2VDKA

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdkA00
5E6RA 3VI3A 3ZDYA 3ZE2A 1TYEA 3NIDA 4Z7QA 2VC2A 2VDKA 4IRZA 4MMXA 2VDQA 4Z7NA 5E6SA 3V4PA 3FCUA 3NIGA 2VDMA 3ZDXA 4Z7OA 1L5GA 4G1EA 3IJEA 4O02A 3ZDZA 5FFGA 4MMZA 3VI4A 3ZE0A 3NIFA 5E6UA 4WK0A 3T3MA 4NENA 2VDRA 3K6SA 4WK2A 3FCSA 4MMYA 2VDNA 4UM9A 3K71A 1U8CA 2VDPA 3ZE1A 2VDLA 5HDBA 1M1XA 3T3PA 4G1MA 2VDOA 1JV2A 4UM8A 4WK4A 4WJKA 3V4VA 3K72A 5FFOA
chains in the Genus database with same CATH superfamily
3EI1A 3BG1A 3ZE2A 1JTDB 3EU7A 2VDKA 4MMXA 4DNVA 4A11B 2CN3A 1O6GA 2YMUA 3UVLA 1GP2B 5B4WA 3OTTA 1NEXB 3C9CA 5EMLB 3EQ9A 4XYIA 3IUQA 4A2MA 5C86A 4PC0A 3K27A 3SCYA 3SVWD 2VDOA 4K3ID 2O9KA 1SQJA 3E0CA 2I0TA 4ZOYA 2PM9B 3FCUA 2OVPB 3I7NA 4G56B 4E54A 3F3GA 2XU7A 3UVNA 3ZWLB 1VE7A 5HQGA 3PE7A 4E5ZB 2AGZA 2B5MA 5IGOA 4D6VA 1GG2B 5M5UA 2VDMA 4PBZA 4CZXA 2WQ8A 2AQ5A 2I3TA 5I5MA 4A0AB 5EAPA 4GGDA 3RN0D 4PNKB 5HE2B 4CY2A 2HU7A 1N6DA 4J0XA 1E5TA 3PVUB 4YVDA 2XL3A 3IUMA 3CFVA 4PSXB 3SN6B 4J86A 4A09B 1VZ2A 2I3SA 2QXVA 3MXXA 3RRMC 3MKQA 3C99A 4IA9A 3KRXB 3OW8A 4JXMA 4JT5C 5TDHB 4J8BA 1JMZB 4I79A 2JKXA 2IUPA 1VYHC 3EWEA 1VZ3A 5HE0B 3EI3B 3EG6A 3DSMA 4JSPC 4TZ4A 1TYQC 2OK4A 3FRXA 5HE1B 3ZDZA 4FAND 4FHLA 3DXMC 3ZE0A 5GSAA 2OVRB 4D0KA 4CI1A 1P22A 4LGNA 3SHFA 4G1MA 1N6FA 2P9PC 3UVOA 1GOHA 3GREA 5H1MA 1UOOA 4A11A 4AN1A 4NSXA 1U4CA 2AGYA 4KFMB 3O4IA 3UR4A 3IIWA 4U7AA 1GOTB 5E6SA 3RMZD 3RSEC 3RN1D 3PXTD 3OKYB 3VA6A 3MUOA 4OWRA 2CE8A 4WK0A 3VH0A 2XL2A 3KRWB 2VDRA 4GQBB 4A2LA 4CZYA 1I2MB 4CY3A 4FA9D 3N0DA 2UZYB 1M1XA 2PM9A 3IKOA 5FLXg 5EMJB 4J78A 4BP9A 5I5IA 1XKSA 4E5ZA 2P9SC 1K3IA 3I7HA 4ZOZA 2H6NA 4A0AA 5IJ8E 1A0RB 2VDQA 1L0QA 4EWRA 2H14A 4O2WA 5IJ7E 5K1CC 4D9SA 3DWLC 4MMZA 3C5MA 3GC3B 4J82A 4A7JA 3NIFA 3FCSA 4AN0A 4A09A 3MZLA 1GXRA 3V9FA 5H17A 5M61A 2GC4A 3QHYB 2J57G 4R7AB 3J81g 3I2NA 3GD1I 2AH0A 5M5SA 5EM2A 3I89A 4CI8A 4IRZA 4K3JB 4FB1D 3AL9A 4GQ1A 4J81A 1YFQA 4MK0B 1MG3A 1E8MA 1XIPA 2QZPA 2HJ4A 3IUNA 3IUJA 1GOFA 3O4HA 2CE9A 3EI2B 3I7LA 5FFGA 2IWKA 4JT6C 4ZN4A 4JSNC 5TEEA 2HKRA 4FAVD 5C9ZB 3OKYA 2H9NA 4J0WA 4RE6A 4IMMA 2J56H 4ZOVA 5FA5B 1MG2A 3SMRA 2CO0A 2I0RA 4FA5D 3IJ0A 1TBGA 4PXWA 3T3MA 2HU8A 3V5WB 5GMKn 3IURA 4BL0A 2EIEA 5CYKB 3MKSB 2HJBA 1XHMA 5HYNB 4BH6A 4Y7RA 1K8KC 5CXCB 1SQ9A 1U2VC 2B4EA 4HDJA 1OLZA 4JSXC 4CY1A 4L1MA 5FKRA 5H14A 3ULEC 2Q7QA 2P9LC 3IJEA 4CY5A 2Z2NA 3L4MD 3O4JA 4LG9A 3AL8B 3EQ7A 3N0EA 3IVMA 4O9DA 3RLMD 1K32A 2EIBA 4XEIC 3T3PA 3UKUC 5IT9g 1GOGA 4NBMA 1S4UX 4GM3A 3AFCA 4J73A 2UZXB 4NC4A 4ERQA 3BWSA 4O45A 4CI3A 1H2XA 3ZDYA 2H9LA 4AOWA 5EALA 3IJ1A 3B7FA 4ES0A 5FKTA 1UTCA 3SBQA 4CC9A 1YR2A 3CFSB 3OF7A 2EIDA 4DNWA 4PBYA 3UVKA 3NVQA 2VDPA 3I7PA 2IUVA 2B5LA 4AX4A 4ERYA 4UI9R 2HYEA 2VZ1A 1ERJA 2G99A 1N6EA 4NAAA 2VC2A 4O3TB 3I8CA 2XZGA 3P4FA 5HE3B 2Z2PA 1FWXA 2XDWA 2B5NA 5EAMA 4PSWB 3L4OD 1C9IA 5E6UA 5GXHA 3KCIA 3K6SA 4GGCA 4L9OA 3SBRA 5TF2A 1PBYB 3JROA 4QRJA 1JOFA 2EICA 4J84A 1QNIA 3JPXA 1B9XA 5CXCA 3U4YA 4X60B 4GGAA 4GMBA 2I0SA 3EMHA 4JHNA 3VI3A 2IURA 2PM6B 2CN2A 2H13A 2OK6A 4BUJC 3EI3A 3SLED 2EBSA 4G1EA 4H5JA 3PXSD 2G9AA 1O6FA 4GZ8A 5C2WB 3MZKA 4NENA 2P9IC 3EQ8A 3FM0A 4BCBA 4A08B 3MUNA 2AGWA 3W15A 2W18A 2TRCB 1QFMA 4RE5A 3NVNA 2P9NC 2IAAA 4H5IA 1Q47A 2HXCA 2YNPA 5THAA 2P9KC 4CZVA 4WK4A 1PEVA 2OIZA 3OL2B 3OKWA 3BG0A 2H9PA 3I7OA 3I7KA 2HKMA 5EMKB 2H3XA 2YNOA 4FA4D 2HU5A 2IWFA 3MVDK 4Y5RD 3V7DB 5JWZA 1PGUA 3EI4B 2XYIA 4O02A 4U1EI 5AFU3 4JHPC 4DNUA 4ESGA 3I8EA 4A0BB 5FQDA 4QQEA 2VDNA 3K71A 3NVXA 4AMYA 1PI6A 3SFZA 1OMWB 3JZNA 1VE6A 4J77A 5TEFA 3QI0A 3F3PA 4UM8A 3RFHA 4WJKA 3V4VA 5FFOA 1JMXB 2H68A 5IGQA 1JJUB 5CXBB 3SJLD 3F3FA 1RI6A 5AJAA 4X61B 3HFQA 4GM9A 4X3EA 3SBPA 2J55H 3ZDXA 1T2XA 1L5GA 2OVQB 1SHYB 1C9LA 3IULA 2BBKH 3VI4A 5M5TA 1B9YA 3UVMA 3J80g 5FKSA 1A12A 3OKTA 2H6KA 3UKRC 3JRPA 4X63B 2VDLA 3DM0A 3SXTD 4J87A 2BKLA 1JV2A 2CO0C 3ODTA 5C92A 4LG8A 4BCDA 1TYEA 4ZOXA 3IJCA 2PBIB 4GQ2P 3NIDA 5C2VB 2H9MA 5K19A 3PSLA 5EM2B 3V4PA 3VGZA 3EI1B 1BPOA 2YNNA 4A08A 2XE4A 5M5RA 3FGBA 5AMSA 4J79A 4N14A 3IIYA 4AEZA 1NR0A 5IC7A 3RFGA 5FXYA 4CI2A 4WK2A 2YBAA 4QAMA 3PSCB 4L1QD 4UM9A 1H2WA 1H2ZA 2CNXA 5HDBA 2H47A 2PM7B 2GC7A 3K26A 3OL2A 3EI2A 5I5JA 4QL1A 4O1QD 5EMMB 4FWWA 4JD2C 1MDAH 4OZUA 4ERZA 4O3UB 2Z2OA 5A2Qg 2AH1A 4BCCA 3JZHA 4JSVC 3EI4A 4E54B 3MMYA 4G55A 5M5VA 4A0BA 1R5MA 4Z7OA 4XYHA 4QT8A 5SXMA 2QC5A 1UOQA 4L3GD 5KDOB 5CYKA 2OJYA 1E8NA 3GFCA 1QFSA 3PXWD 5CXBA 2QR5A 3ORVD 4FA1D 2YB8B 3DDUA 4Z8LA 5E6RA 3JB9L 4GM8A 4Z7QA 2IUQA 4L3HD 4Z7NA 2VZ3A 2BCJB 1UOPA 3A0FA 3C75H 3JAMg 3NIGA 2MTAH 3AL8A 2AGXA 4AMZA 3JZGA 3CIKB 2AGLA 2GNQA 2P9UC 4BP8A 3O4GA 4MMYA 1H2YA 1U8CA 3PVWB 2HESX 5FKQA 3ZE1A 5GXIA 3SWSD 3DXKC 4J8GA 5EARA 3AH8B 3K72A 2H6QA
chains in the Genus database with same CATH topology
5E6RA 3VI3A 3ZDYA 3ZE2A 1TYEA 3NIDA 4Z7QA 2VC2A 2VDKA 4IRZA 4MMXA 2VDQA 4Z7NA 5E6SA 3V4PA 3FCUA 3NIGA 2VDMA 3ZDXA 4Z7OA 1L5GA 4G1EA 3IJEA 4O02A 3ZDZA 5FFGA 4MMZA 3VI4A 3ZE0A 3NIFA 5E6UA 4WK0A 3T3MA 4NENA 2VDRA 3K6SA 4WK2A 3FCSA 4MMYA 2VDNA 4UM9A 3K71A 1U8CA 2VDPA 3ZE1A 2VDLA 5HDBA 1M1XA 3T3PA 4G1MA 2VDOA 1JV2A 4UM8A 4WK4A 4WJKA 3V4VA 3K72A 5FFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6R A;  3VI3 A;  3ZDY A;  3ZE2 A;  1TYE A;  3NID A;  4Z7Q A;  2VC2 A;  2VDK A;  4IRZ A;  4MMX A;  2VDQ A;  4Z7N A;  5E6S A;  3V4P A;  3FCU A;  3NIG A;  2VDM A;  3ZDX A;  4Z7O A;  1L5G A;  4G1E A;  3IJE A;  4O02 A;  3ZDZ A;  5FFG A;  4MMZ A;  3VI4 A;  3ZE0 A;  3NIF A;  5E6U A;  4WK0 A;  3T3M A;  4NEN A;  2VDR A;  3K6S A;  4WK2 A;  3FCS A;  4MMY A;  2VDN A;  4UM9 A;  3K71 A;  1U8C A;  2VDP A;  3ZE1 A;  2VDL A;  5HDB A;  1M1X A;  3T3P A;  4G1M A;  2VDO A;  1JV2 A;  4UM8 A;  4WK4 A;  4WJK A;  3V4V A;  3K72 A;  5FFO A; 
#chains in the Genus database with same CATH topology
 3EI1 A;  3BG1 A;  3ZE2 A;  1JTD B;  3EU7 A;  2VDK A;  4MMX A;  4DNV A;  4A11 B;  2CN3 A;  1O6G A;  2YMU A;  3UVL A;  1GP2 B;  5B4W A;  3OTT A;  1NEX B;  3C9C A;  5EML B;  3EQ9 A;  4XYI A;  3IUQ A;  4A2M A;  5C86 A;  4PC0 A;  3K27 A;  3SCY A;  3SVW D;  2VDO A;  4K3I D;  2O9K A;  1SQJ A;  3E0C A;  2I0T A;  4ZOY A;  2PM9 B;  3FCU A;  2OVP B;  3I7N A;  4G56 B;  4E54 A;  3F3G A;  2XU7 A;  3UVN A;  3ZWL B;  1VE7 A;  5HQG A;  3PE7 A;  4E5Z B;  2AGZ A;  2B5M A;  5IGO A;  4D6V A;  1GG2 B;  5M5U A;  2VDM A;  4PBZ A;  4CZX A;  2WQ8 A;  2AQ5 A;  2I3T A;  5I5M A;  4A0A B;  5EAP A;  4GGD A;  3RN0 D;  4PNK B;  5HE2 B;  4CY2 A;  2HU7 A;  1N6D A;  4J0X A;  1E5T A;  3PVU B;  4YVD A;  2XL3 A;  3IUM A;  3CFV A;  4PSX B;  3SN6 B;  4J86 A;  4A09 B;  1VZ2 A;  2I3S A;  2QXV A;  3MXX A;  3RRM C;  3MKQ A;  3C99 A;  4IA9 A;  3KRX B;  3OW8 A;  4JXM A;  4JT5 C;  5TDH B;  4J8B A;  1JMZ B;  4I79 A;  2JKX A;  2IUP A;  1VYH C;  3EWE A;  1VZ3 A;  5HE0 B;  3EI3 B;  3EG6 A;  3DSM A;  4JSP C;  4TZ4 A;  1TYQ C;  2OK4 A;  3FRX A;  5HE1 B;  3ZDZ A;  4FAN D;  4FHL A;  3DXM C;  3ZE0 A;  5GSA A;  2OVR B;  4D0K A;  4CI1 A;  1P22 A;  4LGN A;  3SHF A;  4G1M A;  1N6F A;  2P9P C;  3UVO A;  1GOH A;  3GRE A;  5H1M A;  1UOO A;  4A11 A;  4AN1 A;  4NSX A;  1U4C A;  2AGY A;  4KFM B;  3O4I A;  3UR4 A;  3IIW A;  4U7A A;  1GOT B;  5E6S A;  3RMZ D;  3RSE C;  3RN1 D;  3PXT D;  3OKY B;  3VA6 A;  3MUO A;  4OWR A;  2CE8 A;  4WK0 A;  3VH0 A;  2XL2 A;  3KRW B;  2VDR A;  4GQB B;  4A2L A;  4CZY A;  1I2M B;  4CY3 A;  4FA9 D;  3N0D A;  2UZY B;  1M1X A;  2PM9 A;  3IKO A;  5FLX g;  5EMJ B;  4J78 A;  4BP9 A;  5I5I A;  1XKS A;  4E5Z A;  2P9S C;  1K3I A;  3I7H A;  4ZOZ A;  2H6N A;  4A0A A;  5IJ8 E;  1A0R B;  2VDQ A;  1L0Q A;  4EWR A;  2H14 A;  4O2W A;  5IJ7 E;  5K1C C;  4D9S A;  3DWL C;  4MMZ A;  3C5M A;  3GC3 B;  4J82 A;  4A7J A;  3NIF A;  3FCS A;  4AN0 A;  4A09 A;  3MZL A;  1GXR A;  3V9F A;  5H17 A;  5M61 A;  2GC4 A;  3QHY B;  2J57 G;  4R7A B;  3J81 g;  3I2N A;  3GD1 I;  2AH0 A;  5M5S A;  5EM2 A;  3I89 A;  4CI8 A;  4IRZ A;  4K3J B;  4FB1 D;  3AL9 A;  4GQ1 A;  4J81 A;  1YFQ A;  4MK0 B;  1MG3 A;  1E8M A;  1XIP A;  2QZP A;  2HJ4 A;  3IUN A;  3IUJ A;  1GOF A;  3O4H A;  2CE9 A;  3EI2 B;  3I7L A;  5FFG A;  2IWK A;  4JT6 C;  4ZN4 A;  4JSN C;  5TEE A;  2HKR A;  4FAV D;  5C9Z B;  3OKY A;  2H9N A;  4J0W A;  4RE6 A;  4IMM A;  2J56 H;  4ZOV A;  5FA5 B;  1MG2 A;  3SMR A;  2CO0 A;  2I0R A;  4FA5 D;  3IJ0 A;  1TBG A;  4PXW A;  3T3M A;  2HU8 A;  3V5W B;  5GMK n;  3IUR A;  4BL0 A;  2EIE A;  5CYK B;  3MKS B;  2HJB A;  1XHM A;  5HYN B;  4BH6 A;  4Y7R A;  1K8K C;  5CXC B;  1SQ9 A;  1U2V C;  2B4E A;  4HDJ A;  1OLZ A;  4JSX C;  4CY1 A;  4L1M A;  5FKR A;  5H14 A;  3ULE C;  2Q7Q A;  2P9L C;  3IJE A;  4CY5 A;  2Z2N A;  3L4M D;  3O4J A;  4LG9 A;  3AL8 B;  3EQ7 A;  3N0E A;  3IVM A;  4O9D A;  3RLM D;  1K32 A;  2EIB A;  4XEI C;  3T3P A;  3UKU C;  5IT9 g;  1GOG A;  4NBM A;  1S4U X;  4GM3 A;  3AFC A;  4J73 A;  2UZX B;  4NC4 A;  4ERQ A;  3BWS A;  4O45 A;  4CI3 A;  1H2X A;  3ZDY A;  2H9L A;  4AOW A;  5EAL A;  3IJ1 A;  3B7F A;  4ES0 A;  5FKT A;  1UTC A;  3SBQ A;  4CC9 A;  1YR2 A;  3CFS B;  3OF7 A;  2EID A;  4DNW A;  4PBY A;  3UVK A;  3NVQ A;  2VDP A;  3I7P A;  2IUV A;  2B5L A;  4AX4 A;  4ERY A;  4UI9 R;  2HYE A;  2VZ1 A;  1ERJ A;  2G99 A;  1N6E A;  4NAA A;  2VC2 A;  4O3T B;  3I8C A;  2XZG A;  3P4F A;  5HE3 B;  2Z2P A;  1FWX A;  2XDW A;  2B5N A;  5EAM A;  4PSW B;  3L4O D;  1C9I A;  5E6U A;  5GXH A;  3KCI A;  3K6S A;  4GGC A;  4L9O A;  3SBR A;  5TF2 A;  1PBY B;  3JRO A;  4QRJ A;  1JOF A;  2EIC A;  4J84 A;  1QNI A;  3JPX A;  1B9X A;  5CXC A;  3U4Y A;  4X60 B;  4GGA A;  4GMB A;  2I0S A;  3EMH A;  4JHN A;  3VI3 A;  2IUR A;  2PM6 B;  2CN2 A;  2H13 A;  2OK6 A;  4BUJ C;  3EI3 A;  3SLE D;  2EBS A;  4G1E A;  4H5J A;  3PXS D;  2G9A A;  1O6F A;  4GZ8 A;  5C2W B;  3MZK A;  4NEN A;  2P9I C;  3EQ8 A;  3FM0 A;  4BCB A;  4A08 B;  3MUN A;  2AGW A;  3W15 A;  2W18 A;  2TRC B;  1QFM A;  4RE5 A;  3NVN A;  2P9N C;  2IAA A;  4H5I A;  1Q47 A;  2HXC A;  2YNP A;  5THA A;  2P9K C;  4CZV A;  4WK4 A;  1PEV A;  2OIZ A;  3OL2 B;  3OKW A;  3BG0 A;  2H9P A;  3I7O A;  3I7K A;  2HKM A;  5EMK B;  2H3X A;  2YNO A;  4FA4 D;  2HU5 A;  2IWF A;  3MVD K;  4Y5R D;  3V7D B;  5JWZ A;  1PGU A;  3EI4 B;  2XYI A;  4O02 A;  4U1E I;  5AFU 3;  4JHP C;  4DNU A;  4ESG A;  3I8E A;  4A0B B;  5FQD A;  4QQE A;  2VDN A;  3K71 A;  3NVX A;  4AMY A;  1PI6 A;  3SFZ A;  1OMW B;  3JZN A;  1VE6 A;  4J77 A;  5TEF A;  3QI0 A;  3F3P A;  4UM8 A;  3RFH A;  4WJK A;  3V4V A;  5FFO A;  1JMX B;  2H68 A;  5IGQ A;  1JJU B;  5CXB B;  3SJL D;  3F3F A;  1RI6 A;  5AJA A;  4X61 B;  3HFQ A;  4GM9 A;  4X3E A;  3SBP A;  2J55 H;  3ZDX A;  1T2X A;  1L5G A;  2OVQ B;  1SHY B;  1C9L A;  3IUL A;  2BBK H;  3VI4 A;  5M5T A;  1B9Y A;  3UVM A;  3J80 g;  5FKS A;  1A12 A;  3OKT A;  2H6K A;  3UKR C;  3JRP A;  4X63 B;  2VDL A;  3DM0 A;  3SXT D;  4J87 A;  2BKL A;  1JV2 A;  2CO0 C;  3ODT A;  5C92 A;  4LG8 A;  4BCD A;  1TYE A;  4ZOX A;  3IJC A;  2PBI B;  4GQ2 P;  3NID A;  5C2V B;  2H9M A;  5K19 A;  3PSL A;  5EM2 B;  3V4P A;  3VGZ A;  3EI1 B;  1BPO A;  2YNN A;  4A08 A;  2XE4 A;  5M5R A;  3FGB A;  5AMS A;  4J79 A;  4N14 A;  3IIY A;  4AEZ A;  1NR0 A;  5IC7 A;  3RFG A;  5FXY A;  4CI2 A;  4WK2 A;  2YBA A;  4QAM A;  3PSC B;  4L1Q D;  4UM9 A;  1H2W A;  1H2Z A;  2CNX A;  5HDB A;  2H47 A;  2PM7 B;  2GC7 A;  3K26 A;  3OL2 A;  3EI2 A;  5I5J A;  4QL1 A;  4O1Q D;  5EMM B;  4FWW A;  4JD2 C;  1MDA H;  4OZU A;  4ERZ A;  4O3U B;  2Z2O A;  5A2Q g;  2AH1 A;  4BCC A;  3JZH A;  4JSV C;  3EI4 A;  4E54 B;  3MMY A;  4G55 A;  5M5V A;  4A0B A;  1R5M A;  4Z7O A;  4XYH A;  4QT8 A;  5SXM A;  2QC5 A;  1UOQ A;  4L3G D;  5KDO B;  5CYK A;  2OJY A;  1E8N A;  3GFC A;  1QFS A;  3PXW D;  5CXB A;  2QR5 A;  3ORV D;  4FA1 D;  2YB8 B;  3DDU A;  4Z8L A;  5E6R A;  3JB9 L;  4GM8 A;  4Z7Q A;  2IUQ A;  4L3H D;  4Z7N A;  2VZ3 A;  2BCJ B;  1UOP A;  3A0F A;  3C75 H;  3JAM g;  3NIG A;  2MTA H;  3AL8 A;  2AGX A;  4AMZ A;  3JZG A;  3CIK B;  2AGL A;  2GNQ A;  2P9U C;  4BP8 A;  3O4G A;  4MMY A;  1H2Y A;  1U8C A;  3PVW B;  2HES X;  5FKQ A;  3ZE1 A;  5GXI A;  3SWS D;  3DXK C;  4J8G A;  5EAR A;  3AH8 B;  3K72 A;  2H6Q A; 
#chains in the Genus database with same CATH homology
 5E6R A;  3VI3 A;  3ZDY A;  3ZE2 A;  1TYE A;  3NID A;  4Z7Q A;  2VC2 A;  2VDK A;  4IRZ A;  4MMX A;  2VDQ A;  4Z7N A;  5E6S A;  3V4P A;  3FCU A;  3NIG A;  2VDM A;  3ZDX A;  4Z7O A;  1L5G A;  4G1E A;  3IJE A;  4O02 A;  3ZDZ A;  5FFG A;  4MMZ A;  3VI4 A;  3ZE0 A;  3NIF A;  5E6U A;  4WK0 A;  3T3M A;  4NEN A;  2VDR A;  3K6S A;  4WK2 A;  3FCS A;  4MMY A;  2VDN A;  4UM9 A;  3K71 A;  1U8C A;  2VDP A;  3ZE1 A;  2VDL A;  5HDB A;  1M1X A;  3T3P A;  4G1M A;  2VDO A;  1JV2 A;  4UM8 A;  4WK4 A;  4WJK A;  3V4V A;  3K72 A;  5FFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...