3T3PA

A novel high affinity integrin alphaiibbeta3 receptor antagonist that unexpectedly displaces mg2+ from the beta3 midas
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Structure-Guided Design of a High-Affinity Platelet Integrin alphaIIbbeta3 Receptor Antagonist That Disrupts Mg2+ Binding to the MIDAS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 110
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3t3pA00
2VDOA 3FCUA 1M1XA 3ZDZA 2VDKA 4IRZA 4Z7OA 4WK0A 5E6SA 5E6UA 3VI3A 2VDPA 3ZDYA 2VDQA 5E6RA 3ZE0A 3K72A 4G1EA 4WK4A 3ZE1A 2VC2A 4MMZA 3IJEA 5FFGA 3FCSA 2VDNA 4O02A 4G1MA 3NIDA 3V4VA 3V4PA 1TYEA 4Z7QA 5FFOA 3K6SA 3VI4A 5HDBA 3T3MA 1U8CA 4UM9A 4MMXA 4Z7NA 1L5GA 3NIFA 2VDMA 4NENA 2VDRA 3ZE2A 4MMYA 4WJKA 3ZDXA 3T3PA 2VDLA 4UM8A 3K71A 3NIGA 4WK2A 1JV2A
chains in the Genus database with same CATH superfamily
5IC7A 4J73A 4QL1A 2B5NA 2BKLA 2AGZA 3OTTA 4FHLA 4GQ2P 2XL3A 5K19A 2GC7A 4J79A 2UZYB 4JSNC 3MVDK 2VDNA 4O02A 4G1MA 4J8BA 2XE4A 4JHNA 1L0QA 1NR0A 2PBIB 5M5UA 5M5VA 1TBGA 2H13A 2AGXA 2H9NA 1VYHC 4MMYA 2HKRA 2P9UC 3IKOA 3I89A 4GZ8A 1H2YA 2I3TA 4BCCA 3ODTA 3CIKB 4G55A 3DSMA 2CO0A 4Z7OA 4ZOZA 4JT5C 1K32A 4JSXC 3EQ7A 4ESGA 2G99A 4NAAA 3IULA 5EMJB 2H9LA 4GMBA 3MXXA 3C75H 2Z2NA 3ULEC 3EQ9A 2H68A 1N6EA 3CFSB 3IUJA 4QAMA 4BCBA 3K27A 1JMXB 4KFMB 3RN1D 5AJAA 5E6UA 3RRMC 5EMKB 4ZOXA 3V7DB 3U4YA 3AL8A 3KRWB 4J84A 4O2WA 4A7JA 3NIDA 3I7HA 5GXHA 3GC3B 2I3SA 1U8CA 5M5TA 3OL2B 1L5GA 3J81g 4WJKA 5CYKB 4BP9A 3K71A 2P9IC 3QI0A 4A0BB 3C99A 4K3JB 3ORVD 3MMYA 1I2MB 3OL2A 4IA9A 3E0CA 5THAA 2AGWA 4J82A 2MTAH 5IT9g 3O4IA 4A0BA 2QR5A 3SFZA 4BH6A 1GOFA 4GGCA 3PXWD 5GSAA 1H2ZA 4QQEA 5IGQA 4CI3A 2VDRA 4NSXA 1E5TA 2EBSA 3DM0A 3PE7A 5IJ8E 2H6NA 2XU7A 5IGOA 2CNXA 4FAND 3EQ8A 5EM2A 2VDKA 4QRJA 2XDWA 1ERJA 2EIDA 3N0DA 3PVWB 5E6SA 5M5RA 4Y7RA 2WQ8A 3UR4A 3IJ0A 4QT8A 4J0WA 2I0SA 3GFCA 5B4WA 1N6FA 2H47A 3ZE1A 5IJ7E 3OW8A 3W15A 3OKYB 5HQGA 4JSPC 3IJ1A 5AFU3 3NVNA 4LG8A 4CZVA 5HDBA 4MMXA 5CXCB 4AMYA 3PVUB 4PSXB 1YFQA 3DXMC 3EI4A 4GM3A 2GNQA 2I0RA 3MKSB 4GM9A 4O3TB 5FLXg 1B9XA 3UVNA 5CXCA 4L3HD 2EICA 1TYQC 3RFHA 4AEZA 1UTCA 2J57G 2OJYA 3K72A 4UI9R 4A0AB 4ZOYA 4U7AA 4L1MA 2AH0A 4Z8LA 5H14A 2B4EA 2Z2PA 4O9DA 4XYIA 5I5IA 3FGBA 4N14A 3OKWA 3UVMA 2YNPA 2VDMA 4CI1A 1A12A 4CZXA 4A0AA 3UVLA 3O4JA 3SHFA 3EMHA 1XIPA 2IWFA 4RE5A 1UOPA 4FA4D 3L4MD 4JT6C 3DWLC 2B5LA 3F3GA 5JWZA 5C2VB 2J55H 2HU5A 3A0FA 4AN0A 3JROA 4GM8A 4J78A 4JXMA 1VE6A 5EAPA 3SCYA 4O1QD 4JD2C 1K8KC 2P9NC 3DDUA 4J0XA 3NIFA 4CY2A 4D9SA 3L4OD 5HE0B 4CY1A 1GP2B 3P4FA 1PBYB 3PXTD 4BP8A 4CY5A 3AL8B 5H1MA 4H5IA 3KCIA 3BWSA 3JZHA 2VDPA 3SBPA 2B5MA 3IJEA 5FFGA 4I79A 1K3IA 1SHYB 3V4PA 3I2NA 3MKQA 4GGDA 2Q7QA 3FM0A 4NENA 5M5SA 3RLMD 1MG3A 4X63B 5C9ZB 2Z2OA 4UM8A 2O9KA 2H9PA 5FQDA 5C2WB 2I0TA 5EALA 5C86A 4E54A 4PBZA 3EI3B 4DNVA 2IAAA 4XYHA 5EMMB 2P9KC 2OVQB 4X61B 1MDAH 3EI2A 4YVDA 2HXCA 2PM7B 4PBYA 3V4VA 4CI2A 4CC9A 3EI3A 4HDJA 1UOOA 4GQBB 1YR2A 5EM2B 3OF7A 3C5MA 3I8CA 3SBRA 4H5JA 5FKSA 1Q47A 2IUVA 1E8MA 3UKUC 3IURA 1GXRA 3BG0A 2J56H 3AH8B 1C9IA 2HESX 4ZN4A 4PXWA 4A09A 4PSWB 2QC5A 4FAVD 4FA5D 1PI6A 4G1EA 4WK4A 3AL9A 3IUMA 4J81A 3EI4B 2CO0C 3V9FA 3EI1B 4A2LA 2QZPA 4L3GD 4NBMA 4A11B 4U1EI 1XHMA 1OLZA 4FB1D 4CZYA 3JZGA 2IUQA 3NVQA 4Y5RD 2CN2A 1BPOA 3I7KA 4ERZA 4XEIC 3T3PA 3SVWD 3AFCA 2VDLA 2H6KA 2IWKA 3EI1A 2VDOA 4A11A 3SWSD 1U2VC 2QXVA 4R7AB 4E5ZB 3RN0D 4IRZA 1R5MA 5EARA 5TDHB 3IUQA 1QFMA 3VI3A 2VZ3A 3JB9L 2BBKH 3SLED 4AX4A 1SQ9A 4J8GA 4E5ZA 1TYEA 2PM9A 5SXMA 4CY3A 1MG2A 1P22A 2XL2A 4UM9A 2AH1A 3MUOA 3ZE2A 3HFQA 3V5WB 4AN1A 3ZDXA 2XZGA 2H3XA 3JPXA 2HYEA 4JHPC 2EIEA 3PXSD 3PSCB 4MK0B 5GXIA 2HJBA 2AQ5A 1GG2B 4PNKB 5A2Qg 4NC4A 4PC0A 2YNOA 3SJLD 3ZWLB 4LGNA 3OKTA 2OK6A 3I8EA 4MMZA 3FRXA 3VH0A 5H17A 2XYIA 4Z7QA 2BCJB 3JRPA 3RSEC 2HKMA 2HU7A 3I7LA 2P9LC 5AMSA 1QNIA 2AGYA 4A08B 4O45A 4FA1D 4GGAA 4WK2A 1GOTB 5FKQA 1FWXA 3FCUA 4J87A 3MZKA 4K3ID 4L9OA 1O6FA 1OMWB 2CN3A 4WK0A 3EG6A 5FKTA 3GD1I 4A08A 3ZDYA 3ZE0A 4OZUA 5FKRA 3KRXB 4A2MA 5TF2A 1GOGA 4GQ1A 4ZOVA 3GREA 4X3EA 3IIYA 3C9CA 5HYNB 4E54B 2UZXB 3VA6A 3JZNA 1O6GA 4AMZA 2H9MA 4IMMA 1JV2A 1PEVA 3EI2B 2OVPB 4TZ4A 3SXTD 3N0EA 4RE6A 3UKRC 1T2XA 4ERYA 5C92A 5EAMA 5HE3B 4BUJC 1VZ3A 1UOQA 2EIBA 1QFSA 1VZ2A 2IURA 1SQJA 3IIWA 3F3FA 2P9SC 4OWRA 5CXBB 3DXKC 2VZ1A 4L1QD 4EWRA 1PGUA 3I7PA 1XKSA 1B9YA 3EU7A 5M61A 2TRCB 3B7FA 1NEXB 4X60B 4O3UB 1H2WA 3QHYB 5CXBA 4D6VA 3J80g 2CE8A 5I5MA 1JMZB 4A09B 5TEEA 3NIGA 3JAMg 3IJCA 3CFVA 4FWWA 1M1XA 3ZDZA 4ERQA 5TEFA 3IUNA 3MUNA 2OIZA 2OVRB 5I5JA 4D0KA 2PM6B 1JJUB 2YNNA 3UVKA 5CYKA 1U4CA 2AGLA 2VDQA 4J86A 5E6RA 2GC4A 1S4UX 3PSLA 2OK4A 4G56B 5KDOB 4DNWA 2VC2A 5HE2B 3VGZA 3I7NA 2H14A 4ES0A 3VI4A 3T3MA 5GMKn 2HJ4A 4BCDA 4BL0A 2IUPA 3RFGA 4LG9A 1VE7A 2G9AA 3O4GA 1A0RB 3UVOA 2CE9A 3NVXA 2W18A 3SMRA 1JOFA 1GOHA 2YB8B 5FA5B 3K26A 3MZLA 1RI6A 1H2XA 2PM9B 5K1CC 2YMUA 4CI8A 1N6DA 2JKXA 4AOWA 3EWEA 1JTDB 2H6QA 3O4HA 3IVMA 3FCSA 4J77A 4FA9D 3SBQA 3BG1A 5EMLB 5FFOA 3K6SA 4DNUA 3SN6B 2HU8A 3I7OA 4Z7NA 1C9LA 2YBAA 4JSVC 3RMZD 1E8NA 5FXYA 3OKYA 2P9PC 5HE1B 3F3PA
chains in the Genus database with same CATH topology
2VDOA 3FCUA 1M1XA 3ZDZA 2VDKA 4IRZA 4Z7OA 4WK0A 5E6SA 5E6UA 3VI3A 2VDPA 3ZDYA 2VDQA 5E6RA 3ZE0A 3K72A 4G1EA 4WK4A 3ZE1A 2VC2A 4MMZA 3IJEA 5FFGA 3FCSA 2VDNA 4O02A 4G1MA 3NIDA 3V4VA 3V4PA 1TYEA 4Z7QA 5FFOA 3K6SA 3VI4A 5HDBA 3T3MA 1U8CA 4UM9A 4MMXA 4Z7NA 1L5GA 3NIFA 2VDMA 4NENA 2VDRA 3ZE2A 4MMYA 4WJKA 3ZDXA 3T3PA 2VDLA 4UM8A 3K71A 3NIGA 4WK2A 1JV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDO A;  3FCU A;  1M1X A;  3ZDZ A;  2VDK A;  4IRZ A;  4Z7O A;  4WK0 A;  5E6S A;  5E6U A;  3VI3 A;  2VDP A;  3ZDY A;  2VDQ A;  5E6R A;  3ZE0 A;  3K72 A;  4G1E A;  4WK4 A;  3ZE1 A;  2VC2 A;  4MMZ A;  3IJE A;  5FFG A;  3FCS A;  2VDN A;  4O02 A;  4G1M A;  3NID A;  3V4V A;  3V4P A;  1TYE A;  4Z7Q A;  5FFO A;  3K6S A;  3VI4 A;  5HDB A;  3T3M A;  1U8C A;  4UM9 A;  4MMX A;  4Z7N A;  1L5G A;  3NIF A;  2VDM A;  4NEN A;  2VDR A;  3ZE2 A;  4MMY A;  4WJK A;  3ZDX A;  3T3P A;  2VDL A;  4UM8 A;  3K71 A;  3NIG A;  4WK2 A;  1JV2 A; 
#chains in the Genus database with same CATH topology
 5IC7 A;  4J73 A;  4QL1 A;  2B5N A;  2BKL A;  2AGZ A;  3OTT A;  4FHL A;  4GQ2 P;  2XL3 A;  5K19 A;  2GC7 A;  4J79 A;  2UZY B;  4JSN C;  3MVD K;  2VDN A;  4O02 A;  4G1M A;  4J8B A;  2XE4 A;  4JHN A;  1L0Q A;  1NR0 A;  2PBI B;  5M5U A;  5M5V A;  1TBG A;  2H13 A;  2AGX A;  2H9N A;  1VYH C;  4MMY A;  2HKR A;  2P9U C;  3IKO A;  3I89 A;  4GZ8 A;  1H2Y A;  2I3T A;  4BCC A;  3ODT A;  3CIK B;  4G55 A;  3DSM A;  2CO0 A;  4Z7O A;  4ZOZ A;  4JT5 C;  1K32 A;  4JSX C;  3EQ7 A;  4ESG A;  2G99 A;  4NAA A;  3IUL A;  5EMJ B;  2H9L A;  4GMB A;  3MXX A;  3C75 H;  2Z2N A;  3ULE C;  3EQ9 A;  2H68 A;  1N6E A;  3CFS B;  3IUJ A;  4QAM A;  4BCB A;  3K27 A;  1JMX B;  4KFM B;  3RN1 D;  5AJA A;  5E6U A;  3RRM C;  5EMK B;  4ZOX A;  3V7D B;  3U4Y A;  3AL8 A;  3KRW B;  4J84 A;  4O2W A;  4A7J A;  3NID A;  3I7H A;  5GXH A;  3GC3 B;  2I3S A;  1U8C A;  5M5T A;  3OL2 B;  1L5G A;  3J81 g;  4WJK A;  5CYK B;  4BP9 A;  3K71 A;  2P9I C;  3QI0 A;  4A0B B;  3C99 A;  4K3J B;  3ORV D;  3MMY A;  1I2M B;  3OL2 A;  4IA9 A;  3E0C A;  5THA A;  2AGW A;  4J82 A;  2MTA H;  5IT9 g;  3O4I A;  4A0B A;  2QR5 A;  3SFZ A;  4BH6 A;  1GOF A;  4GGC A;  3PXW D;  5GSA A;  1H2Z A;  4QQE A;  5IGQ A;  4CI3 A;  2VDR A;  4NSX A;  1E5T A;  2EBS A;  3DM0 A;  3PE7 A;  5IJ8 E;  2H6N A;  2XU7 A;  5IGO A;  2CNX A;  4FAN D;  3EQ8 A;  5EM2 A;  2VDK A;  4QRJ A;  2XDW A;  1ERJ A;  2EID A;  3N0D A;  3PVW B;  5E6S A;  5M5R A;  4Y7R A;  2WQ8 A;  3UR4 A;  3IJ0 A;  4QT8 A;  4J0W A;  2I0S A;  3GFC A;  5B4W A;  1N6F A;  2H47 A;  3ZE1 A;  5IJ7 E;  3OW8 A;  3W15 A;  3OKY B;  5HQG A;  4JSP C;  3IJ1 A;  5AFU 3;  3NVN A;  4LG8 A;  4CZV A;  5HDB A;  4MMX A;  5CXC B;  4AMY A;  3PVU B;  4PSX B;  1YFQ A;  3DXM C;  3EI4 A;  4GM3 A;  2GNQ A;  2I0R A;  3MKS B;  4GM9 A;  4O3T B;  5FLX g;  1B9X A;  3UVN A;  5CXC A;  4L3H D;  2EIC A;  1TYQ C;  3RFH A;  4AEZ A;  1UTC A;  2J57 G;  2OJY A;  3K72 A;  4UI9 R;  4A0A B;  4ZOY A;  4U7A A;  4L1M A;  2AH0 A;  4Z8L A;  5H14 A;  2B4E A;  2Z2P A;  4O9D A;  4XYI A;  5I5I A;  3FGB A;  4N14 A;  3OKW A;  3UVM A;  2YNP A;  2VDM A;  4CI1 A;  1A12 A;  4CZX A;  4A0A A;  3UVL A;  3O4J A;  3SHF A;  3EMH A;  1XIP A;  2IWF A;  4RE5 A;  1UOP A;  4FA4 D;  3L4M D;  4JT6 C;  3DWL C;  2B5L A;  3F3G A;  5JWZ A;  5C2V B;  2J55 H;  2HU5 A;  3A0F A;  4AN0 A;  3JRO A;  4GM8 A;  4J78 A;  4JXM A;  1VE6 A;  5EAP A;  3SCY A;  4O1Q D;  4JD2 C;  1K8K C;  2P9N C;  3DDU A;  4J0X A;  3NIF A;  4CY2 A;  4D9S A;  3L4O D;  5HE0 B;  4CY1 A;  1GP2 B;  3P4F A;  1PBY B;  3PXT D;  4BP8 A;  4CY5 A;  3AL8 B;  5H1M A;  4H5I A;  3KCI A;  3BWS A;  3JZH A;  2VDP A;  3SBP A;  2B5M A;  3IJE A;  5FFG A;  4I79 A;  1K3I A;  1SHY B;  3V4P A;  3I2N A;  3MKQ A;  4GGD A;  2Q7Q A;  3FM0 A;  4NEN A;  5M5S A;  3RLM D;  1MG3 A;  4X63 B;  5C9Z B;  2Z2O A;  4UM8 A;  2O9K A;  2H9P A;  5FQD A;  5C2W B;  2I0T A;  5EAL A;  5C86 A;  4E54 A;  4PBZ A;  3EI3 B;  4DNV A;  2IAA A;  4XYH A;  5EMM B;  2P9K C;  2OVQ B;  4X61 B;  1MDA H;  3EI2 A;  4YVD A;  2HXC A;  2PM7 B;  4PBY A;  3V4V A;  4CI2 A;  4CC9 A;  3EI3 A;  4HDJ A;  1UOO A;  4GQB B;  1YR2 A;  5EM2 B;  3OF7 A;  3C5M A;  3I8C A;  3SBR A;  4H5J A;  5FKS A;  1Q47 A;  2IUV A;  1E8M A;  3UKU C;  3IUR A;  1GXR A;  3BG0 A;  2J56 H;  3AH8 B;  1C9I A;  2HES X;  4ZN4 A;  4PXW A;  4A09 A;  4PSW B;  2QC5 A;  4FAV D;  4FA5 D;  1PI6 A;  4G1E A;  4WK4 A;  3AL9 A;  3IUM A;  4J81 A;  3EI4 B;  2CO0 C;  3V9F A;  3EI1 B;  4A2L A;  2QZP A;  4L3G D;  4NBM A;  4A11 B;  4U1E I;  1XHM A;  1OLZ A;  4FB1 D;  4CZY A;  3JZG A;  2IUQ A;  3NVQ A;  4Y5R D;  2CN2 A;  1BPO A;  3I7K A;  4ERZ A;  4XEI C;  3T3P A;  3SVW D;  3AFC A;  2VDL A;  2H6K A;  2IWK A;  3EI1 A;  2VDO A;  4A11 A;  3SWS D;  1U2V C;  2QXV A;  4R7A B;  4E5Z B;  3RN0 D;  4IRZ A;  1R5M A;  5EAR A;  5TDH B;  3IUQ A;  1QFM A;  3VI3 A;  2VZ3 A;  3JB9 L;  2BBK H;  3SLE D;  4AX4 A;  1SQ9 A;  4J8G A;  4E5Z A;  1TYE A;  2PM9 A;  5SXM A;  4CY3 A;  1MG2 A;  1P22 A;  2XL2 A;  4UM9 A;  2AH1 A;  3MUO A;  3ZE2 A;  3HFQ A;  3V5W B;  4AN1 A;  3ZDX A;  2XZG A;  2H3X A;  3JPX A;  2HYE A;  4JHP C;  2EIE A;  3PXS D;  3PSC B;  4MK0 B;  5GXI A;  2HJB A;  2AQ5 A;  1GG2 B;  4PNK B;  5A2Q g;  4NC4 A;  4PC0 A;  2YNO A;  3SJL D;  3ZWL B;  4LGN A;  3OKT A;  2OK6 A;  3I8E A;  4MMZ A;  3FRX A;  3VH0 A;  5H17 A;  2XYI A;  4Z7Q A;  2BCJ B;  3JRP A;  3RSE C;  2HKM A;  2HU7 A;  3I7L A;  2P9L C;  5AMS A;  1QNI A;  2AGY A;  4A08 B;  4O45 A;  4FA1 D;  4GGA A;  4WK2 A;  1GOT B;  5FKQ A;  1FWX A;  3FCU A;  4J87 A;  3MZK A;  4K3I D;  4L9O A;  1O6F A;  1OMW B;  2CN3 A;  4WK0 A;  3EG6 A;  5FKT A;  3GD1 I;  4A08 A;  3ZDY A;  3ZE0 A;  4OZU A;  5FKR A;  3KRX B;  4A2M A;  5TF2 A;  1GOG A;  4GQ1 A;  4ZOV A;  3GRE A;  4X3E A;  3IIY A;  3C9C A;  5HYN B;  4E54 B;  2UZX B;  3VA6 A;  3JZN A;  1O6G A;  4AMZ A;  2H9M A;  4IMM A;  1JV2 A;  1PEV A;  3EI2 B;  2OVP B;  4TZ4 A;  3SXT D;  3N0E A;  4RE6 A;  3UKR C;  1T2X A;  4ERY A;  5C92 A;  5EAM A;  5HE3 B;  4BUJ C;  1VZ3 A;  1UOQ A;  2EIB A;  1QFS A;  1VZ2 A;  2IUR A;  1SQJ A;  3IIW A;  3F3F A;  2P9S C;  4OWR A;  5CXB B;  3DXK C;  2VZ1 A;  4L1Q D;  4EWR A;  1PGU A;  3I7P A;  1XKS A;  1B9Y A;  3EU7 A;  5M61 A;  2TRC B;  3B7F A;  1NEX B;  4X60 B;  4O3U B;  1H2W A;  3QHY B;  5CXB A;  4D6V A;  3J80 g;  2CE8 A;  5I5M A;  1JMZ B;  4A09 B;  5TEE A;  3NIG A;  3JAM g;  3IJC A;  3CFV A;  4FWW A;  1M1X A;  3ZDZ A;  4ERQ A;  5TEF A;  3IUN A;  3MUN A;  2OIZ A;  2OVR B;  5I5J A;  4D0K A;  2PM6 B;  1JJU B;  2YNN A;  3UVK A;  5CYK A;  1U4C A;  2AGL A;  2VDQ A;  4J86 A;  5E6R A;  2GC4 A;  1S4U X;  3PSL A;  2OK4 A;  4G56 B;  5KDO B;  4DNW A;  2VC2 A;  5HE2 B;  3VGZ A;  3I7N A;  2H14 A;  4ES0 A;  3VI4 A;  3T3M A;  5GMK n;  2HJ4 A;  4BCD A;  4BL0 A;  2IUP A;  3RFG A;  4LG9 A;  1VE7 A;  2G9A A;  3O4G A;  1A0R B;  3UVO A;  2CE9 A;  3NVX A;  2W18 A;  3SMR A;  1JOF A;  1GOH A;  2YB8 B;  5FA5 B;  3K26 A;  3MZL A;  1RI6 A;  1H2X A;  2PM9 B;  5K1C C;  2YMU A;  4CI8 A;  1N6D A;  2JKX A;  4AOW A;  3EWE A;  1JTD B;  2H6Q A;  3O4H A;  3IVM A;  3FCS A;  4J77 A;  4FA9 D;  3SBQ A;  3BG1 A;  5EML B;  5FFO A;  3K6S A;  4DNU A;  3SN6 B;  2HU8 A;  3I7O A;  4Z7N A;  1C9L A;  2YBA A;  4JSV C;  3RMZ D;  1E8N A;  5FXY A;  3OKY A;  2P9P C;  5HE1 B;  3F3P A; 
#chains in the Genus database with same CATH homology
 2VDO A;  3FCU A;  1M1X A;  3ZDZ A;  2VDK A;  4IRZ A;  4Z7O A;  4WK0 A;  5E6S A;  5E6U A;  3VI3 A;  2VDP A;  3ZDY A;  2VDQ A;  5E6R A;  3ZE0 A;  3K72 A;  4G1E A;  4WK4 A;  3ZE1 A;  2VC2 A;  4MMZ A;  3IJE A;  5FFG A;  3FCS A;  2VDN A;  4O02 A;  4G1M A;  3NID A;  3V4V A;  3V4P A;  1TYE A;  4Z7Q A;  5FFO A;  3K6S A;  3VI4 A;  5HDB A;  3T3M A;  1U8C A;  4UM9 A;  4MMX A;  4Z7N A;  1L5G A;  3NIF A;  2VDM A;  4NEN A;  2VDR A;  3ZE2 A;  4MMY A;  4WJK A;  3ZDX A;  3T3P A;  2VDL A;  4UM8 A;  3K71 A;  3NIG A;  4WK2 A;  1JV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...