2VDKA

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdkA00
3FCSA 3ZE2A 2VDPA 4UM8A 4NENA 3ZE1A 3T3PA 3K71A 4WJKA 3VI3A 5E6RA 4MMXA 1U8CA 4O02A 5E6UA 4IRZA 4MMYA 3T3MA 3ZE0A 1M1XA 4UM9A 4Z7NA 2VDLA 3IJEA 3FCUA 2VDNA 4G1MA 4MMZA 5HDBA 5FFOA 5E6SA 3V4PA 3K6SA 2VDQA 2VC2A 4WK4A 3ZDYA 1JV2A 4WK2A 3VI4A 2VDOA 4WK0A 3ZDZA 4Z7QA 1L5GA 5FFGA 1TYEA 3NIFA 3NIDA 3V4VA 3ZDXA 2VDRA 2VDKA 4Z7OA 3NIGA 4G1EA 3K72A 2VDMA
chains in the Genus database with same CATH superfamily
4NENA 3QHYB 1A0RB 2B5LA 5AJAA 1JMXB 1P22A 1FWXA 2B5MA 4FAVD 3JB9L 4J73A 3I7NA 3JZGA 3C5MA 1ERJA 2WQ8A 4LGNA 5GSAA 3C99A 4PXWA 3AFCA 1MDAH 4A0BA 3EI1A 4ZN4A 4WK0A 3ZDZA 4Z7QA 5CXCB 4JSNC 4E54A 2YNPA 4CY3A 1YFQA 4N14A 3NIGA 2H9NA 4CY2A 4RE5A 2YB8B 4H5JA 3ZE2A 2HJBA 2B4EA 1Q47A 4J87A 1K32A 4J0WA 3MKQA 1C9IA 4RE6A 5E6UA 2QC5A 5EAPA 2CE9A 4JD2C 3I7PA 2PM7B 4YVDA 4NBMA 4CI1A 3IUQA 2H6KA 3MVDK 3VI4A 2EIBA 4FB1D 3DSMA 1GOGA 1SQJA 4O9DA 2OK4A 4GQ2P 3UR4A 2GNQA 2HU7A 3T3PA 4BH6A 4K3JB 4A11B 3EQ8A 3K26A 4O02A 5EMMB 5JWZA 1U2VC 2XDWA 1E8NA 4GMBA 1NEXB 4G1MA 3J81g 2AH0A 2OVRB 4FAND 3QI0A 3FM0A 1GP2B 2OIZA 3AL8B 2H6NA 4DNVA 1K3IA 4BUJC 5HE0B 4X61B 1QFSA 5FXYA 4CZYA 2VDKA 3O4HA 3KRWB 4L1QD 3EI4A 4PC0A 5H1MA 3SFZA 4O45A 5C92A 3UVOA 2P9LC 3IJ1A 4JXMA 4PBYA 3EI3B 3MKSB 3PXTD 2PM9B 2VDNA 3PVWB 2G9AA 3VGZA 3FRXA 4O1QD 2OVQB 3SVWD 1N6DA 4BCCA 3RFGA 4H5IA 4KFMB 1N6FA 4MK0B 3UVMA 4XYIA 2GC7A 1YR2A 3UVKA 3EU7A 3AL9A 4QRJA 3ZDXA 4FA4D 2HESX 4G1EA 4TZ4A 5M5RA 3RN1D 1H2ZA 3OKYA 2AGXA 2OVPB 3C9CA 5FA5B 4J86A 4FA1D 3IVMA 2Z2OA 3ZWLB 4QQEA 4J78A 4UM9A 5FLXg 2Z2PA 5FQDA 4JT6C 3A0FA 3BG0A 2P9KC 1XKSA 4A0BB 3I7HA 1B9YA 4BCDA 4NSXA 4BP9A 1VZ3A 3F3FA 4NAAA 4WK4A 3NVQA 3I8CA 1H2WA 2VDOA 5GMKn 1PGUA 1VE6A 4Y7RA 4A2LA 4XYHA 3V4VA 5C2VB 4A09A 4ZOVA 2YNOA 3EQ9A 4Z8LA 2P9PC 2W18A 5E6RA 3NVXA 4MMXA 1R5MA 4JHPC 3K27A 3ZE0A 3FCUA 1PBYB 3MZKA 3O4IA 4AOWA 4NC4A 3IUJA 4O3TB 2IUVA 3SBRA 3IULA 1I2MB 3CIKB 3P4FA 1JMZB 4A08A 3IIYA 4ES0A 5IJ8E 1GXRA 2J55H 3I7LA 3PSCB 2QZPA 2P9SC 3I7OA 4Z7OA 3SLED 3OTTA 5FKRA 4L1MA 1PEVA 5AFU3 2IWFA 1H2XA 4FWWA 1K8KC 4QL1A 1TBGA 3T3MA 3DDUA 4CZXA 2B5NA 2XZGA 2CN3A 2AGWA 2HKMA 5EM2B 3OF7A 3OL2A 1UOQA 1UOOA 2AGLA 5HDBA 5E6SA 4E5ZA 4DNWA 3MUOA 2PBIB 4QT8A 3BG1A 3CFVA 4L3GD 4ZOZA 4O2WA 5I5MA 2YNNA 1UOPA 4QAMA 4PNKB 5A2Qg 5GXHA 1SHYB 5HYNB 1GOHA 1PI6A 3EI4B 2I3TA 2VDMA 5K19A 2VZ3A 5THAA 5K1CC 4BL0A 5IGOA 2QXVA 4J84A 4AEZA 1XIPA 4D0KA 4IMMA 4MMZA 5FFOA 5M61A 4A2MA 3MUNA 3K6SA 3SHFA 2VDQA 2CO0C 5SXMA 3ZDYA 5M5TA 4JSVC 2HXCA 1B9XA 3VA6A 3UVNA 1T2XA 1OMWB 3NIDA 4CZVA 5EARA 3KRXB 1H2YA 3RN0D 2CNXA 3FCSA 5TDHB 5FKQA 3MZLA 4CC9A 3JAMg 2AGYA 3OKTA 3RLMD 3L4OD 4J8GA 2H14A 2H47A 3IIWA 4OZUA 5CYKA 3EQ7A 4JSPC 1JV2A 4J82A 4LG9A 4AMZA 1TYQC 4A0AA 4HDJA 2P9UC 2EBSA 5HE1B 4R7AB 5TF2A 5HQGA 2P9IC 4J0XA 2H9LA 3I89A 4PSXB 4J8BA 2I0RA 3C75H 5CXBA 3B7FA 1GOTB 2OK6A 3IURA 2G99A 3IJCA 4IRZA 4CY1A 1JJUB 3SJLD 2AQ5A 4FA5D 4Z7NA 3GFCA 2J57G 3O4GA 2IWKA 4O3UB 3RSEC 1JTDB 4XEIC 3EMHA 3EI1B 4JT5C 4GQ1A 4PBZA 2HYEA 3AL8A 1SQ9A 2H6QA 3PE7A 4E54B 2P9NC 3ORVD 2H9PA 3E0CA 2CN2A 2XL2A 2OJYA 2CO0A 4AN0A 5IT9g 2EIDA 5KDOB 4CY5A 3IJ0A 3GD1I 4D6VA 4PSWB 2HKRA 3CFSB 3UVLA 4EWRA 3SCYA 3OL2B 3EI2A 3DWLC 5AMSA 4GZ8A 2IAAA 4E5ZB 4Y5RD 5C2WB 5M5VA 1O6GA 2PM9A 1N6EA 4G56B 3RRMC 4I79A 4L3HD 4X63B 5FKSA 1RI6A 2I3SA 4GM9A 3SWSD 3L4MD 2HJ4A 2BKLA 3JRPA 2I0SA 5FFGA 5TEEA 1TYEA 4J79A 3IKOA 2AGZA 4GM3A 3K72A 2YMUA 3V5WB 1QNIA 1L0QA 2CE8A 1U8CA 5IJ7E 4L9OA 3FGBA 1U4CA 3V7DB 2UZXB 3PXWD 4X3EA 4J77A 2Z2NA 3JZHA 3ODTA 4ESGA 2IURA 4AX4A 3I7KA 5IGQA 3EWEA 4AN1A 5M5UA 3NVNA 1L5GA 4ERYA 5I5IA 3AH8B 3IUMA 3PXSD 3UKRC 3I8EA 4DNUA 4G55A 3MXXA 1NR0A 3ZE1A 3SMRA 3BWSA 4WJKA 3VI3A 4AMYA 3W15A 4D9SA 3OW8A 3RMZD 1M1XA 3JZNA 2VDLA 5IC7A 3HFQA 3IUNA 4GGAA 5CYKB 5H14A 3DM0A 2MTAH 5EMLB 3N0EA 1UTCA 2Q7QA 3OKWA 2XU7A 1GG2B 4A0AB 3SXTD 1A12A 3RFHA 1XHMA 5I5JA 4IA9A 2XE4A 2EIEA 4X60B 2QR5A 2YBAA 5CXCA 2H13A 4U7AA 3OKYB 5C9ZB 1E8MA 5M5SA 5CXBB 2HU5A 3U4YA 2VDPA 2XYIA 5EMKB 2BCJB 4MMYA 4GGCA 3UKUC 4CI3A 3IJEA 3KCIA 5EAMA 5EM2A 2BBKH 4JHNA 3V4PA 4ERQA 4OWRA 4ZOYA 3J80g 1VE7A 2JKXA 5HE3B 2PM6B 1O6FA 3PVUB 4WK2A 4J81A 4CI8A 2GC4A 1OLZA 4A09B 3NIFA 2VDRA 4LG8A 3SBQA 4ZOXA 2HU8A 3PSLA 3GREA 2VZ1A 1VZ2A 2H3XA 4UM8A 4BCBA 3K71A 3I2NA 3EI2B 3F3PA 3VH0A 3JROA 2J56H 2XL3A 2UZYB 4GM8A 4BP8A 4A11A 2H9MA 2AH1A 2O9KA 3SBPA 4K3ID 1S4UX 4UI9R 5EMJB 1VYHC 4A08B 3O4JA 2VC2A 5C86A 4FA9D 2H68A 5H17A 4A7JA 1BPOA 3MMYA 1QFMA 3DXKC 3JPXA 3V9FA 1MG3A 2IUPA 3DXMC 3N0DA 5HE2B 3ULEC 4U1EI 1MG2A 5EALA 1E5TA 5TEFA 4JSXC 2TRCB 3EI3A 2IUQA 4FHLA 4GQBB 5FKTA 1JOFA 4CI2A 4ERZA 3GC3B 1C9LA 2EICA 4GGDA 1GOFA 3F3GA 2I0TA 5B4WA 5GXIA 3SN6B 3EG6A
chains in the Genus database with same CATH topology
3FCSA 3ZE2A 2VDPA 4UM8A 4NENA 3ZE1A 3T3PA 3K71A 4WJKA 3VI3A 5E6RA 4MMXA 1U8CA 4O02A 5E6UA 4IRZA 4MMYA 3T3MA 3ZE0A 1M1XA 4UM9A 4Z7NA 2VDLA 3IJEA 3FCUA 2VDNA 4G1MA 4MMZA 5HDBA 5FFOA 5E6SA 3V4PA 3K6SA 2VDQA 2VC2A 4WK4A 3ZDYA 1JV2A 4WK2A 3VI4A 2VDOA 4WK0A 3ZDZA 4Z7QA 1L5GA 5FFGA 1TYEA 3NIFA 3NIDA 3V4VA 3ZDXA 2VDRA 2VDKA 4Z7OA 3NIGA 4G1EA 3K72A 2VDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FCS A;  3ZE2 A;  2VDP A;  4UM8 A;  4NEN A;  3ZE1 A;  3T3P A;  3K71 A;  4WJK A;  3VI3 A;  5E6R A;  4MMX A;  1U8C A;  4O02 A;  5E6U A;  4IRZ A;  4MMY A;  3T3M A;  3ZE0 A;  1M1X A;  4UM9 A;  4Z7N A;  2VDL A;  3IJE A;  3FCU A;  2VDN A;  4G1M A;  4MMZ A;  5HDB A;  5FFO A;  5E6S A;  3V4P A;  3K6S A;  2VDQ A;  2VC2 A;  4WK4 A;  3ZDY A;  1JV2 A;  4WK2 A;  3VI4 A;  2VDO A;  4WK0 A;  3ZDZ A;  4Z7Q A;  1L5G A;  5FFG A;  1TYE A;  3NIF A;  3NID A;  3V4V A;  3ZDX A;  2VDR A;  2VDK A;  4Z7O A;  3NIG A;  4G1E A;  3K72 A;  2VDM A; 
#chains in the Genus database with same CATH topology
 4NEN A;  3QHY B;  1A0R B;  2B5L A;  5AJA A;  1JMX B;  1P22 A;  1FWX A;  2B5M A;  4FAV D;  3JB9 L;  4J73 A;  3I7N A;  3JZG A;  3C5M A;  1ERJ A;  2WQ8 A;  4LGN A;  5GSA A;  3C99 A;  4PXW A;  3AFC A;  1MDA H;  4A0B A;  3EI1 A;  4ZN4 A;  4WK0 A;  3ZDZ A;  4Z7Q A;  5CXC B;  4JSN C;  4E54 A;  2YNP A;  4CY3 A;  1YFQ A;  4N14 A;  3NIG A;  2H9N A;  4CY2 A;  4RE5 A;  2YB8 B;  4H5J A;  3ZE2 A;  2HJB A;  2B4E A;  1Q47 A;  4J87 A;  1K32 A;  4J0W A;  3MKQ A;  1C9I A;  4RE6 A;  5E6U A;  2QC5 A;  5EAP A;  2CE9 A;  4JD2 C;  3I7P A;  2PM7 B;  4YVD A;  4NBM A;  4CI1 A;  3IUQ A;  2H6K A;  3MVD K;  3VI4 A;  2EIB A;  4FB1 D;  3DSM A;  1GOG A;  1SQJ A;  4O9D A;  2OK4 A;  4GQ2 P;  3UR4 A;  2GNQ A;  2HU7 A;  3T3P A;  4BH6 A;  4K3J B;  4A11 B;  3EQ8 A;  3K26 A;  4O02 A;  5EMM B;  5JWZ A;  1U2V C;  2XDW A;  1E8N A;  4GMB A;  1NEX B;  4G1M A;  3J81 g;  2AH0 A;  2OVR B;  4FAN D;  3QI0 A;  3FM0 A;  1GP2 B;  2OIZ A;  3AL8 B;  2H6N A;  4DNV A;  1K3I A;  4BUJ C;  5HE0 B;  4X61 B;  1QFS A;  5FXY A;  4CZY A;  2VDK A;  3O4H A;  3KRW B;  4L1Q D;  3EI4 A;  4PC0 A;  5H1M A;  3SFZ A;  4O45 A;  5C92 A;  3UVO A;  2P9L C;  3IJ1 A;  4JXM A;  4PBY A;  3EI3 B;  3MKS B;  3PXT D;  2PM9 B;  2VDN A;  3PVW B;  2G9A A;  3VGZ A;  3FRX A;  4O1Q D;  2OVQ B;  3SVW D;  1N6D A;  4BCC A;  3RFG A;  4H5I A;  4KFM B;  1N6F A;  4MK0 B;  3UVM A;  4XYI A;  2GC7 A;  1YR2 A;  3UVK A;  3EU7 A;  3AL9 A;  4QRJ A;  3ZDX A;  4FA4 D;  2HES X;  4G1E A;  4TZ4 A;  5M5R A;  3RN1 D;  1H2Z A;  3OKY A;  2AGX A;  2OVP B;  3C9C A;  5FA5 B;  4J86 A;  4FA1 D;  3IVM A;  2Z2O A;  3ZWL B;  4QQE A;  4J78 A;  4UM9 A;  5FLX g;  2Z2P A;  5FQD A;  4JT6 C;  3A0F A;  3BG0 A;  2P9K C;  1XKS A;  4A0B B;  3I7H A;  1B9Y A;  4BCD A;  4NSX A;  4BP9 A;  1VZ3 A;  3F3F A;  4NAA A;  4WK4 A;  3NVQ A;  3I8C A;  1H2W A;  2VDO A;  5GMK n;  1PGU A;  1VE6 A;  4Y7R A;  4A2L A;  4XYH A;  3V4V A;  5C2V B;  4A09 A;  4ZOV A;  2YNO A;  3EQ9 A;  4Z8L A;  2P9P C;  2W18 A;  5E6R A;  3NVX A;  4MMX A;  1R5M A;  4JHP C;  3K27 A;  3ZE0 A;  3FCU A;  1PBY B;  3MZK A;  3O4I A;  4AOW A;  4NC4 A;  3IUJ A;  4O3T B;  2IUV A;  3SBR A;  3IUL A;  1I2M B;  3CIK B;  3P4F A;  1JMZ B;  4A08 A;  3IIY A;  4ES0 A;  5IJ8 E;  1GXR A;  2J55 H;  3I7L A;  3PSC B;  2QZP A;  2P9S C;  3I7O A;  4Z7O A;  3SLE D;  3OTT A;  5FKR A;  4L1M A;  1PEV A;  5AFU 3;  2IWF A;  1H2X A;  4FWW A;  1K8K C;  4QL1 A;  1TBG A;  3T3M A;  3DDU A;  4CZX A;  2B5N A;  2XZG A;  2CN3 A;  2AGW A;  2HKM A;  5EM2 B;  3OF7 A;  3OL2 A;  1UOQ A;  1UOO A;  2AGL A;  5HDB A;  5E6S A;  4E5Z A;  4DNW A;  3MUO A;  2PBI B;  4QT8 A;  3BG1 A;  3CFV A;  4L3G D;  4ZOZ A;  4O2W A;  5I5M A;  2YNN A;  1UOP A;  4QAM A;  4PNK B;  5A2Q g;  5GXH A;  1SHY B;  5HYN B;  1GOH A;  1PI6 A;  3EI4 B;  2I3T A;  2VDM A;  5K19 A;  2VZ3 A;  5THA A;  5K1C C;  4BL0 A;  5IGO A;  2QXV A;  4J84 A;  4AEZ A;  1XIP A;  4D0K A;  4IMM A;  4MMZ A;  5FFO A;  5M61 A;  4A2M A;  3MUN A;  3K6S A;  3SHF A;  2VDQ A;  2CO0 C;  5SXM A;  3ZDY A;  5M5T A;  4JSV C;  2HXC A;  1B9X A;  3VA6 A;  3UVN A;  1T2X A;  1OMW B;  3NID A;  4CZV A;  5EAR A;  3KRX B;  1H2Y A;  3RN0 D;  2CNX A;  3FCS A;  5TDH B;  5FKQ A;  3MZL A;  4CC9 A;  3JAM g;  2AGY A;  3OKT A;  3RLM D;  3L4O D;  4J8G A;  2H14 A;  2H47 A;  3IIW A;  4OZU A;  5CYK A;  3EQ7 A;  4JSP C;  1JV2 A;  4J82 A;  4LG9 A;  4AMZ A;  1TYQ C;  4A0A A;  4HDJ A;  2P9U C;  2EBS A;  5HE1 B;  4R7A B;  5TF2 A;  5HQG A;  2P9I C;  4J0X A;  2H9L A;  3I89 A;  4PSX B;  4J8B A;  2I0R A;  3C75 H;  5CXB A;  3B7F A;  1GOT B;  2OK6 A;  3IUR A;  2G99 A;  3IJC A;  4IRZ A;  4CY1 A;  1JJU B;  3SJL D;  2AQ5 A;  4FA5 D;  4Z7N A;  3GFC A;  2J57 G;  3O4G A;  2IWK A;  4O3U B;  3RSE C;  1JTD B;  4XEI C;  3EMH A;  3EI1 B;  4JT5 C;  4GQ1 A;  4PBZ A;  2HYE A;  3AL8 A;  1SQ9 A;  2H6Q A;  3PE7 A;  4E54 B;  2P9N C;  3ORV D;  2H9P A;  3E0C A;  2CN2 A;  2XL2 A;  2OJY A;  2CO0 A;  4AN0 A;  5IT9 g;  2EID A;  5KDO B;  4CY5 A;  3IJ0 A;  3GD1 I;  4D6V A;  4PSW B;  2HKR A;  3CFS B;  3UVL A;  4EWR A;  3SCY A;  3OL2 B;  3EI2 A;  3DWL C;  5AMS A;  4GZ8 A;  2IAA A;  4E5Z B;  4Y5R D;  5C2W B;  5M5V A;  1O6G A;  2PM9 A;  1N6E A;  4G56 B;  3RRM C;  4I79 A;  4L3H D;  4X63 B;  5FKS A;  1RI6 A;  2I3S A;  4GM9 A;  3SWS D;  3L4M D;  2HJ4 A;  2BKL A;  3JRP A;  2I0S A;  5FFG A;  5TEE A;  1TYE A;  4J79 A;  3IKO A;  2AGZ A;  4GM3 A;  3K72 A;  2YMU A;  3V5W B;  1QNI A;  1L0Q A;  2CE8 A;  1U8C A;  5IJ7 E;  4L9O A;  3FGB A;  1U4C A;  3V7D B;  2UZX B;  3PXW D;  4X3E A;  4J77 A;  2Z2N A;  3JZH A;  3ODT A;  4ESG A;  2IUR A;  4AX4 A;  3I7K A;  5IGQ A;  3EWE A;  4AN1 A;  5M5U A;  3NVN A;  1L5G A;  4ERY A;  5I5I A;  3AH8 B;  3IUM A;  3PXS D;  3UKR C;  3I8E A;  4DNU A;  4G55 A;  3MXX A;  1NR0 A;  3ZE1 A;  3SMR A;  3BWS A;  4WJK A;  3VI3 A;  4AMY A;  3W15 A;  4D9S A;  3OW8 A;  3RMZ D;  1M1X A;  3JZN A;  2VDL A;  5IC7 A;  3HFQ A;  3IUN A;  4GGA A;  5CYK B;  5H14 A;  3DM0 A;  2MTA H;  5EML B;  3N0E A;  1UTC A;  2Q7Q A;  3OKW A;  2XU7 A;  1GG2 B;  4A0A B;  3SXT D;  1A12 A;  3RFH A;  1XHM A;  5I5J A;  4IA9 A;  2XE4 A;  2EIE A;  4X60 B;  2QR5 A;  2YBA A;  5CXC A;  2H13 A;  4U7A A;  3OKY B;  5C9Z B;  1E8M A;  5M5S A;  5CXB B;  2HU5 A;  3U4Y A;  2VDP A;  2XYI A;  5EMK B;  2BCJ B;  4MMY A;  4GGC A;  3UKU C;  4CI3 A;  3IJE A;  3KCI A;  5EAM A;  5EM2 A;  2BBK H;  4JHN A;  3V4P A;  4ERQ A;  4OWR A;  4ZOY A;  3J80 g;  1VE7 A;  2JKX A;  5HE3 B;  2PM6 B;  1O6F A;  3PVU B;  4WK2 A;  4J81 A;  4CI8 A;  2GC4 A;  1OLZ A;  4A09 B;  3NIF A;  2VDR A;  4LG8 A;  3SBQ A;  4ZOX A;  2HU8 A;  3PSL A;  3GRE A;  2VZ1 A;  1VZ2 A;  2H3X A;  4UM8 A;  4BCB A;  3K71 A;  3I2N A;  3EI2 B;  3F3P A;  3VH0 A;  3JRO A;  2J56 H;  2XL3 A;  2UZY B;  4GM8 A;  4BP8 A;  4A11 A;  2H9M A;  2AH1 A;  2O9K A;  3SBP A;  4K3I D;  1S4U X;  4UI9 R;  5EMJ B;  1VYH C;  4A08 B;  3O4J A;  2VC2 A;  5C86 A;  4FA9 D;  2H68 A;  5H17 A;  4A7J A;  1BPO A;  3MMY A;  1QFM A;  3DXK C;  3JPX A;  3V9F A;  1MG3 A;  2IUP A;  3DXM C;  3N0D A;  5HE2 B;  3ULE C;  4U1E I;  1MG2 A;  5EAL A;  1E5T A;  5TEF A;  4JSX C;  2TRC B;  3EI3 A;  2IUQ A;  4FHL A;  4GQB B;  5FKT A;  1JOF A;  4CI2 A;  4ERZ A;  3GC3 B;  1C9L A;  2EIC A;  4GGD A;  1GOF A;  3F3G A;  2I0T A;  5B4W A;  5GXI A;  3SN6 B;  3EG6 A; 
#chains in the Genus database with same CATH homology
 3FCS A;  3ZE2 A;  2VDP A;  4UM8 A;  4NEN A;  3ZE1 A;  3T3P A;  3K71 A;  4WJK A;  3VI3 A;  5E6R A;  4MMX A;  1U8C A;  4O02 A;  5E6U A;  4IRZ A;  4MMY A;  3T3M A;  3ZE0 A;  1M1X A;  4UM9 A;  4Z7N A;  2VDL A;  3IJE A;  3FCU A;  2VDN A;  4G1M A;  4MMZ A;  5HDB A;  5FFO A;  5E6S A;  3V4P A;  3K6S A;  2VDQ A;  2VC2 A;  4WK4 A;  3ZDY A;  1JV2 A;  4WK2 A;  3VI4 A;  2VDO A;  4WK0 A;  3ZDZ A;  4Z7Q A;  1L5G A;  5FFG A;  1TYE A;  3NIF A;  3NID A;  3V4V A;  3ZDX A;  2VDR A;  2VDK A;  4Z7O A;  3NIG A;  4G1E A;  3K72 A;  2VDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...