2VDKA

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdkA00
4Z7QA 3NIDA 4WJKA 4NENA 3ZDYA 3K72A 3FCUA 4Z7OA 2VDRA 1JV2A 4Z7NA 4MMZA 3K71A 2VDMA 5E6UA 3VI3A 3NIGA 3ZE1A 1L5GA 2VC2A 2VDOA 4G1MA 4WK2A 4MMXA 3ZDZA 1U8CA 4WK0A 5FFOA 3ZE2A 3VI4A 2VDQA 3V4PA 4UM9A 5E6RA 4IRZA 5E6SA 3ZDXA 5FFGA 1M1XA 3IJEA 1TYEA 3FCSA 4MMYA 4O02A 2VDKA 4UM8A 3K6SA 5HDBA 2VDLA 4WK4A 3V4VA 3ZE0A 3T3MA 3T3PA 2VDPA 3NIFA 4G1EA 2VDNA
chains in the Genus database with same CATH superfamily
3EI3B 2CO0C 4JSNC 4L1MA 1A0RB 4CC9A 2AH0A 5I5JA 4Y5RD 3SXTD 3EQ7A 5E6UA 2QC5A 2H47A 3A0FA 5HQGA 1GOFA 3NVQA 4J78A 4X3EA 4PNKB 1VE6A 2QZPA 4EWRA 2HKRA 5EAPA 4J82A 4PSXB 4A7JA 5FKTA 2H9NA 3KCIA 5HE1B 3IUMA 4NBMA 4NC4A 3DM0A 2JKXA 5M5UA 4AOWA 2I3TA 2AGZA 3OW8A 4FWWA 2EIDA 4JSVC 3K72A 1O6GA 3AFCA 2PM9B 5A2Qg 1N6DA 3SVWD 4J84A 3UVLA 3P4FA 3DXMC 3K26A 1Q47A 4U7AA 3ZDXA 4BP8A 4BCBA 2AGLA 3OKYA 1TYEA 1SQJA 3FCSA 3DDUA 1YFQA 4ERZA 3UVMA 3N0EA 4OWRA 3SHFA 4FA9D 1P22A 1MG2A 2H6QA 1JMXB 4Z7NA 3MVDK 1JMZB 3IVMA 3OKWA 1L5GA 3RMZD 5C2VB 4RE5A 3EWEA 3K27A 4O3UB 4A09A 5GXHA 4L3GD 2HXCA 4HDJA 4IRZA 2OK4A 5CYKA 5E6SA 5IC7A 2P9IC 4CI3A 1M1XA 3EI4A 4JHNA 5IT9g 2CN3A 4A2LA 3IKOA 2HU5A 2H9MA 4O02A 3RRMC 3EI3A 1TYQC 3ODTA 3EMHA 3C99A 3IJ1A 1PI6A 4CI8A 2P9LC 3KRXB 4Z7OA 3JB9L 4H5JA 3K71A 2VDMA 4FHLA 3OL2B 3J80g 3C75H 4FA5D 4J87A 1U8CA 3F3GA 4O2WA 4JSXC 3O4IA 4RE6A 4D9SA 3AH8B 2I0TA 5THAA 3FGBA 4A11B 4MMYA 2QXVA 2Z2PA 1B9XA 1L0QA 1QNIA 2O9KA 2EBSA 1XHMA 3OKYB 4J81A 4J86A 2PM7B 1UOQA 4G55A 2OK6A 3RSEC 3SFZA 1TBGA 3PE7A 2EICA 3ULEC 2B5LA 4BCCA 4G1MA 3CFSB 3O4GA 5K19A 4ZN4A 5M5SA 3N0DA 5EARA 3CFVA 5K1CC 3UVOA 2P9KC 3EQ8A 3E0CA 5TEFA 3V9FA 4FA1D 5SXMA 5FKSA 3L4MD 3C5MA 3IIWA 1E5TA 3V4VA 1UOPA 2IWFA 4CY2A 1GOHA 2UZXB 3L4OD 2AQ5A 3JAMg 4CI2A 1QFMA 1VE7A 4WJKA 1K8KC 4K3ID 4CY1A 4GZ8A 4Y7RA 5EMJB 3C9CA 3RN0D 3AL8A 4MMXA 2OVQB 5KDOB 4GQ1A 4MK0B 3V4PA 5EMLB 4GGDA 2H14A 5FFGA 2XE4A 3IJCA 1RI6A 1O6FA 1OLZA 1T2XA 1R5MA 4PBZA 4OZUA 5IJ7E 2AGYA 3UKRC 2YBAA 5I5MA 2CE8A 4AMYA 5H1MA 3OL2A 1GXRA 3DXKC 2CNXA 3I7LA 2XDWA 3IUJA 4MMZA 5GMKn 1E8MA 3B7FA 4A11A 3UKUC 5M5VA 4U1EI 3QI0A 3EU7A 1H2ZA 4NSXA 3I7HA 4BP9A 5M5TA 4AEZA 1NR0A 4QL1A 1BPOA 1K3IA 4AN0A 4FAVD 2OIZA 4UM8A 3SMRA 1VYHC 5HDBA 4A08B 5IGQA 4GQ2P 3PXWD 3QHYB 3UVNA 1ERJA 3I2NA 2VDNA 4NENA 3FCUA 4ZOZA 2HKMA 5TEEA 2XU7A 3SN6B 2P9NC 3CIKB 5IJ8E 3EI2A 4DNWA 1GP2B 4O9DA 2MTAH 4R7AB 1UOOA 2OJYA 3PSLA 4XYHA 3PXSD 5TDHB 1A12A 3IURA 1H2XA 2HESX 5HE3B 4QQEA 4CZXA 2AH1A 3BG0A 4J0XA 1VZ2A 3AL8B 3KRWB 4GQBB 3BG1A 3JROA 4PC0A 2OVRB 3OF7A 2H13A 2YB8B 3MZLA 4J79A 2Z2NA 4QRJA 4A0BB 3T3MA 4Z8LA 2UZYB 3NVNA 4G1EA 5IGOA 4BUJC 4CY3A 4Z7QA 3I8CA 1PBYB 5FQDA 5CXBB 3ZDZA 3V7DB 2VZ1A 3MUOA 1GOTB 4D0KA 2HYEA 4DNUA 4UM9A 1N6FA 4LG8A 4GM3A 2QR5A 3IUQA 4GM9A 3SJLD 4FA4D 5CXCA 4A2MA 3RLMD 3GD1I 3IIYA 2CO0A 5EMKB 3MKQA 4FB1D 3JZHA 2XYIA 2HJBA 5AJAA 3F3FA 3VI3A 4AMZA 2H68A 4CZYA 3MXXA 3PSCB 5I5IA 4I79A 3PVUB 2AGXA 1JOFA 5FKQA 2GC7A 4A08A 3GC3B 3VGZA 3EI2B 5EM2A 1NEXB 3MKSB 5TF2A 1PGUA 3HFQA 3SBPA 3MUNA 4CZVA 5HE0B 4PXWA 3SBQA 3W15A 5HE2B 4D6VA 2IUPA 3PXTD 1XIPA 3IULA 5GSAA 4E54B 3O4JA 3I7PA 4JT6C 2H9LA 3DWLC 4GGAA 4A0AB 2YNNA 4J77A 4L3HD 3RFHA 5C92A 1K32A 2WQ8A 4J73A 2VC2A 2H3XA 5FFOA 4UI9R 2IUVA 4JHPC 2BCJB 4A0BA 3FM0A 3SLED 2H9PA 4QAMA 1UTCA 1C9LA 2IAAA 4J8GA 4L9OA 4KFMB 2I0RA 4X60B 4K3JB 4IMMA 1N6EA 3EI1A 2VDPA 4O45A 4PBYA 5CXBA 4BCDA 5CXCB 4J8BA 3GREA 3MZKA 1E8NA 4E5ZA 4ZOYA 2J57G 4WK2A 5B4WA 4IA9A 2Q7QA 3J81g 4ERYA 2GC4A 4YVDA 3JRPA 2PM6B 2P9PC 2EIBA 5H14A 4AX4A 3JZGA 3IJ0A 2P9SC 3ORVD 3NVXA 1GOGA 4ERQA 2VZ3A 4J0WA 2IWKA 3VH0A 5C2WB 1VZ3A 4XYIA 3T3PA 5EM2B 3NIFA 2J56H 3V5WB 3UVKA 3I89A 1H2YA 2CN2A 4G56B 1JV2A 4PSWB 2J55H 3AL9A 1YR2A 2I0SA 1H2WA 5FA5B 4JT5C 1FWXA 2BBKH 4BH6A 2IURA 1U2VC 4GM8A 5E6RA 4O3TB 5H17A 3PVWB 2YNOA 1U4CA 2Z2OA 4GMBA 2YNPA 5FXYA 2OVPB 1XKSA 1MDAH 2B5MA 4E54A 1PEVA 2VDKA 5C86A 4A0AA 2AGWA 2PBIB 3BWSA 3ZDYA 2XL3A 3I8EA 3I7KA 4NAAA 3O4HA 3VA6A 3ZE1A 3EI1B 1QFSA 3JZNA 5FKRA 2B5NA 3ZE2A 2GNQA 1B9YA 5C9ZB 5FLXg 4ES0A 4JD2C 4E5ZB 3IJEA 4N14A 3FRXA 4LGNA 3SBRA 3GFCA 3K6SA 3F3PA 3JPXA 1MG3A 2VDLA 4O1QD 2XL2A 2HJ4A 3ZE0A 3OKTA 3DSMA 2CE9A 1S4UX 2W18A 4QT8A 5EMMB 3EG6A 2VDOA 3SCYA 2H6KA 5EAMA 2HU7A 3IUNA 4H5IA 4CI1A 2BKLA 3I7OA 2B4EA 3ZWLB 2P9UC 4TZ4A 4ZOVA 2G9AA 2TRCB 4ESGA 1C9IA 1GG2B 3SWSD 1JTDB 1I2MB 2PM9A 3MMYA 1SHYB 3RN1D 5EALA 3UR4A 2H6NA 2XZGA 2I3SA 4X61B 4CY5A 4DNVA 3NIDA 4BL0A 5M61A 3OTTA 2VDRA 2YMUA 4X63B 5HYNB 4XEIC 3NIGA 2HU8A 4LG9A 3EQ9A 4WK0A 3VI4A 4JXMA 2IUQA 2VDQA 5JWZA 4GGCA 5AMSA 4A09B 1JJUB 4AN1A 4JSPC 4ZOXA 5AFU3 1OMWB 2G99A 4FAND 5CYKB 5M5RA 2EIEA 4WK4A 3EI4B 4L1QD 3U4YA 5GXIA 1SQ9A 3I7NA 3RFGA
chains in the Genus database with same CATH topology
4Z7QA 3NIDA 4WJKA 4NENA 3ZDYA 3K72A 3FCUA 4Z7OA 2VDRA 1JV2A 4Z7NA 4MMZA 3K71A 2VDMA 5E6UA 3VI3A 3NIGA 3ZE1A 1L5GA 2VC2A 2VDOA 4G1MA 4WK2A 4MMXA 3ZDZA 1U8CA 4WK0A 5FFOA 3ZE2A 3VI4A 2VDQA 3V4PA 4UM9A 5E6RA 4IRZA 5E6SA 3ZDXA 5FFGA 1M1XA 3IJEA 1TYEA 3FCSA 4MMYA 4O02A 2VDKA 4UM8A 3K6SA 5HDBA 2VDLA 4WK4A 3V4VA 3ZE0A 3T3MA 3T3PA 2VDPA 3NIFA 4G1EA 2VDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7Q A;  3NID A;  4WJK A;  4NEN A;  3ZDY A;  3K72 A;  3FCU A;  4Z7O A;  2VDR A;  1JV2 A;  4Z7N A;  4MMZ A;  3K71 A;  2VDM A;  5E6U A;  3VI3 A;  3NIG A;  3ZE1 A;  1L5G A;  2VC2 A;  2VDO A;  4G1M A;  4WK2 A;  4MMX A;  3ZDZ A;  1U8C A;  4WK0 A;  5FFO A;  3ZE2 A;  3VI4 A;  2VDQ A;  3V4P A;  4UM9 A;  5E6R A;  4IRZ A;  5E6S A;  3ZDX A;  5FFG A;  1M1X A;  3IJE A;  1TYE A;  3FCS A;  4MMY A;  4O02 A;  2VDK A;  4UM8 A;  3K6S A;  5HDB A;  2VDL A;  4WK4 A;  3V4V A;  3ZE0 A;  3T3M A;  3T3P A;  2VDP A;  3NIF A;  4G1E A;  2VDN A; 
#chains in the Genus database with same CATH topology
 3EI3 B;  2CO0 C;  4JSN C;  4L1M A;  1A0R B;  4CC9 A;  2AH0 A;  5I5J A;  4Y5R D;  3SXT D;  3EQ7 A;  5E6U A;  2QC5 A;  2H47 A;  3A0F A;  5HQG A;  1GOF A;  3NVQ A;  4J78 A;  4X3E A;  4PNK B;  1VE6 A;  2QZP A;  4EWR A;  2HKR A;  5EAP A;  4J82 A;  4PSX B;  4A7J A;  5FKT A;  2H9N A;  3KCI A;  5HE1 B;  3IUM A;  4NBM A;  4NC4 A;  3DM0 A;  2JKX A;  5M5U A;  4AOW A;  2I3T A;  2AGZ A;  3OW8 A;  4FWW A;  2EID A;  4JSV C;  3K72 A;  1O6G A;  3AFC A;  2PM9 B;  5A2Q g;  1N6D A;  3SVW D;  4J84 A;  3UVL A;  3P4F A;  3DXM C;  3K26 A;  1Q47 A;  4U7A A;  3ZDX A;  4BP8 A;  4BCB A;  2AGL A;  3OKY A;  1TYE A;  1SQJ A;  3FCS A;  3DDU A;  1YFQ A;  4ERZ A;  3UVM A;  3N0E A;  4OWR A;  3SHF A;  4FA9 D;  1P22 A;  1MG2 A;  2H6Q A;  1JMX B;  4Z7N A;  3MVD K;  1JMZ B;  3IVM A;  3OKW A;  1L5G A;  3RMZ D;  5C2V B;  4RE5 A;  3EWE A;  3K27 A;  4O3U B;  4A09 A;  5GXH A;  4L3G D;  2HXC A;  4HDJ A;  4IRZ A;  2OK4 A;  5CYK A;  5E6S A;  5IC7 A;  2P9I C;  4CI3 A;  1M1X A;  3EI4 A;  4JHN A;  5IT9 g;  2CN3 A;  4A2L A;  3IKO A;  2HU5 A;  2H9M A;  4O02 A;  3RRM C;  3EI3 A;  1TYQ C;  3ODT A;  3EMH A;  3C99 A;  3IJ1 A;  1PI6 A;  4CI8 A;  2P9L C;  3KRX B;  4Z7O A;  3JB9 L;  4H5J A;  3K71 A;  2VDM A;  4FHL A;  3OL2 B;  3J80 g;  3C75 H;  4FA5 D;  4J87 A;  1U8C A;  3F3G A;  4O2W A;  4JSX C;  3O4I A;  4RE6 A;  4D9S A;  3AH8 B;  2I0T A;  5THA A;  3FGB A;  4A11 B;  4MMY A;  2QXV A;  2Z2P A;  1B9X A;  1L0Q A;  1QNI A;  2O9K A;  2EBS A;  1XHM A;  3OKY B;  4J81 A;  4J86 A;  2PM7 B;  1UOQ A;  4G55 A;  2OK6 A;  3RSE C;  3SFZ A;  1TBG A;  3PE7 A;  2EIC A;  3ULE C;  2B5L A;  4BCC A;  4G1M A;  3CFS B;  3O4G A;  5K19 A;  4ZN4 A;  5M5S A;  3N0D A;  5EAR A;  3CFV A;  5K1C C;  3UVO A;  2P9K C;  3EQ8 A;  3E0C A;  5TEF A;  3V9F A;  4FA1 D;  5SXM A;  5FKS A;  3L4M D;  3C5M A;  3IIW A;  1E5T A;  3V4V A;  1UOP A;  2IWF A;  4CY2 A;  1GOH A;  2UZX B;  3L4O D;  2AQ5 A;  3JAM g;  4CI2 A;  1QFM A;  1VE7 A;  4WJK A;  1K8K C;  4K3I D;  4CY1 A;  4GZ8 A;  4Y7R A;  5EMJ B;  3C9C A;  3RN0 D;  3AL8 A;  4MMX A;  2OVQ B;  5KDO B;  4GQ1 A;  4MK0 B;  3V4P A;  5EML B;  4GGD A;  2H14 A;  5FFG A;  2XE4 A;  3IJC A;  1RI6 A;  1O6F A;  1OLZ A;  1T2X A;  1R5M A;  4PBZ A;  4OZU A;  5IJ7 E;  2AGY A;  3UKR C;  2YBA A;  5I5M A;  2CE8 A;  4AMY A;  5H1M A;  3OL2 A;  1GXR A;  3DXK C;  2CNX A;  3I7L A;  2XDW A;  3IUJ A;  4MMZ A;  5GMK n;  1E8M A;  3B7F A;  4A11 A;  3UKU C;  5M5V A;  4U1E I;  3QI0 A;  3EU7 A;  1H2Z A;  4NSX A;  3I7H A;  4BP9 A;  5M5T A;  4AEZ A;  1NR0 A;  4QL1 A;  1BPO A;  1K3I A;  4AN0 A;  4FAV D;  2OIZ A;  4UM8 A;  3SMR A;  1VYH C;  5HDB A;  4A08 B;  5IGQ A;  4GQ2 P;  3PXW D;  3QHY B;  3UVN A;  1ERJ A;  3I2N A;  2VDN A;  4NEN A;  3FCU A;  4ZOZ A;  2HKM A;  5TEE A;  2XU7 A;  3SN6 B;  2P9N C;  3CIK B;  5IJ8 E;  3EI2 A;  4DNW A;  1GP2 B;  4O9D A;  2MTA H;  4R7A B;  1UOO A;  2OJY A;  3PSL A;  4XYH A;  3PXS D;  5TDH B;  1A12 A;  3IUR A;  1H2X A;  2HES X;  5HE3 B;  4QQE A;  4CZX A;  2AH1 A;  3BG0 A;  4J0X A;  1VZ2 A;  3AL8 B;  3KRW B;  4GQB B;  3BG1 A;  3JRO A;  4PC0 A;  2OVR B;  3OF7 A;  2H13 A;  2YB8 B;  3MZL A;  4J79 A;  2Z2N A;  4QRJ A;  4A0B B;  3T3M A;  4Z8L A;  2UZY B;  3NVN A;  4G1E A;  5IGO A;  4BUJ C;  4CY3 A;  4Z7Q A;  3I8C A;  1PBY B;  5FQD A;  5CXB B;  3ZDZ A;  3V7D B;  2VZ1 A;  3MUO A;  1GOT B;  4D0K A;  2HYE A;  4DNU A;  4UM9 A;  1N6F A;  4LG8 A;  4GM3 A;  2QR5 A;  3IUQ A;  4GM9 A;  3SJL D;  4FA4 D;  5CXC A;  4A2M A;  3RLM D;  3GD1 I;  3IIY A;  2CO0 A;  5EMK B;  3MKQ A;  4FB1 D;  3JZH A;  2XYI A;  2HJB A;  5AJA A;  3F3F A;  3VI3 A;  4AMZ A;  2H68 A;  4CZY A;  3MXX A;  3PSC B;  5I5I A;  4I79 A;  3PVU B;  2AGX A;  1JOF A;  5FKQ A;  2GC7 A;  4A08 A;  3GC3 B;  3VGZ A;  3EI2 B;  5EM2 A;  1NEX B;  3MKS B;  5TF2 A;  1PGU A;  3HFQ A;  3SBP A;  3MUN A;  4CZV A;  5HE0 B;  4PXW A;  3SBQ A;  3W15 A;  5HE2 B;  4D6V A;  2IUP A;  3PXT D;  1XIP A;  3IUL A;  5GSA A;  4E54 B;  3O4J A;  3I7P A;  4JT6 C;  2H9L A;  3DWL C;  4GGA A;  4A0A B;  2YNN A;  4J77 A;  4L3H D;  3RFH A;  5C92 A;  1K32 A;  2WQ8 A;  4J73 A;  2VC2 A;  2H3X A;  5FFO A;  4UI9 R;  2IUV A;  4JHP C;  2BCJ B;  4A0B A;  3FM0 A;  3SLE D;  2H9P A;  4QAM A;  1UTC A;  1C9L A;  2IAA A;  4J8G A;  4L9O A;  4KFM B;  2I0R A;  4X60 B;  4K3J B;  4IMM A;  1N6E A;  3EI1 A;  2VDP A;  4O45 A;  4PBY A;  5CXB A;  4BCD A;  5CXC B;  4J8B A;  3GRE A;  3MZK A;  1E8N A;  4E5Z A;  4ZOY A;  2J57 G;  4WK2 A;  5B4W A;  4IA9 A;  2Q7Q A;  3J81 g;  4ERY A;  2GC4 A;  4YVD A;  3JRP A;  2PM6 B;  2P9P C;  2EIB A;  5H14 A;  4AX4 A;  3JZG A;  3IJ0 A;  2P9S C;  3ORV D;  3NVX A;  1GOG A;  4ERQ A;  2VZ3 A;  4J0W A;  2IWK A;  3VH0 A;  5C2W B;  1VZ3 A;  4XYI A;  3T3P A;  5EM2 B;  3NIF A;  2J56 H;  3V5W B;  3UVK A;  3I89 A;  1H2Y A;  2CN2 A;  4G56 B;  1JV2 A;  4PSW B;  2J55 H;  3AL9 A;  1YR2 A;  2I0S A;  1H2W A;  5FA5 B;  4JT5 C;  1FWX A;  2BBK H;  4BH6 A;  2IUR A;  1U2V C;  4GM8 A;  5E6R A;  4O3T B;  5H17 A;  3PVW B;  2YNO A;  1U4C A;  2Z2O A;  4GMB A;  2YNP A;  5FXY A;  2OVP B;  1XKS A;  1MDA H;  2B5M A;  4E54 A;  1PEV A;  2VDK A;  5C86 A;  4A0A A;  2AGW A;  2PBI B;  3BWS A;  3ZDY A;  2XL3 A;  3I8E A;  3I7K A;  4NAA A;  3O4H A;  3VA6 A;  3ZE1 A;  3EI1 B;  1QFS A;  3JZN A;  5FKR A;  2B5N A;  3ZE2 A;  2GNQ A;  1B9Y A;  5C9Z B;  5FLX g;  4ES0 A;  4JD2 C;  4E5Z B;  3IJE A;  4N14 A;  3FRX A;  4LGN A;  3SBR A;  3GFC A;  3K6S A;  3F3P A;  3JPX A;  1MG3 A;  2VDL A;  4O1Q D;  2XL2 A;  2HJ4 A;  3ZE0 A;  3OKT A;  3DSM A;  2CE9 A;  1S4U X;  2W18 A;  4QT8 A;  5EMM B;  3EG6 A;  2VDO A;  3SCY A;  2H6K A;  5EAM A;  2HU7 A;  3IUN A;  4H5I A;  4CI1 A;  2BKL A;  3I7O A;  2B4E A;  3ZWL B;  2P9U C;  4TZ4 A;  4ZOV A;  2G9A A;  2TRC B;  4ESG A;  1C9I A;  1GG2 B;  3SWS D;  1JTD B;  1I2M B;  2PM9 A;  3MMY A;  1SHY B;  3RN1 D;  5EAL A;  3UR4 A;  2H6N A;  2XZG A;  2I3S A;  4X61 B;  4CY5 A;  4DNV A;  3NID A;  4BL0 A;  5M61 A;  3OTT A;  2VDR A;  2YMU A;  4X63 B;  5HYN B;  4XEI C;  3NIG A;  2HU8 A;  4LG9 A;  3EQ9 A;  4WK0 A;  3VI4 A;  4JXM A;  2IUQ A;  2VDQ A;  5JWZ A;  4GGC A;  5AMS A;  4A09 B;  1JJU B;  4AN1 A;  4JSP C;  4ZOX A;  5AFU 3;  1OMW B;  2G99 A;  4FAN D;  5CYK B;  5M5R A;  2EIE A;  4WK4 A;  3EI4 B;  4L1Q D;  3U4Y A;  5GXI A;  1SQ9 A;  3I7N A;  3RFG A; 
#chains in the Genus database with same CATH homology
 4Z7Q A;  3NID A;  4WJK A;  4NEN A;  3ZDY A;  3K72 A;  3FCU A;  4Z7O A;  2VDR A;  1JV2 A;  4Z7N A;  4MMZ A;  3K71 A;  2VDM A;  5E6U A;  3VI3 A;  3NIG A;  3ZE1 A;  1L5G A;  2VC2 A;  2VDO A;  4G1M A;  4WK2 A;  4MMX A;  3ZDZ A;  1U8C A;  4WK0 A;  5FFO A;  3ZE2 A;  3VI4 A;  2VDQ A;  3V4P A;  4UM9 A;  5E6R A;  4IRZ A;  5E6S A;  3ZDX A;  5FFG A;  1M1X A;  3IJE A;  1TYE A;  3FCS A;  4MMY A;  4O02 A;  2VDK A;  4UM8 A;  3K6S A;  5HDB A;  2VDL A;  4WK4 A;  3V4V A;  3ZE0 A;  3T3M A;  3T3P A;  2VDP A;  3NIF A;  4G1E A;  2VDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...