2VDKA

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdkA00
3NIDA 4G1EA 3NIGA 3VI3A 3ZE2A 3FCUA 5HDBA 3ZDXA 3ZE1A 1TYEA 4WK0A 4Z7QA 2VDOA 4G1MA 3V4VA 4WK4A 3K6SA 4MMZA 4WJKA 3VI4A 4MMYA 1M1XA 4MMXA 5E6RA 3K72A 4NENA 2VC2A 3K71A 2VDRA 3ZDZA 4Z7NA 1JV2A 4UM9A 4UM8A 3ZDYA 3IJEA 2VDMA 3V4PA 4Z7OA 5E6SA 1L5GA 3T3MA 3FCSA 2VDPA 1U8CA 4WK2A 5FFGA 3T3PA 2VDKA 2VDLA 4O02A 2VDNA 5FFOA 5E6UA 3NIFA 3ZE0A 4IRZA 2VDQA
chains in the Genus database with same CATH superfamily
2IUVA 3FCUA 3EQ7A 2XU7A 3RFGA 4AMYA 3SBRA 5EM2B 3PVWB 4GGDA 2G99A 3IKOA 4G55A 4ZOYA 1MG3A 2EBSA 5AJAA 2OIZA 5M5UA 1PGUA 5HQGA 4XYIA 1T2XA 4KFMB 5K1CC 3SBPA 3MVDK 3A0FA 2IUQA 5E6SA 5HE2B 2QR5A 3T3MA 2CO0A 3O4GA 3ODTA 4OZUA 5KDOB 5HE0B 3V7DB 3MKQA 4ZOXA 3ZE0A 3MZKA 3MUNA 2H9LA 3OKWA 2J55H 5H1MA 2HU5A 1H2YA 3QI0A 4JSNC 2IWKA 4CY2A 1YR2A 2XL2A 4A0BA 2J56H 3SXTD 4Y7RA 4J86A 4WJKA 4MMYA 2PM9B 1I2MB 2H6NA 4CZVA 4NAAA 4PXWA 3JROA 2B5MA 1H2WA 1YFQA 3UVMA 2OK6A 1B9YA 2VDMA 3EI4A 4AMZA 4ZOZA 3AH8B 4FAND 3L4MD 3OF7A 5CXCB 2VDNA 2OJYA 5M5VA 4A09A 4CI2A 4ESGA 5C86A 4Y5RD 4H5IA 2O9KA 1JTDB 2HU7A 1R5MA 4GM3A 5I5JA 2QXVA 4QRJA 4O3TB 4A2MA 2P9IC 2H13A 2XZGA 1QFMA 3F3FA 3JRPA 3JZHA 4J8BA 4E5ZB 5TEFA 3V9FA 1JJUB 3JB9L 3IVMA 1UOPA 4QL1A 5EMKB 2HU8A 2PM6B 1VZ2A 3SMRA 2I0TA 1JOFA 3SVWD 1Q47A 2CNXA 1NEXB 2AGYA 4FB1D 2XL3A 4GGCA 5GXHA 3ULEC 5IJ7E 3KCIA 4J79A 3F3PA 1OLZA 3RSEC 2CE8A 3RRMC 3UVKA 3EMHA 3RN1D 1NR0A 1K3IA 2YBAA 3GC3B 2BKLA 3QHYB 3EQ9A 4AEZA 1P22A 1FWXA 4I79A 4AN1A 5H14A 4BP9A 1O6FA 2JKXA 3T3PA 4FA4D 3GD1I 3PSLA 4EWRA 1C9IA 3E0CA 3ZWLB 4A11A 5H17A 4ERQA 4L1QD 3SLED 4R7AB 5EMMB 2HJ4A 3UKUC 4GGAA 5TF2A 3I7OA 1VZ3A 3NVNA 3I8EA 5I5MA 4XYHA 3CFVA 3ZDYA 4CY3A 5EMLB 2MTAH 4LG8A 4CY5A 3DDUA 2TRCB 3O4HA 2EIBA 1N6EA 5JWZA 3VGZA 3OW8A 2VDQA 3IJ1A 4FA9D 2AH1A 5FKRA 3CIKB 3ZDXA 3EI1B 4ERZA 2OVQB 3GFCA 2VZ3A 3K6SA 2CN2A 4PNKB 2AGZA 1N6DA 4OWRA 3K26A 4MMXA 3I7PA 3BG0A 3J80g 5M61A 1SQ9A 1E8MA 5EARA 2WQ8A 4Z7NA 3K71A 4L3HD 1UTCA 3CFSB 3BG1A 1XIPA 3U4YA 1L5GA 4BCDA 4LGNA 2VDPA 4GQBB 4D9SA 1QFSA 2Q7QA 4FA1D 1GOFA 4NBMA 1ERJA 4G1MA 4IA9A 4YVDA 5FXYA 2H6QA 2Z2NA 1H2XA 3UVLA 1GOTB 2W18A 2OVRB 2VDRA 4ERYA 1L0QA 1SHYB 3V4PA 3OTTA 1XHMA 4BUJC 3IUJA 3RN0D 3EI2B 1U8CA 3AL8B 3VH0A 3NIFA 4AOWA 1TBGA 2IAAA 1UOOA 4G1EA 4JT6C 1GP2B 3DXMC 3IJCA 3IULA 3SHFA 4BCBA 3OL2B 3PXWD 4A0AA 2XDWA 3C5MA 5B4WA 4CC9A 5C9ZB 3OKYB 4FHLA 5IJ8E 4E54B 5HYNB 3PSCB 5EMJB 2GC7A 3EI3A 4FWWA 3VA6A 3PXTD 5CYKA 2J57G 2P9SC 3SCYA 3DXKC 1E5TA 3KRWB 2EIEA 2CN3A 3IURA 2IURA 1XKSA 2YMUA 2AGXA 4GQ2P 3FGBA 4AN0A 4O02A 1JMXB 4ES0A 2AH0A 2YNPA 3AL9A 4IRZA 1SQJA 4J84A 5HDBA 3DM0A 4WK0A 3AFCA 2VDOA 3VI4A 2I0RA 1C9LA 1H2ZA 1M1XA 1K32A 5GSAA 5FKSA 1UOQA 5AFU3 2OVPB 4X3EA 4DNUA 2P9PC 5CXBA 4JXMA 1GG2B 2CE9A 2AGWA 2H9NA 4CY1A 1K8KC 1PEVA 4JD2C 3I89A 3I8CA 3RMZD 3JZGA 5C92A 1B9XA 3NIDA 3MUOA 3PE7A 3SBQA 3RFHA 3RLMD 2PM9A 4O9DA 4WK4A 4PBZA 4A0BB 5THAA 4J77A 5EAPA 4Z8LA 2HESX 4GM8A 4DNWA 1GOGA 3K27A 1JV2A 3FRXA 3UVOA 3MMYA 4ZN4A 5CXCA 4J0XA 4CI3A 4A2LA 1MDAH 5FQDA 4U1EI 4WK2A 3SWSD 2IWFA 2BCJB 1OMWB 3EI4B 5SXMA 2PM7B 4CI1A 4J0WA 4PSWB 1O6GA 4J81A 3C9CA 2XE4A 4JHPC 4A09B 4JSPC 2P9NC 3J81g 2AQ5A 3BWSA 3PVUB 1PBYB 3SN6B 1E8NA 4A0AB 4JSXC 3UR4A 4J87A 2EIDA 2QZPA 4BH6A 4E5ZA 3IUNA 2Z2OA 3I2NA 4GMBA 4J73A 5C2VB 5EALA 2UZXB 5FFOA 5E6UA 4CI8A 2P9KC 4A7JA 3MXXA 5TDHB 3ZE2A 4QAMA 3NIGA 5GMKn 4RE6A 3I7NA 4L3GD 2AGLA 1PI6A 4PBYA 4PSXB 3JPXA 4O45A 3SFZA 3W15A 2B4EA 3K72A 4J78A 3HFQA 1N6FA 2I3SA 3MZLA 3I7LA 5FKTA 3OKTA 4J8GA 4U7AA 4CZYA 4CZXA 2EICA 4BP8A 4D0KA 5IT9g 2YNOA 3O4JA 4GZ8A 4QQEA 3V5WB 3I7KA 2OK4A 3NVXA 5CXBB 5FFGA 3B7FA 4QT8A 2VDLA 2P9UC 4MK0B 2H68A 3I7HA 1TYEA 4A11B 4Z7QA 4A08A 4LG9A 3KRXB 2HKMA 2HJBA 3GREA 3O4IA 4BL0A 1S4UX 4HDJA 1GXRA 2H9MA 5M5RA 3IJEA 3N0DA 4L9OA 4XEIC 1A0RB 1U2VC 4BCCA 2QC5A 3C99A 3F3GA 4H5JA 3ORVD 2HKRA 4K3JB 4O2WA 2H6KA 3EI1A 3VI3A 5C2WB 3JAMg 1VE6A 4N14A 2P9LC 2XYIA 5EM2A 5HE3B 3IIWA 2H14A 3PXSD 4G56B 4AX4A 1RI6A 3DWLC 3IUMA 4IMMA 4JHNA 2VC2A 1VE7A 2B5NA 5EAMA 2UZYB 4UM8A 1JMZB 4RE5A 3UKRC 3SJLD 2GC4A 4JT5C 4DNVA 5IC7A 4FAVD 3IUQA 4JSVC 1U4CA 4L1MA 3IJ0A 1A12A 1QNIA 4X63B 1GOHA 5IGOA 4O3UB 1VYHC 2IUPA 3IIYA 4PC0A 3V4VA 5HE1B 3NVQA 2CO0C 4MMZA 5FA5B 2Z2PA 4UI9R 4GQ1A 1MG2A 1TYQC 5AMSA 4NC4A 2HXCA 2VZ1A 4X60B 3ZDZA 5I5IA 3EI2A 3AL8A 2GNQA 4NSXA 4Z7OA 2BBKH 3P4FA 3N0EA 1BPOA 2VDKA 2H9PA 5FLXg 2I3TA 3MKSB 3OL2A 5FKQA 3EQ8A 4D6VA 4ZOVA 5GXIA 2HYEA 2H3XA 2YB8B 3ZE1A 3OKYA 5IGQA 5M5SA 4GM9A 2H47A 5K19A 2YNNA 5TEEA 4FA5D 4E54A 3JZNA 3L4OD 3EG6A 2B5LA 4O1QD 4A08B 5E6RA 4TZ4A 3UVNA 4NENA 3EU7A 4UM9A 4J82A 3EI3B 4K3ID 3DSMA 5CYKB 2I0SA 3C75H 3FCSA 5M5TA 3EWEA 4X61B 2G9AA 5A2Qg 2PBIB 3FM0A
chains in the Genus database with same CATH topology
3NIDA 4G1EA 3NIGA 3VI3A 3ZE2A 3FCUA 5HDBA 3ZDXA 3ZE1A 1TYEA 4WK0A 4Z7QA 2VDOA 4G1MA 3V4VA 4WK4A 3K6SA 4MMZA 4WJKA 3VI4A 4MMYA 1M1XA 4MMXA 5E6RA 3K72A 4NENA 2VC2A 3K71A 2VDRA 3ZDZA 4Z7NA 1JV2A 4UM9A 4UM8A 3ZDYA 3IJEA 2VDMA 3V4PA 4Z7OA 5E6SA 1L5GA 3T3MA 3FCSA 2VDPA 1U8CA 4WK2A 5FFGA 3T3PA 2VDKA 2VDLA 4O02A 2VDNA 5FFOA 5E6UA 3NIFA 3ZE0A 4IRZA 2VDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NID A;  4G1E A;  3NIG A;  3VI3 A;  3ZE2 A;  3FCU A;  5HDB A;  3ZDX A;  3ZE1 A;  1TYE A;  4WK0 A;  4Z7Q A;  2VDO A;  4G1M A;  3V4V A;  4WK4 A;  3K6S A;  4MMZ A;  4WJK A;  3VI4 A;  4MMY A;  1M1X A;  4MMX A;  5E6R A;  3K72 A;  4NEN A;  2VC2 A;  3K71 A;  2VDR A;  3ZDZ A;  4Z7N A;  1JV2 A;  4UM9 A;  4UM8 A;  3ZDY A;  3IJE A;  2VDM A;  3V4P A;  4Z7O A;  5E6S A;  1L5G A;  3T3M A;  3FCS A;  2VDP A;  1U8C A;  4WK2 A;  5FFG A;  3T3P A;  2VDK A;  2VDL A;  4O02 A;  2VDN A;  5FFO A;  5E6U A;  3NIF A;  3ZE0 A;  4IRZ A;  2VDQ A; 
#chains in the Genus database with same CATH topology
 2IUV A;  3FCU A;  3EQ7 A;  2XU7 A;  3RFG A;  4AMY A;  3SBR A;  5EM2 B;  3PVW B;  4GGD A;  2G99 A;  3IKO A;  4G55 A;  4ZOY A;  1MG3 A;  2EBS A;  5AJA A;  2OIZ A;  5M5U A;  1PGU A;  5HQG A;  4XYI A;  1T2X A;  4KFM B;  5K1C C;  3SBP A;  3MVD K;  3A0F A;  2IUQ A;  5E6S A;  5HE2 B;  2QR5 A;  3T3M A;  2CO0 A;  3O4G A;  3ODT A;  4OZU A;  5KDO B;  5HE0 B;  3V7D B;  3MKQ A;  4ZOX A;  3ZE0 A;  3MZK A;  3MUN A;  2H9L A;  3OKW A;  2J55 H;  5H1M A;  2HU5 A;  1H2Y A;  3QI0 A;  4JSN C;  2IWK A;  4CY2 A;  1YR2 A;  2XL2 A;  4A0B A;  2J56 H;  3SXT D;  4Y7R A;  4J86 A;  4WJK A;  4MMY A;  2PM9 B;  1I2M B;  2H6N A;  4CZV A;  4NAA A;  4PXW A;  3JRO A;  2B5M A;  1H2W A;  1YFQ A;  3UVM A;  2OK6 A;  1B9Y A;  2VDM A;  3EI4 A;  4AMZ A;  4ZOZ A;  3AH8 B;  4FAN D;  3L4M D;  3OF7 A;  5CXC B;  2VDN A;  2OJY A;  5M5V A;  4A09 A;  4CI2 A;  4ESG A;  5C86 A;  4Y5R D;  4H5I A;  2O9K A;  1JTD B;  2HU7 A;  1R5M A;  4GM3 A;  5I5J A;  2QXV A;  4QRJ A;  4O3T B;  4A2M A;  2P9I C;  2H13 A;  2XZG A;  1QFM A;  3F3F A;  3JRP A;  3JZH A;  4J8B A;  4E5Z B;  5TEF A;  3V9F A;  1JJU B;  3JB9 L;  3IVM A;  1UOP A;  4QL1 A;  5EMK B;  2HU8 A;  2PM6 B;  1VZ2 A;  3SMR A;  2I0T A;  1JOF A;  3SVW D;  1Q47 A;  2CNX A;  1NEX B;  2AGY A;  4FB1 D;  2XL3 A;  4GGC A;  5GXH A;  3ULE C;  5IJ7 E;  3KCI A;  4J79 A;  3F3P A;  1OLZ A;  3RSE C;  2CE8 A;  3RRM C;  3UVK A;  3EMH A;  3RN1 D;  1NR0 A;  1K3I A;  2YBA A;  3GC3 B;  2BKL A;  3QHY B;  3EQ9 A;  4AEZ A;  1P22 A;  1FWX A;  4I79 A;  4AN1 A;  5H14 A;  4BP9 A;  1O6F A;  2JKX A;  3T3P A;  4FA4 D;  3GD1 I;  3PSL A;  4EWR A;  1C9I A;  3E0C A;  3ZWL B;  4A11 A;  5H17 A;  4ERQ A;  4L1Q D;  3SLE D;  4R7A B;  5EMM B;  2HJ4 A;  3UKU C;  4GGA A;  5TF2 A;  3I7O A;  1VZ3 A;  3NVN A;  3I8E A;  5I5M A;  4XYH A;  3CFV A;  3ZDY A;  4CY3 A;  5EML B;  2MTA H;  4LG8 A;  4CY5 A;  3DDU A;  2TRC B;  3O4H A;  2EIB A;  1N6E A;  5JWZ A;  3VGZ A;  3OW8 A;  2VDQ A;  3IJ1 A;  4FA9 D;  2AH1 A;  5FKR A;  3CIK B;  3ZDX A;  3EI1 B;  4ERZ A;  2OVQ B;  3GFC A;  2VZ3 A;  3K6S A;  2CN2 A;  4PNK B;  2AGZ A;  1N6D A;  4OWR A;  3K26 A;  4MMX A;  3I7P A;  3BG0 A;  3J80 g;  5M61 A;  1SQ9 A;  1E8M A;  5EAR A;  2WQ8 A;  4Z7N A;  3K71 A;  4L3H D;  1UTC A;  3CFS B;  3BG1 A;  1XIP A;  3U4Y A;  1L5G A;  4BCD A;  4LGN A;  2VDP A;  4GQB B;  4D9S A;  1QFS A;  2Q7Q A;  4FA1 D;  1GOF A;  4NBM A;  1ERJ A;  4G1M A;  4IA9 A;  4YVD A;  5FXY A;  2H6Q A;  2Z2N A;  1H2X A;  3UVL A;  1GOT B;  2W18 A;  2OVR B;  2VDR A;  4ERY A;  1L0Q A;  1SHY B;  3V4P A;  3OTT A;  1XHM A;  4BUJ C;  3IUJ A;  3RN0 D;  3EI2 B;  1U8C A;  3AL8 B;  3VH0 A;  3NIF A;  4AOW A;  1TBG A;  2IAA A;  1UOO A;  4G1E A;  4JT6 C;  1GP2 B;  3DXM C;  3IJC A;  3IUL A;  3SHF A;  4BCB A;  3OL2 B;  3PXW D;  4A0A A;  2XDW A;  3C5M A;  5B4W A;  4CC9 A;  5C9Z B;  3OKY B;  4FHL A;  5IJ8 E;  4E54 B;  5HYN B;  3PSC B;  5EMJ B;  2GC7 A;  3EI3 A;  4FWW A;  3VA6 A;  3PXT D;  5CYK A;  2J57 G;  2P9S C;  3SCY A;  3DXK C;  1E5T A;  3KRW B;  2EIE A;  2CN3 A;  3IUR A;  2IUR A;  1XKS A;  2YMU A;  2AGX A;  4GQ2 P;  3FGB A;  4AN0 A;  4O02 A;  1JMX B;  4ES0 A;  2AH0 A;  2YNP A;  3AL9 A;  4IRZ A;  1SQJ A;  4J84 A;  5HDB A;  3DM0 A;  4WK0 A;  3AFC A;  2VDO A;  3VI4 A;  2I0R A;  1C9L A;  1H2Z A;  1M1X A;  1K32 A;  5GSA A;  5FKS A;  1UOQ A;  5AFU 3;  2OVP B;  4X3E A;  4DNU A;  2P9P C;  5CXB A;  4JXM A;  1GG2 B;  2CE9 A;  2AGW A;  2H9N A;  4CY1 A;  1K8K C;  1PEV A;  4JD2 C;  3I89 A;  3I8C A;  3RMZ D;  3JZG A;  5C92 A;  1B9X A;  3NID A;  3MUO A;  3PE7 A;  3SBQ A;  3RFH A;  3RLM D;  2PM9 A;  4O9D A;  4WK4 A;  4PBZ A;  4A0B B;  5THA A;  4J77 A;  5EAP A;  4Z8L A;  2HES X;  4GM8 A;  4DNW A;  1GOG A;  3K27 A;  1JV2 A;  3FRX A;  3UVO A;  3MMY A;  4ZN4 A;  5CXC A;  4J0X A;  4CI3 A;  4A2L A;  1MDA H;  5FQD A;  4U1E I;  4WK2 A;  3SWS D;  2IWF A;  2BCJ B;  1OMW B;  3EI4 B;  5SXM A;  2PM7 B;  4CI1 A;  4J0W A;  4PSW B;  1O6G A;  4J81 A;  3C9C A;  2XE4 A;  4JHP C;  4A09 B;  4JSP C;  2P9N C;  3J81 g;  2AQ5 A;  3BWS A;  3PVU B;  1PBY B;  3SN6 B;  1E8N A;  4A0A B;  4JSX C;  3UR4 A;  4J87 A;  2EID A;  2QZP A;  4BH6 A;  4E5Z A;  3IUN A;  2Z2O A;  3I2N A;  4GMB A;  4J73 A;  5C2V B;  5EAL A;  2UZX B;  5FFO A;  5E6U A;  4CI8 A;  2P9K C;  4A7J A;  3MXX A;  5TDH B;  3ZE2 A;  4QAM A;  3NIG A;  5GMK n;  4RE6 A;  3I7N A;  4L3G D;  2AGL A;  1PI6 A;  4PBY A;  4PSX B;  3JPX A;  4O45 A;  3SFZ A;  3W15 A;  2B4E A;  3K72 A;  4J78 A;  3HFQ A;  1N6F A;  2I3S A;  3MZL A;  3I7L A;  5FKT A;  3OKT A;  4J8G A;  4U7A A;  4CZY A;  4CZX A;  2EIC A;  4BP8 A;  4D0K A;  5IT9 g;  2YNO A;  3O4J A;  4GZ8 A;  4QQE A;  3V5W B;  3I7K A;  2OK4 A;  3NVX A;  5CXB B;  5FFG A;  3B7F A;  4QT8 A;  2VDL A;  2P9U C;  4MK0 B;  2H68 A;  3I7H A;  1TYE A;  4A11 B;  4Z7Q A;  4A08 A;  4LG9 A;  3KRX B;  2HKM A;  2HJB A;  3GRE A;  3O4I A;  4BL0 A;  1S4U X;  4HDJ A;  1GXR A;  2H9M A;  5M5R A;  3IJE A;  3N0D A;  4L9O A;  4XEI C;  1A0R B;  1U2V C;  4BCC A;  2QC5 A;  3C99 A;  3F3G A;  4H5J A;  3ORV D;  2HKR A;  4K3J B;  4O2W A;  2H6K A;  3EI1 A;  3VI3 A;  5C2W B;  3JAM g;  1VE6 A;  4N14 A;  2P9L C;  2XYI A;  5EM2 A;  5HE3 B;  3IIW A;  2H14 A;  3PXS D;  4G56 B;  4AX4 A;  1RI6 A;  3DWL C;  3IUM A;  4IMM A;  4JHN A;  2VC2 A;  1VE7 A;  2B5N A;  5EAM A;  2UZY B;  4UM8 A;  1JMZ B;  4RE5 A;  3UKR C;  3SJL D;  2GC4 A;  4JT5 C;  4DNV A;  5IC7 A;  4FAV D;  3IUQ A;  4JSV C;  1U4C A;  4L1M A;  3IJ0 A;  1A12 A;  1QNI A;  4X63 B;  1GOH A;  5IGO A;  4O3U B;  1VYH C;  2IUP A;  3IIY A;  4PC0 A;  3V4V A;  5HE1 B;  3NVQ A;  2CO0 C;  4MMZ A;  5FA5 B;  2Z2P A;  4UI9 R;  4GQ1 A;  1MG2 A;  1TYQ C;  5AMS A;  4NC4 A;  2HXC A;  2VZ1 A;  4X60 B;  3ZDZ A;  5I5I A;  3EI2 A;  3AL8 A;  2GNQ A;  4NSX A;  4Z7O A;  2BBK H;  3P4F A;  3N0E A;  1BPO A;  2VDK A;  2H9P A;  5FLX g;  2I3T A;  3MKS B;  3OL2 A;  5FKQ A;  3EQ8 A;  4D6V A;  4ZOV A;  5GXI A;  2HYE A;  2H3X A;  2YB8 B;  3ZE1 A;  3OKY A;  5IGQ A;  5M5S A;  4GM9 A;  2H47 A;  5K19 A;  2YNN A;  5TEE A;  4FA5 D;  4E54 A;  3JZN A;  3L4O D;  3EG6 A;  2B5L A;  4O1Q D;  4A08 B;  5E6R A;  4TZ4 A;  3UVN A;  4NEN A;  3EU7 A;  4UM9 A;  4J82 A;  3EI3 B;  4K3I D;  3DSM A;  5CYK B;  2I0S A;  3C75 H;  3FCS A;  5M5T A;  3EWE A;  4X61 B;  2G9A A;  5A2Q g;  2PBI B;  3FM0 A; 
#chains in the Genus database with same CATH homology
 3NID A;  4G1E A;  3NIG A;  3VI3 A;  3ZE2 A;  3FCU A;  5HDB A;  3ZDX A;  3ZE1 A;  1TYE A;  4WK0 A;  4Z7Q A;  2VDO A;  4G1M A;  3V4V A;  4WK4 A;  3K6S A;  4MMZ A;  4WJK A;  3VI4 A;  4MMY A;  1M1X A;  4MMX A;  5E6R A;  3K72 A;  4NEN A;  2VC2 A;  3K71 A;  2VDR A;  3ZDZ A;  4Z7N A;  1JV2 A;  4UM9 A;  4UM8 A;  3ZDY A;  3IJE A;  2VDM A;  3V4P A;  4Z7O A;  5E6S A;  1L5G A;  3T3M A;  3FCS A;  2VDP A;  1U8C A;  4WK2 A;  5FFG A;  3T3P A;  2VDK A;  2VDL A;  4O02 A;  2VDN A;  5FFO A;  5E6U A;  3NIF A;  3ZE0 A;  4IRZ A;  2VDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...