2VDKA

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdkA00
1JV2A 4WK4A 2VDKA 4UM8A 3NIDA 1U8CA 2VDOA 4G1MA 4Z7QA 5E6RA 4MMXA 3K71A 4Z7NA 3K72A 2VDLA 4O02A 4NENA 5E6SA 2VDNA 5HDBA 3T3MA 2VC2A 5FFGA 3VI3A 4G1EA 3V4VA 3ZDYA 3ZE1A 3NIGA 4WK0A 2VDPA 3VI4A 4UM9A 4MMYA 4WJKA 4MMZA 1TYEA 4WK2A 3V4PA 2VDRA 3ZE0A 4Z7OA 3T3PA 1M1XA 2VDMA 4IRZA 2VDQA 3FCUA 3NIFA 5E6UA 3ZDXA 3ZDZA 3K6SA 1L5GA 5FFOA 3FCSA 3ZE2A 3IJEA
chains in the Genus database with same CATH superfamily
3SN6B 4CI3A 1VZ2A 3SBPA 5IGQA 3RFGA 2P9SC 2H9MA 3EG6A 2HJBA 4O1QD 3C99A 5EM2B 3IJ1A 4D6VA 3B7FA 3PE7A 4A08A 2VDNA 5FFGA 1QNIA 1VE7A 5CXCB 4J84A 3V7DB 4CI2A 4GM8A 5FKQA 4WK0A 2I0SA 4J0WA 4CY3A 4PC0A 3JROA 5I5MA 4A0BB 4GQBB 2H3XA 4CC9A 4EWRA 3EI3A 3N0EA 3GC3B 3O4GA 4PXWA 3EI4A 2Z2PA 4TZ4A 2VDOA 5I5IA 4A0BA 3I7LA 4FAVD 4O3UB 2PM6B 4ZOVA 4FB1D 3I8CA 5K1CC 3E0CA 2AGYA 5EMLB 5M5TA 3JZGA 4GGCA 2IWFA 3EU7A 4ESGA 4A2LA 4UM9A 3KRXB 3ZE0A 4O2WA 4CZVA 3QHYB 3UVMA 1FWXA 3KCIA 3OL2A 5GXIA 5M5SA 4HDJA 2PM9B 1JMXB 4OWRA 3SLED 5SXMA 1GOTB 3MUOA 3GREA 4BL0A 2OIZA 3UKRC 1GOFA 4U7AA 2AGLA 5HQGA 2J55H 2VDLA 5HDBA 3HFQA 1SQJA 4AOWA 4O9DA 2OK4A 3I7KA 1OMWB 4GQ2P 2P9PC 2PBIB 3EI2A 3K26A 4D9SA 2G9AA 3EI3B 4JD2C 3IJCA 4MK0B 3AH8B 1NEXB 2AH0A 4H5IA 4LG9A 4BH6A 3MKSB 2XL3A 4J78A 4J8GA 2B5NA 1MG3A 1O6GA 4GM9A 1XKSA 4Y5RD 3RFHA 2I3SA 3ZWLB 5C2VB 4G1MA 1GG2B 2YNPA 3BG0A 4IA9A 5HE2B 4JHNA 2BKLA 3I7HA 3I7PA 4QQEA 4MMYA 4NBMA 3JB9L 2OJYA 3N0DA 4PBYA 3EQ7A 1L5GA 4L3HD 4OZUA 3SBRA 3IJEA 3IULA 5IT9g 2HU8A 4XEIC 4AX4A 3AL9A 3MZKA 5FA5B 2H13A 4GZ8A 3NIDA 5K19A 3IIWA 4MMXA 3W15A 4DNWA 4J82A 4JT5C 1P22A 3RSEC 4J81A 2OK6A 3V5WB 3SJLD 2VDPA 1U4CA 3VI4A 1E5TA 1E8NA 2H14A 3C9CA 2P9NC 3GFCA 5I5JA 5THAA 3BWSA 3FCSA 3GD1I 5FXYA 2J56H 4GMBA 1VE6A 3UKUC 4FA9D 1SHYB 2HJ4A 2I3TA 3SVWD 3K71A 3PXTD 1B9YA 3PSCB 2VC2A 3VI3A 3V4VA 1C9LA 3IVMA 5EALA 5EMKB 3I2NA 3OKYB 1JTDB 2YB8B 4R7AB 1TYEA 2CE9A 1OLZA 3IUNA 5M5UA 3JZHA 3EI1B 1NR0A 2BBKH 4IRZA 2VDQA 2IUPA 3VH0A 3QI0A 2B4EA 4JSNC 5FLXg 3L4MD 4KFMB 2PM9A 1XIPA 3I8EA 4AMZA 3I7OA 1UOPA 4J77A 3MXXA 3NVXA 3OKTA 4E54A 4L1MA 2HKMA 4AN0A 3AL8A 4GQ1A 2I0TA 2QZPA 4NENA 4JSVC 3DXKC 5GSAA 3DM0A 4CZXA 4X3EA 3EQ9A 3MVDK 1VYHC 3MZLA 2QXVA 4E5ZB 1T2XA 3RN1D 4MMZA 3SMRA 2XDWA 2VDRA 4Z7OA 1RI6A 2Z2OA 3ZE2A 5IJ7E 5AMSA 4L1QD 5AJAA 3UVLA 3MUNA 5B4WA 2B5LA 5AFU3 4J0XA 1R5MA 2AGZA 2P9LC 3BG1A 3OL2B 3ODTA 2XZGA 4PSWB 1GOGA 4NC4A 1A12A 4JXMA 2WQ8A 5H17A 5EMJB 3IUMA 2J57G 4NSXA 3PVWB 4YVDA 2H68A 3J80g 3EQ8A 4RE6A 4A09B 3SBQA 4ERZA 2GNQA 4A7JA 3NVQA 5A2Qg 4XYHA 3SWSD 3SXTD 5CYKB 4AMYA 1UOQA 2CNXA 2HU7A 5C86A 1C9IA 4E54B 1E8MA 2IAAA 4J86A 2Q7QA 4O3TB 2GC7A 4GGDA 5FKSA 2AGWA 2YNOA 4CY2A 2BCJB 4DNUA 4A2MA 2IWKA 4CZYA 4K3ID 1UOOA 2CO0C 2VDMA 3NIFA 2H9LA 4ZOXA 3A0FA 4I79A 3NVNA 4A11A 4CY5A 3UVKA 1U2VC 1PGUA 1K3IA 1O6FA 3DDUA 4FA1D 4JSPC 4Z7NA 1UTCA 2UZYB 1B9XA 2AQ5A 3T3MA 2CN2A 5M5RA 3CFSB 3JRPA 1JOFA 3C5MA 2HKRA 3NIGA 3OKWA 5IC7A 1PBYB 3F3PA 5GMKn 3I89A 3O4IA 3CIKB 4D0KA 3OKYA 1VZ3A 5FQDA 3UVOA 3T3PA 2XE4A 3PXSD 4L3GD 3F3FA 2AGXA 3PSLA 1QFSA 5TEFA 5CYKA 2EIBA 3FRXA 2H47A 2YMUA 4A0AA 1JMZB 2VZ1A 2MTAH 2CN3A 3O4HA 5CXBB 4QRJA 1K32A 4FWWA 4ZOYA 1GXRA 4GM3A 4LG8A 4X63B 1A0RB 4E5ZA 1GP2B 3AFCA 2H9PA 2AH1A 5EM2A 5EMMB 2O9KA 3RLMD 4A08B 5E6UA 3ORVD 3ZDZA 1YR2A 4QAMA 4BP9A 2OVPB 5HE0B 3RN0D 5TF2A 3RMZD 5H1MA 4JT6C 3P4FA 2H6KA 4FAND 4X60B 3IKOA 4AN1A 2P9KC 4PSXB 1N6DA 5C92A 4O02A 5EAPA 2B5MA 2TRCB 4IMMA 4CY1A 3PXWD 5TEEA 1GOHA 2GC4A 3EMHA 5H14A 5EARA 4BUJC 5M5VA 4DNVA 2CE8A 1M1XA 2Z2NA 3J81g 3AL8B 2IUQA 4BCCA 3IJ0A 2H6NA 4PNKB 5HYNB 4A09A 4BCDA 2QC5A 2JKXA 4A0AB 4BCBA 5HE1B 1JJUB 3U4YA 1BPOA 5TDHB 1N6EA 5E6RA 5E6SA 1PEVA 2IURA 2W18A 2OVQB 4UI9R 5C9ZB 4G1EA 3F3GA 4JHPC 3ZE1A 4AEZA 4BP8A 4XYIA 4ZOZA 2EICA 2EIEA 1PI6A 4ERQA 2HXCA 4WJKA 4CI1A 3JAMg 1YFQA 3EWEA 1Q47A 4FA4D 4ERYA 2QR5A 5IGOA 3V9FA 4U1EI 3VA6A 2YBAA 2UZXB 3PVUB 4H5JA 4L9OA 4N14A 3JPXA 3EI4B 4A11B 1TBGA 1I2MB 1U8CA 3UVNA 4CI8A 5KDOB 1MDAH 1H2XA 3MKQA 4J8BA 3KRWB 3FM0A 5FKRA 4O45A 2XU7A 3K27A 3O4JA 2G99A 2H6QA 3DWLC 1H2WA 2IUVA 2HYEA 1H2ZA 2I0RA 2XYIA 5C2WB 4RE5A 2HESX 3MMYA 4QL1A 4ES0A 3DXMC 5M61A 5IJ8E 3SCYA 3EI1A 3L4OD 1TYQC 2YNNA 4FHLA 4J79A 3UR4A 4NAAA 4J73A 5JWZA 2VDKA 1H2YA 2HU5A 1N6FA 3C75H 3K72A 2CO0A 4X61B 4G56B 5CXCA 3SHFA 3JZNA 3OF7A 3ZDYA 1L0QA 2PM7B 3IIYA 2VZ3A 2P9UC 4GGAA 4Y7RA 3EI2B 2XL2A 3SFZA 3IUJA 5HE3B 3FCUA 3ZDXA 3ULEC 1QFMA 1MG2A 4K3JB 1JV2A 4WK4A 5GXHA 3DSMA 3VGZA 1K8KC 4PBZA 4LGNA 2OVRB 4J87A 1ERJA 2H9NA 4UM8A 4Z7QA 4JSXC 4G55A 2EIDA 5EAMA 2EBSA 2P9IC 3IURA 1S4UX 3RRMC 4ZN4A 4QT8A 4Z8LA 3FGBA 3OW8A 5FKTA 3CFVA 3OTTA 3IUQA 4WK2A 3V4PA 3I7NA 4FA5D 1SQ9A 3K6SA 5CXBA 5FFOA 1XHMA
chains in the Genus database with same CATH topology
1JV2A 4WK4A 2VDKA 4UM8A 3NIDA 1U8CA 2VDOA 4G1MA 4Z7QA 5E6RA 4MMXA 3K71A 4Z7NA 3K72A 2VDLA 4O02A 4NENA 5E6SA 2VDNA 5HDBA 3T3MA 2VC2A 5FFGA 3VI3A 4G1EA 3V4VA 3ZDYA 3ZE1A 3NIGA 4WK0A 2VDPA 3VI4A 4UM9A 4MMYA 4WJKA 4MMZA 1TYEA 4WK2A 3V4PA 2VDRA 3ZE0A 4Z7OA 3T3PA 1M1XA 2VDMA 4IRZA 2VDQA 3FCUA 3NIFA 5E6UA 3ZDXA 3ZDZA 3K6SA 1L5GA 5FFOA 3FCSA 3ZE2A 3IJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JV2 A;  4WK4 A;  2VDK A;  4UM8 A;  3NID A;  1U8C A;  2VDO A;  4G1M A;  4Z7Q A;  5E6R A;  4MMX A;  3K71 A;  4Z7N A;  3K72 A;  2VDL A;  4O02 A;  4NEN A;  5E6S A;  2VDN A;  5HDB A;  3T3M A;  2VC2 A;  5FFG A;  3VI3 A;  4G1E A;  3V4V A;  3ZDY A;  3ZE1 A;  3NIG A;  4WK0 A;  2VDP A;  3VI4 A;  4UM9 A;  4MMY A;  4WJK A;  4MMZ A;  1TYE A;  4WK2 A;  3V4P A;  2VDR A;  3ZE0 A;  4Z7O A;  3T3P A;  1M1X A;  2VDM A;  4IRZ A;  2VDQ A;  3FCU A;  3NIF A;  5E6U A;  3ZDX A;  3ZDZ A;  3K6S A;  1L5G A;  5FFO A;  3FCS A;  3ZE2 A;  3IJE A; 
#chains in the Genus database with same CATH topology
 3SN6 B;  4CI3 A;  1VZ2 A;  3SBP A;  5IGQ A;  3RFG A;  2P9S C;  2H9M A;  3EG6 A;  2HJB A;  4O1Q D;  3C99 A;  5EM2 B;  3IJ1 A;  4D6V A;  3B7F A;  3PE7 A;  4A08 A;  2VDN A;  5FFG A;  1QNI A;  1VE7 A;  5CXC B;  4J84 A;  3V7D B;  4CI2 A;  4GM8 A;  5FKQ A;  4WK0 A;  2I0S A;  4J0W A;  4CY3 A;  4PC0 A;  3JRO A;  5I5M A;  4A0B B;  4GQB B;  2H3X A;  4CC9 A;  4EWR A;  3EI3 A;  3N0E A;  3GC3 B;  3O4G A;  4PXW A;  3EI4 A;  2Z2P A;  4TZ4 A;  2VDO A;  5I5I A;  4A0B A;  3I7L A;  4FAV D;  4O3U B;  2PM6 B;  4ZOV A;  4FB1 D;  3I8C A;  5K1C C;  3E0C A;  2AGY A;  5EML B;  5M5T A;  3JZG A;  4GGC A;  2IWF A;  3EU7 A;  4ESG A;  4A2L A;  4UM9 A;  3KRX B;  3ZE0 A;  4O2W A;  4CZV A;  3QHY B;  3UVM A;  1FWX A;  3KCI A;  3OL2 A;  5GXI A;  5M5S A;  4HDJ A;  2PM9 B;  1JMX B;  4OWR A;  3SLE D;  5SXM A;  1GOT B;  3MUO A;  3GRE A;  4BL0 A;  2OIZ A;  3UKR C;  1GOF A;  4U7A A;  2AGL A;  5HQG A;  2J55 H;  2VDL A;  5HDB A;  3HFQ A;  1SQJ A;  4AOW A;  4O9D A;  2OK4 A;  3I7K A;  1OMW B;  4GQ2 P;  2P9P C;  2PBI B;  3EI2 A;  3K26 A;  4D9S A;  2G9A A;  3EI3 B;  4JD2 C;  3IJC A;  4MK0 B;  3AH8 B;  1NEX B;  2AH0 A;  4H5I A;  4LG9 A;  4BH6 A;  3MKS B;  2XL3 A;  4J78 A;  4J8G A;  2B5N A;  1MG3 A;  1O6G A;  4GM9 A;  1XKS A;  4Y5R D;  3RFH A;  2I3S A;  3ZWL B;  5C2V B;  4G1M A;  1GG2 B;  2YNP A;  3BG0 A;  4IA9 A;  5HE2 B;  4JHN A;  2BKL A;  3I7H A;  3I7P A;  4QQE A;  4MMY A;  4NBM A;  3JB9 L;  2OJY A;  3N0D A;  4PBY A;  3EQ7 A;  1L5G A;  4L3H D;  4OZU A;  3SBR A;  3IJE A;  3IUL A;  5IT9 g;  2HU8 A;  4XEI C;  4AX4 A;  3AL9 A;  3MZK A;  5FA5 B;  2H13 A;  4GZ8 A;  3NID A;  5K19 A;  3IIW A;  4MMX A;  3W15 A;  4DNW A;  4J82 A;  4JT5 C;  1P22 A;  3RSE C;  4J81 A;  2OK6 A;  3V5W B;  3SJL D;  2VDP A;  1U4C A;  3VI4 A;  1E5T A;  1E8N A;  2H14 A;  3C9C A;  2P9N C;  3GFC A;  5I5J A;  5THA A;  3BWS A;  3FCS A;  3GD1 I;  5FXY A;  2J56 H;  4GMB A;  1VE6 A;  3UKU C;  4FA9 D;  1SHY B;  2HJ4 A;  2I3T A;  3SVW D;  3K71 A;  3PXT D;  1B9Y A;  3PSC B;  2VC2 A;  3VI3 A;  3V4V A;  1C9L A;  3IVM A;  5EAL A;  5EMK B;  3I2N A;  3OKY B;  1JTD B;  2YB8 B;  4R7A B;  1TYE A;  2CE9 A;  1OLZ A;  3IUN A;  5M5U A;  3JZH A;  3EI1 B;  1NR0 A;  2BBK H;  4IRZ A;  2VDQ A;  2IUP A;  3VH0 A;  3QI0 A;  2B4E A;  4JSN C;  5FLX g;  3L4M D;  4KFM B;  2PM9 A;  1XIP A;  3I8E A;  4AMZ A;  3I7O A;  1UOP A;  4J77 A;  3MXX A;  3NVX A;  3OKT A;  4E54 A;  4L1M A;  2HKM A;  4AN0 A;  3AL8 A;  4GQ1 A;  2I0T A;  2QZP A;  4NEN A;  4JSV C;  3DXK C;  5GSA A;  3DM0 A;  4CZX A;  4X3E A;  3EQ9 A;  3MVD K;  1VYH C;  3MZL A;  2QXV A;  4E5Z B;  1T2X A;  3RN1 D;  4MMZ A;  3SMR A;  2XDW A;  2VDR A;  4Z7O A;  1RI6 A;  2Z2O A;  3ZE2 A;  5IJ7 E;  5AMS A;  4L1Q D;  5AJA A;  3UVL A;  3MUN A;  5B4W A;  2B5L A;  5AFU 3;  4J0X A;  1R5M A;  2AGZ A;  2P9L C;  3BG1 A;  3OL2 B;  3ODT A;  2XZG A;  4PSW B;  1GOG A;  4NC4 A;  1A12 A;  4JXM A;  2WQ8 A;  5H17 A;  5EMJ B;  3IUM A;  2J57 G;  4NSX A;  3PVW B;  4YVD A;  2H68 A;  3J80 g;  3EQ8 A;  4RE6 A;  4A09 B;  3SBQ A;  4ERZ A;  2GNQ A;  4A7J A;  3NVQ A;  5A2Q g;  4XYH A;  3SWS D;  3SXT D;  5CYK B;  4AMY A;  1UOQ A;  2CNX A;  2HU7 A;  5C86 A;  1C9I A;  4E54 B;  1E8M A;  2IAA A;  4J86 A;  2Q7Q A;  4O3T B;  2GC7 A;  4GGD A;  5FKS A;  2AGW A;  2YNO A;  4CY2 A;  2BCJ B;  4DNU A;  4A2M A;  2IWK A;  4CZY A;  4K3I D;  1UOO A;  2CO0 C;  2VDM A;  3NIF A;  2H9L A;  4ZOX A;  3A0F A;  4I79 A;  3NVN A;  4A11 A;  4CY5 A;  3UVK A;  1U2V C;  1PGU A;  1K3I A;  1O6F A;  3DDU A;  4FA1 D;  4JSP C;  4Z7N A;  1UTC A;  2UZY B;  1B9X A;  2AQ5 A;  3T3M A;  2CN2 A;  5M5R A;  3CFS B;  3JRP A;  1JOF A;  3C5M A;  2HKR A;  3NIG A;  3OKW A;  5IC7 A;  1PBY B;  3F3P A;  5GMK n;  3I89 A;  3O4I A;  3CIK B;  4D0K A;  3OKY A;  1VZ3 A;  5FQD A;  3UVO A;  3T3P A;  2XE4 A;  3PXS D;  4L3G D;  3F3F A;  2AGX A;  3PSL A;  1QFS A;  5TEF A;  5CYK A;  2EIB A;  3FRX A;  2H47 A;  2YMU A;  4A0A A;  1JMZ B;  2VZ1 A;  2MTA H;  2CN3 A;  3O4H A;  5CXB B;  4QRJ A;  1K32 A;  4FWW A;  4ZOY A;  1GXR A;  4GM3 A;  4LG8 A;  4X63 B;  1A0R B;  4E5Z A;  1GP2 B;  3AFC A;  2H9P A;  2AH1 A;  5EM2 A;  5EMM B;  2O9K A;  3RLM D;  4A08 B;  5E6U A;  3ORV D;  3ZDZ A;  1YR2 A;  4QAM A;  4BP9 A;  2OVP B;  5HE0 B;  3RN0 D;  5TF2 A;  3RMZ D;  5H1M A;  4JT6 C;  3P4F A;  2H6K A;  4FAN D;  4X60 B;  3IKO A;  4AN1 A;  2P9K C;  4PSX B;  1N6D A;  5C92 A;  4O02 A;  5EAP A;  2B5M A;  2TRC B;  4IMM A;  4CY1 A;  3PXW D;  5TEE A;  1GOH A;  2GC4 A;  3EMH A;  5H14 A;  5EAR A;  4BUJ C;  5M5V A;  4DNV A;  2CE8 A;  1M1X A;  2Z2N A;  3J81 g;  3AL8 B;  2IUQ A;  4BCC A;  3IJ0 A;  2H6N A;  4PNK B;  5HYN B;  4A09 A;  4BCD A;  2QC5 A;  2JKX A;  4A0A B;  4BCB A;  5HE1 B;  1JJU B;  3U4Y A;  1BPO A;  5TDH B;  1N6E A;  5E6R A;  5E6S A;  1PEV A;  2IUR A;  2W18 A;  2OVQ B;  4UI9 R;  5C9Z B;  4G1E A;  3F3G A;  4JHP C;  3ZE1 A;  4AEZ A;  4BP8 A;  4XYI A;  4ZOZ A;  2EIC A;  2EIE A;  1PI6 A;  4ERQ A;  2HXC A;  4WJK A;  4CI1 A;  3JAM g;  1YFQ A;  3EWE A;  1Q47 A;  4FA4 D;  4ERY A;  2QR5 A;  5IGO A;  3V9F A;  4U1E I;  3VA6 A;  2YBA A;  2UZX B;  3PVU B;  4H5J A;  4L9O A;  4N14 A;  3JPX A;  3EI4 B;  4A11 B;  1TBG A;  1I2M B;  1U8C A;  3UVN A;  4CI8 A;  5KDO B;  1MDA H;  1H2X A;  3MKQ A;  4J8B A;  3KRW B;  3FM0 A;  5FKR A;  4O45 A;  2XU7 A;  3K27 A;  3O4J A;  2G99 A;  2H6Q A;  3DWL C;  1H2W A;  2IUV A;  2HYE A;  1H2Z A;  2I0R A;  2XYI A;  5C2W B;  4RE5 A;  2HES X;  3MMY A;  4QL1 A;  4ES0 A;  3DXM C;  5M61 A;  5IJ8 E;  3SCY A;  3EI1 A;  3L4O D;  1TYQ C;  2YNN A;  4FHL A;  4J79 A;  3UR4 A;  4NAA A;  4J73 A;  5JWZ A;  2VDK A;  1H2Y A;  2HU5 A;  1N6F A;  3C75 H;  3K72 A;  2CO0 A;  4X61 B;  4G56 B;  5CXC A;  3SHF A;  3JZN A;  3OF7 A;  3ZDY A;  1L0Q A;  2PM7 B;  3IIY A;  2VZ3 A;  2P9U C;  4GGA A;  4Y7R A;  3EI2 B;  2XL2 A;  3SFZ A;  3IUJ A;  5HE3 B;  3FCU A;  3ZDX A;  3ULE C;  1QFM A;  1MG2 A;  4K3J B;  1JV2 A;  4WK4 A;  5GXH A;  3DSM A;  3VGZ A;  1K8K C;  4PBZ A;  4LGN A;  2OVR B;  4J87 A;  1ERJ A;  2H9N A;  4UM8 A;  4Z7Q A;  4JSX C;  4G55 A;  2EID A;  5EAM A;  2EBS A;  2P9I C;  3IUR A;  1S4U X;  3RRM C;  4ZN4 A;  4QT8 A;  4Z8L A;  3FGB A;  3OW8 A;  5FKT A;  3CFV A;  3OTT A;  3IUQ A;  4WK2 A;  3V4P A;  3I7N A;  4FA5 D;  1SQ9 A;  3K6S A;  5CXB A;  5FFO A;  1XHM A; 
#chains in the Genus database with same CATH homology
 1JV2 A;  4WK4 A;  2VDK A;  4UM8 A;  3NID A;  1U8C A;  2VDO A;  4G1M A;  4Z7Q A;  5E6R A;  4MMX A;  3K71 A;  4Z7N A;  3K72 A;  2VDL A;  4O02 A;  4NEN A;  5E6S A;  2VDN A;  5HDB A;  3T3M A;  2VC2 A;  5FFG A;  3VI3 A;  4G1E A;  3V4V A;  3ZDY A;  3ZE1 A;  3NIG A;  4WK0 A;  2VDP A;  3VI4 A;  4UM9 A;  4MMY A;  4WJK A;  4MMZ A;  1TYE A;  4WK2 A;  3V4P A;  2VDR A;  3ZE0 A;  4Z7O A;  3T3P A;  1M1X A;  2VDM A;  4IRZ A;  2VDQ A;  3FCU A;  3NIF A;  5E6U A;  3ZDX A;  3ZDZ A;  3K6S A;  1L5G A;  5FFO A;  3FCS A;  3ZE2 A;  3IJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...