA 3C9CA 3NVXA 3DDUA 4KFMB 2H9NA 5CXCB 5EMMB 3EI1A 4A09A 5GXIA 5IT9g 5CYKA 5M5UA 4O3UB 5M61A 4A11A 4PC0A 3PXWD 4PXWA 4NC4A 4QL1A 3DXKC 1GP2B 4GGAA 2HESX 3SLED 4JXMA 4ERQA 3CFSB 3ZDZA 2P9KC 3OKTA 5FKQA 3SXTD 4E54B 4J0XA 4LGNA 3PSCB 4E54A 2VDMA 1GXRA 4FAVD 2AGZA 3V4VA 4BP8A 3CIKB 2OVQB 4L1QD 3EI3A 2H47A 1TBGA 4AMZA 2OIZA 3NIGA 1N6DA 2YNNA 4Z7NA 3K72A 4E5ZA 4GM9A 4LG8A 4PBZA 3ZE0A 3JZNA 2QC5A 2AGWA 4L9OA 5EMJB 1P22A 1T2XA 3IUMA 5TF2A 1JOFA 3V9FA 4NBMA 1GOFA 1K32A 4FA4D 4GM3A 1MG2A 3O4HA 5HE2B 5AJAA 2O9KA 2BBKH 2H9PA 1M1XA 4K3ID 3IKOA 3RFHA 3I7KA 2IUPA 3EI4B 4BUJC 2P9IC 3O4JA 3IVMA 4JHNA 3I2NA 4A0AB 4HDJA 4J86A 4G1MA 1NEXB 1VE7A 3EQ7A 5HE0B 2P9LC 4Z7OA 3IUJA 4ERZA 5EAPA 3UR4A 2CN2A 1UOOA 3V4PA 4UI9R 3OKYB 2I0SA 3EG6A 1UOQA 3AH8B 4L3GD 4J8BA 4DNWA 2YNPA 4Z8LA 1N6EA 5THAA 5H1MA 2B5NA 4AN1A 5M5VA 3OL2A 2IUQA 3N0EA 4JSPC 2PM7B 3DXMC 4UM8A 4CZYA 1ERJA 4JT5C 3SBQA 5TDHB 3IURA 1GOHA 3L4OD 4WK4A 2HXCA 1QFSA 4ZOZA 4GM8A 3VI4A 3RMZD 4NENA 4BH6A 3SMRA 3RFGA 2CN3A 1MG3A 2VZ1A 1VZ3A 4UM9A 3AL8A 3SN6B 3IUNA 5M5TA 3MXXA 2IWFA 3PE7A 4QT8A 5FXYA 2GC4A 2PM9B 3L4MD 3RN0D 4CY1A 4RE6A 3MMYA 3EMHA 4BCBA 5HDBA 3EI3B 3SCYA 2VDRA 2XE4A 5KDOB 2VDNA 5HE3B 5I5JA 4Z7QA 3GFCA 1S4UX 4J87A 3ZDXA 3F3FA 4ZOXA 5FFOA 2QZPA 3F3PA 4G1EA 4PSWB 5HQGA 5IJ8E 2XDWA 4U7AA 3UVKA 3ZE2A 4A09B 1UTCA 5A2Qg 2IWKA 3NIDA 1XIPA 3VA6A 4D9SA 3A0FA 3EWEA 2HKMA 4ERYA 4U1EI 3VGZA 1A0RB 5K19A 1L0QA 1QFMA 3I7PA 3KRWB 3I7OA 5FKSA 3ODTA 3EI2A 1Q47A 1E8NA 3ZDYA 4QRJA 1TYEA 5E6RA 5CXCA 1VZ2A 1O6GA 2H3XA 3SJLD 4LG9A 5IJ7E 5FQDA 3SVWD 4AX4A 2Z2OA 2VDQA 1R5MA 3P4FA 2J57G 4XEIC 2H6QA 4WK0A 4GQ1A 5M5RA 4I79A 4FA1D 3IIWA 3OTTA 5FFGA 5IGOA 3AL9A 4H5JA 4MMXA 2P9SC 3MKSB 4QAMA 3IJCA 4L3HD 3V5WB 3EQ8A 1RI6A 4OZUA 3RN1D 4CI8A 3K71A 3IJEA 4AOWA 4JSXC 3C99A 5C2WB 3BWSA 5CXBB 5M5SA 5E6SA 2OK6A 2IUVA 1C9IA 4BCCA 1B9XA 2H13A 3PXSD 4A0BA 4O02A 2H14A 2H6NA 3UKUC 4A08A 1SQJA 1PEVA 4QQEA 3C75H 3I8CA 2Z2NA 1YFQA 4G56B 1H2XA 2CE9A 2EBSA 3NVNA 4IA9A 1K3IA 5GXHA 4X61B 3K26A 2J55H 3IIYA 3OF7A 3GC3B 3K27A 4XYHA 1I2MB 1L5GA 4A11B 4ES0A 5SXMA 4FA9D 1JTDB 2I0RA 5C2VB 4O1QD 4D6VA 1JMZB 4JSVC 2VZ3A 4GQ2P 5C9ZB 3SHFA 3EU7A 3JRPA 4G55A 4DNVA 4IMMA 5EMKB 4A0AA 4FHLA 4MMYA 1PBYB 4O9DA 2XU7A 4GGCA 3SFZA 4CI2A 4CY5A 3T3PA 4ZOYA 2I3SA 4O2WA 4X60B 3QI0A 4CC9A 5E6UA 3SWSD 4ZOVA 4A08B 2HU5A 2UZYB 2IURA 4PBYA 5JWZA 4FWWA 1JV2A 5GMKn 1U2VC 2HU7A 5FKRA 2YB8B 4L1MA 5TEFA 4J82A 2XL2A 5K1CC 3EI1B 1U8CA 3MVDK 1XKSA 2UZXB 4O45A 4H5IA 1VE6A 3NIFA 3O4IA 3JAMg 2OJYA 3IJ1A 1K8KC 3FGBA 4OWRA 4JD2C 3CFVA 2WQ8A 4FA5D 2AH0A 3SBPA 5CYKB 4FAND 3QHYB 2YMUA 2OVRB 2IAAA 2PBIB 4A7JA 2P9NC 2MTAH 2H9MA 3RLMD 4PSXB 2H6KA 2Q7QA 4MMZA 5EM2A 3IJ0A 3JB9L 2P9UC 4NAAA 3RRMC 3MZLA 5HE1B 4J81A 3J80g 4RE5A 4TZ4A 3MZKA 1SHYB 2B5MA 3UVMA 3I89A 2W18A 3PVWB 5HYNB 1NR0A 3I7LA 4PNKB 2I3TA 4J77A 2HU8A 3F3GA 3KRXB 5B4WA 3UVNA 1N6FA 3NVQA 3IULA 4MK0B 5IGQA 2HYEA 1OMWB 2P9PC 5TEEA 4GMBA 3DSMA 3OW8A 2EIBA 3W15A 5AFU3 4O3TB 3I7NA 4J73A 2YNOA 4GGDA 5EAMA 1H2WA 3U4YA 2JKXA 1O6FA 2XZGA 2XYIA 3OKWA 3EI4A 1H2ZA 4A2LA 1B9YA 5AMSA 3AFCA 3BG1A 3N0DA 4X63B 2AGLA 1GG2B 1SQ9A 3MUNA 1YR2A 3IUQA 4X3EA 3I7HA 2XL3A 1C9LA 1JMXB 2AGYA 3EI2B 2J56H 4JHPC 3AL8B 1TYQC 5H14A 3T3MA 2H9LA 5C86A 4CY2A 1PGUA 4ESGA 1VYHC 4DNUA 4EWRA 3MUOA 5C92A 2B5LA 2PM6B 3I8EA 2EICA 1PI6A 2VC2A 3DWLC 4Y7RA 2TRCB 3E0CA 3FCUA 2G9AA 1GOGA 3GD1I 5IC7A 3UVOA 3KCIA 5FLXg 4J0WA 4FB1D 3B7FA 5FKTA 4YVDA 2AQ5A 3VI3A 1H2YA 3UVLA 2QR5A 4XYIA 3EQ9A 3PXTD 5CXBA 4AEZA 4AMYA 5I5MA 2CO0A 5EMLB 1JJUB 2B4EA 3SBRA 5I5IA 4A0BB 3ULEC 4CZXA 4BP9A 1QNIA 3JPXA 4K3JB 1OLZA 3OL2B 3VH0A 3ORVD 4CY3A 3GREA 2HKRA 4R7AB 4CI3A 4GQBB 4J8GA 3PSLA 1BPOA 4J84A 2I0TA 2PM9A 4N14A 3FCSA 1E8MA 3JZHA 5GSAA 3K6SA 3ZWLB 4CI1A 2BCJB 4J79A 4AN0A 4BCDA 2H68A 1FWXA 3UKRC 2OVPB 4CZVA 2Z2PA 4Y5RD 2CNXA 2VDKA 3V7DB 5FA5B 4BL0A 3MKQA 5EALA 5EARA 1MDAH 5H17A 5EM2B 3BG0A 2HJ4A 4JSNC 3J81g 3OKYA 3HFQA 4ZN4A 2OK4A 2QXVA 2CO0C 1XHMA
chains in the Genus database with same CATH topology
4WJKA 3NIGA 5E6RA 4WK2A 5E6UA 1L5GA 3VI4A 5E6SA 3ZDXA 4Z7NA 3K72A 4NENA 3ZDZA 2VDOA 1JV2A 2VDQA 5FFOA 3FCSA 3ZE0A 2VDPA 3VI3A 4G1EA 2VDLA 3K6SA 4IRZA 4O02A 4UM9A 3T3MA 3ZE2A 4WK0A 1U8CA 3NIDA 5FFGA 4G1MA 4MMXA 2VDMA 4UM8A 4MMZA 3ZE1A 2VDKA 4MMYA 3V4VA 4Z7OA 5HDBA 2VDRA 3NIFA 2VC2A 2VDNA 3K71A 3IJEA 4Z7QA 3V4PA 1M1XA 3FCUA 3ZDYA 3T3PA 4WK4A 1TYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJK A;  3NIG A;  5E6R A;  4WK2 A;  5E6U A;  1L5G A;  3VI4 A;  5E6S A;  3ZDX A;  4Z7N A;  3K72 A;  4NEN A;  3ZDZ A;  2VDO A;  1JV2 A;  2VDQ A;  5FFO A;  3FCS A;  3ZE0 A;  2VDP A;  3VI3 A;  4G1E A;  2VDL A;  3K6S A;  4IRZ A;  4O02 A;  4UM9 A;  3T3M A;  3ZE2 A;  4WK0 A;  1U8C A;  3NID A;  5FFG A;  4G1M A;  4MMX A;  2VDM A;  4UM8 A;  4MMZ A;  3ZE1 A;  2VDK A;  4MMY A;  3V4V A;  4Z7O A;  5HDB A;  2VDR A;  3NIF A;  2VC2 A;  2VDN A;  3K71 A;  3IJE A;  4Z7Q A;  3V4P A;  1M1X A;  3FCU A;  3ZDY A;  3T3P A;  4WK4 A;  1TYE A; 
#chains in the Genus database with same CATH topology
 4WJK A;  4WK2 A;  3DM0 A;  3FM0 A;  1U4C A;  4A2M A;  2AH1 A;  2CE8 A;  4GZ8 A;  2VDO A;  3C5M A;  3FRX A;  2HJB A;  2VDP A;  3PVU B;  2VDL A;  4D0K A;  4IRZ A;  2YBA A;  1GOT B;  3O4G A;  3RSE C;  2BKL A;  2G99 A;  4E5Z B;  1UOP A;  2AGX A;  4J78 A;  2EID A;  3JZG A;  2EIE A;  1E5T A;  1A12 A;  3ZE1 A;  4NSX A;  2GNQ A;  4JT6 C;  2GC7 A;  3JRO A;  3C9C A;  3NVX A;  3DDU A;  4KFM B;  2H9N A;  5CXC B;  5EMM B;  3EI1 A;  4A09 A;  5GXI A;  5IT9 g;  5CYK A;  5M5U A;  4O3U B;  5M61 A;  4A11 A;  4PC0 A;  3PXW D;  4PXW A;  4NC4 A;  4QL1 A;  3DXK C;  1GP2 B;  4GGA A;  2HES X;  3SLE D;  4JXM A;  4ERQ A;  3CFS B;  3ZDZ A;  2P9K C;  3OKT A;  5FKQ A;  3SXT D;  4E54 B;  4J0X A;  4LGN A;  3PSC B;  4E54 A;  2VDM A;  1GXR A;  4FAV D;  2AGZ A;  3V4V A;  4BP8 A;  3CIK B;  2OVQ B;  4L1Q D;  3EI3 A;  2H47 A;  1TBG A;  4AMZ A;  2OIZ A;  3NIG A;  1N6D A;  2YNN A;  4Z7N A;  3K72 A;  4E5Z A;  4GM9 A;  4LG8 A;  4PBZ A;  3ZE0 A;  3JZN A;  2QC5 A;  2AGW A;  4L9O A;  5EMJ B;  1P22 A;  1T2X A;  3IUM A;  5TF2 A;  1JOF A;  3V9F A;  4NBM A;  1GOF A;  1K32 A;  4FA4 D;  4GM3 A;  1MG2 A;  3O4H A;  5HE2 B;  5AJA A;  2O9K A;  2BBK H;  2H9P A;  1M1X A;  4K3I D;  3IKO A;  3RFH A;  3I7K A;  2IUP A;  3EI4 B;  4BUJ C;  2P9I C;  3O4J A;  3IVM A;  4JHN A;  3I2N A;  4A0A B;  4HDJ A;  4J86 A;  4G1M A;  1NEX B;  1VE7 A;  3EQ7 A;  5HE0 B;  2P9L C;  4Z7O A;  3IUJ A;  4ERZ A;  5EAP A;  3UR4 A;  2CN2 A;  1UOO A;  3V4P A;  4UI9 R;  3OKY B;  2I0S A;  3EG6 A;  1UOQ A;  3AH8 B;  4L3G D;  4J8B A;  4DNW A;  2YNP A;  4Z8L A;  1N6E A;  5THA A;  5H1M A;  2B5N A;  4AN1 A;  5M5V A;  3OL2 A;  2IUQ A;  3N0E A;  4JSP C;  2PM7 B;  3DXM C;  4UM8 A;  4CZY A;  1ERJ A;  4JT5 C;  3SBQ A;  5TDH B;  3IUR A;  1GOH A;  3L4O D;  4WK4 A;  2HXC A;  1QFS A;  4ZOZ A;  4GM8 A;  3VI4 A;  3RMZ D;  4NEN A;  4BH6 A;  3SMR A;  3RFG A;  2CN3 A;  1MG3 A;  2VZ1 A;  1VZ3 A;  4UM9 A;  3AL8 A;  3SN6 B;  3IUN A;  5M5T A;  3MXX A;  2IWF A;  3PE7 A;  4QT8 A;  5FXY A;  2GC4 A;  2PM9 B;  3L4M D;  3RN0 D;  4CY1 A;  4RE6 A;  3MMY A;  3EMH A;  4BCB A;  5HDB A;  3EI3 B;  3SCY A;  2VDR A;  2XE4 A;  5KDO B;  2VDN A;  5HE3 B;  5I5J A;  4Z7Q A;  3GFC A;  1S4U X;  4J87 A;  3ZDX A;  3F3F A;  4ZOX A;  5FFO A;  2QZP A;  3F3P A;  4G1E A;  4PSW B;  5HQG A;  5IJ8 E;  2XDW A;  4U7A A;  3UVK A;  3ZE2 A;  4A09 B;  1UTC A;  5A2Q g;  2IWK A;  3NID A;  1XIP A;  3VA6 A;  4D9S A;  3A0F A;  3EWE A;  2HKM A;  4ERY A;  4U1E I;  3VGZ A;  1A0R B;  5K19 A;  1L0Q A;  1QFM A;  3I7P A;  3KRW B;  3I7O A;  5FKS A;  3ODT A;  3EI2 A;  1Q47 A;  1E8N A;  3ZDY A;  4QRJ A;  1TYE A;  5E6R A;  5CXC A;  1VZ2 A;  1O6G A;  2H3X A;  3SJL D;  4LG9 A;  5IJ7 E;  5FQD A;  3SVW D;  4AX4 A;  2Z2O A;  2VDQ A;  1R5M A;  3P4F A;  2J57 G;  4XEI C;  2H6Q A;  4WK0 A;  4GQ1 A;  5M5R A;  4I79 A;  4FA1 D;  3IIW A;  3OTT A;  5FFG A;  5IGO A;  3AL9 A;  4H5J A;  4MMX A;  2P9S C;  3MKS B;  4QAM A;  3IJC A;  4L3H D;  3V5W B;  3EQ8 A;  1RI6 A;  4OZU A;  3RN1 D;  4CI8 A;  3K71 A;  3IJE A;  4AOW A;  4JSX C;  3C99 A;  5C2W B;  3BWS A;  5CXB B;  5M5S A;  5E6S A;  2OK6 A;  2IUV A;  1C9I A;  4BCC A;  1B9X A;  2H13 A;  3PXS D;  4A0B A;  4O02 A;  2H14 A;  2H6N A;  3UKU C;  4A08 A;  1SQJ A;  1PEV A;  4QQE A;  3C75 H;  3I8C A;  2Z2N A;  1YFQ A;  4G56 B;  1H2X A;  2CE9 A;  2EBS A;  3NVN A;  4IA9 A;  1K3I A;  5GXH A;  4X61 B;  3K26 A;  2J55 H;  3IIY A;  3OF7 A;  3GC3 B;  3K27 A;  4XYH A;  1I2M B;  1L5G A;  4A11 B;  4ES0 A;  5SXM A;  4FA9 D;  1JTD B;  2I0R A;  5C2V B;  4O1Q D;  4D6V A;  1JMZ B;  4JSV C;  2VZ3 A;  4GQ2 P;  5C9Z B;  3SHF A;  3EU7 A;  3JRP A;  4G55 A;  4DNV A;  4IMM A;  5EMK B;  4A0A A;  4FHL A;  4MMY A;  1PBY B;  4O9D A;  2XU7 A;  4GGC A;  3SFZ A;  4CI2 A;  4CY5 A;  3T3P A;  4ZOY A;  2I3S A;  4O2W A;  4X60 B;  3QI0 A;  4CC9 A;  5E6U A;  3SWS D;  4ZOV A;  4A08 B;  2HU5 A;  2UZY B;  2IUR A;  4PBY A;  5JWZ A;  4FWW A;  1JV2 A;  5GMK n;  1U2V C;  2HU7 A;  5FKR A;  2YB8 B;  4L1M A;  5TEF A;  4J82 A;  2XL2 A;  5K1C C;  3EI1 B;  1U8C A;  3MVD K;  1XKS A;  2UZX B;  4O45 A;  4H5I A;  1VE6 A;  3NIF A;  3O4I A;  3JAM g;  2OJY A;  3IJ1 A;  1K8K C;  3FGB A;  4OWR A;  4JD2 C;  3CFV A;  2WQ8 A;  4FA5 D;  2AH0 A;  3SBP A;  5CYK B;  4FAN D;  3QHY B;  2YMU A;  2OVR B;  2IAA A;  2PBI B;  4A7J A;  2P9N C;  2MTA H;  2H9M A;  3RLM D;  4PSX B;  2H6K A;  2Q7Q A;  4MMZ A;  5EM2 A;  3IJ0 A;  3JB9 L;  2P9U C;  4NAA A;  3RRM C;  3MZL A;  5HE1 B;  4J81 A;  3J80 g;  4RE5 A;  4TZ4 A;  3MZK A;  1SHY B;  2B5M A;  3UVM A;  3I89 A;  2W18 A;  3PVW B;  5HYN B;  1NR0 A;  3I7L A;  4PNK B;  2I3T A;  4J77 A;  2HU8 A;  3F3G A;  3KRX B;  5B4W A;  3UVN A;  1N6F A;  3NVQ A;  3IUL A;  4MK0 B;  5IGQ A;  2HYE A;  1OMW B;  2P9P C;  5TEE A;  4GMB A;  3DSM A;  3OW8 A;  2EIB A;  3W15 A;  5AFU 3;  4O3T B;  3I7N A;  4J73 A;  2YNO A;  4GGD A;  5EAM A;  1H2W A;  3U4Y A;  2JKX A;  1O6F A;  2XZG A;  2XYI A;  3OKW A;  3EI4 A;  1H2Z A;  4A2L A;  1B9Y A;  5AMS A;  3AFC A;  3BG1 A;  3N0D A;  4X63 B;  2AGL A;  1GG2 B;  1SQ9 A;  3MUN A;  1YR2 A;  3IUQ A;  4X3E A;  3I7H A;  2XL3 A;  1C9L A;  1JMX B;  2AGY A;  3EI2 B;  2J56 H;  4JHP C;  3AL8 B;  1TYQ C;  5H14 A;  3T3M A;  2H9L A;  5C86 A;  4CY2 A;  1PGU A;  4ESG A;  1VYH C;  4DNU A;  4EWR A;  3MUO A;  5C92 A;  2B5L A;  2PM6 B;  3I8E A;  2EIC A;  1PI6 A;  2VC2 A;  3DWL C;  4Y7R A;  2TRC B;  3E0C A;  3FCU A;  2G9A A;  1GOG A;  3GD1 I;  5IC7 A;  3UVO A;  3KCI A;  5FLX g;  4J0W A;  4FB1 D;  3B7F A;  5FKT A;  4YVD A;  2AQ5 A;  3VI3 A;  1H2Y A;  3UVL A;  2QR5 A;  4XYI A;  3EQ9 A;  3PXT D;  5CXB A;  4AEZ A;  4AMY A;  5I5M A;  2CO0 A;  5EML B;  1JJU B;  2B4E A;  3SBR A;  5I5I A;  4A0B B;  3ULE C;  4CZX A;  4BP9 A;  1QNI A;  3JPX A;  4K3J B;  1OLZ A;  3OL2 B;  3VH0 A;  3ORV D;  4CY3 A;  3GRE A;  2HKR A;  4R7A B;  4CI3 A;  4GQB B;  4J8G A;  3PSL A;  1BPO A;  4J84 A;  2I0T A;  2PM9 A;  4N14 A;  3FCS A;  1E8M A;  3JZH A;  5GSA A;  3K6S A;  3ZWL B;  4CI1 A;  2BCJ B;  4J79 A;  4AN0 A;  4BCD A;  2H68 A;  1FWX A;  3UKR C;  2OVP B;  4CZV A;  2Z2P A;  4Y5R D;  2CNX A;  2VDK A;  3V7D B;  5FA5 B;  4BL0 A;  3MKQ A;  5EAL A;  5EAR A;  1MDA H;  5H17 A;  5EM2 B;  3BG0 A;  2HJ4 A;  4JSN C;  3J81 g;  3OKY A;  3HFQ A;  4ZN4 A;  2OK4 A;  2QXV A;  2CO0 C;  1XHM A; 
#chains in the Genus database with same CATH homology
 4WJK A;  3NIG A;  5E6R A;  4WK2 A;  5E6U A;  1L5G A;  3VI4 A;  5E6S A;  3ZDX A;  4Z7N A;  3K72 A;  4NEN A;  3ZDZ A;  2VDO A;  1JV2 A;  2VDQ A;  5FFO A;  3FCS A;  3ZE0 A;  2VDP A;  3VI3 A;  4G1E A;  2VDL A;  3K6S A;  4IRZ A;  4O02 A;  4UM9 A;  3T3M A;  3ZE2 A;  4WK0 A;  1U8C A;  3NID A;  5FFG A;  4G1M A;  4MMX A;  2VDM A;  4UM8 A;  4MMZ A;  3ZE1 A;  2VDK A;  4MMY A;  3V4V A;  4Z7O A;  5HDB A;  2VDR A;  3NIF A;  2VC2 A;  2VDN A;  3K71 A;  3IJE A;  4Z7Q A;  3V4P A;  1M1X A;  3FCU A;  3ZDY A;  3T3P A;  4WK4 A;  1TYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...