2VDKA

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 106
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdkA00
2VDMA 2VDKA 2VDRA 3NIDA 4MMYA 3K71A 4MMXA 5E6UA 3ZDXA 4Z7QA 3T3MA 5FFOA 3ZE0A 3K6SA 1L5GA 2VDNA 5HDBA 3T3PA 2VDLA 3VI3A 3V4PA 4WJKA 2VDOA 1TYEA 2VC2A 3FCSA 4MMZA 1M1XA 3NIGA 5E6SA 3IJEA 3ZE2A 2VDPA 4G1EA 3ZDYA 5E6RA 4G1MA 4NENA 4IRZA 3ZDZA 1U8CA 3FCUA 4Z7NA 4O02A 2VDQA 3ZE1A 4WK4A 4UM9A 5FFGA 3VI4A 4WK2A 3V4VA 4Z7OA 4WK0A 3K72A 3NIFA 1JV2A 4UM8A
chains in the Genus database with same CATH superfamily
1JJUB 3IJCA 5K1CC 3FRXA 1PEVA 3K6SA 3N0EA 4ZOVA 3MVDK 4RE6A 3VI3A 4A2LA 5H1MA 3RN1D 3PXTD 5EMJB 3SCYA 4G55A 5AFU3 1M1XA 5M5RA 2HKRA 1VYHC 1BPOA 4GM9A 1YFQA 4RE5A 3IJEA 3ZE2A 4OZUA 2YBAA 4G1EA 4NBMA 3MKQA 5E6RA 2I0RA 2IUVA 2HU8A 4X60B 3P4FA 1NR0A 1XKSA 3UVNA 5FXYA 2HU5A 4OWRA 1GP2B 4GQBB 2CE9A 3UVMA 5FKRA 3J81g 4O2WA 3C9CA 2VDKA 2Z2NA 3KRXB 3ZWLB 3ORVD 2IUQA 3EI2B 4E54A 3O4HA 4J82A 4BH6A 1H2ZA 3B7FA 4AMYA 4Z8LA 2EIBA 2WQ8A 3BG0A 4CZVA 4BL0A 3MMYA 4AEZA 5GSAA 2IURA 2P9PC 4G1MA 3EI2A 2AQ5A 2GC4A 4J81A 4NC4A 3IUMA 3DM0A 5THAA 5I5MA 3RN0D 2H3XA 4J0XA 3IJ1A 4MK0B 1JV2A 3I8CA 3K71A 5HE1B 4J87A 3T3MA 4E54B 5C2VB 4PBZA 2XZGA 2H9MA 5AMSA 3EMHA 3I2NA 4CY1A 2VDOA 3FCSA 2YB8B 4A0BB 3OTTA 4XEIC 4ERZA 1JMZB 4ERYA 1H2XA 1FWXA 1PGUA 2Q7QA 3NVQA 4JXMA 4IRZA 3GREA 3DXKC 5AJAA 4ESGA 4PSXB 3V5WB 1QFSA 2H9LA 2P9KC 3ZE1A 4FA4D 2OK4A 3F3GA 2QXVA 2O9KA 2HYEA 2AH0A 2IWFA 4J8BA 5M61A 3EQ8A 5EM2B 3ZE0A 3SLED 2GC7A 5TDHB 4A11A 4GZ8A 3GD1I 5M5TA 4CY2A 4YVDA 4A0AB 2OVPB 1K32A 4JT5C 5CXCA 2HJBA 3UVOA 5EM2A 4GQ2P 3J80g 2G9AA 5CXBA 4FAND 5GXIA 3IURA 4BUJC 1GXRA 4N14A 4CC9A 3PVUB 3I7OA 2H9PA 1A12A 3JAMg 1N6EA 4DNVA 4E5ZA 1L5GA 5CXBB 4CI2A 2P9UC 2XL2A 2OIZA 4K3JB 1NEXB 2HKMA 4DNUA 1P22A 1XHMA 4PC0A 3EU7A 4FA9D 4JHPC 3EI4B 2BBKH 3SHFA 4GM8A 3RFHA 2W18A 4WK4A 3I89A 5EAPA 5K19A 4Z7OA 4J86A 4WK0A 3K72A 4BCCA 3SWSD 2G99A 3RRMC 3O4GA 3MXXA 4MMXA 3AFCA 3F3FA 3VGZA 4IA9A 5HQGA 1B9XA 3V4PA 5IC7A 3JRPA 3QHYB 4A08A 4L3HD 4QQEA 4FA5D 4U1EI 3SVWD 4A7JA 5SXMA 4J0WA 2TRCB 4NENA 4XYIA 3ZDZA 5KDOB 2XU7A 4O02A 1E8NA 3BG1A 4L1MA 1MG3A 5EAMA 2GNQA 2I0TA 2XL3A 2UZXB 2JKXA 4A0AA 2H9NA 2CNXA 4L3GD 4FA1D 3CIKB 3IULA 4O3TB 4A0BA 2BKLA 2EICA 4ZOZA 3AL8B 1H2WA 3BWSA 3SMRA 1VE6A 4ZOYA 3K27A 2YNNA 3FCUA 4EWRA 1XIPA 3QI0A 3PXWD 2CN2A 2CN3A 2VDQA 4CI8A 4E5ZB 5C2WB 1RI6A 1UOPA 4UI9R 1JTDB 2IUPA 3OL2A 3OW8A 2J55H 4J79A 3IUJA 3KCIA 3AH8B 5HE3B 4FB1D 3EI4A 3NVXA 2OVRB 2B5LA 3SXTD 3IKOA 5C92A 1B9YA 4PNKB 5FA5B 4BP9A 5IGQA 1GG2B 2XE4A 4FAVD 4NSXA 3OKWA 1SHYB 1U4CA 3DSMA 3VI4A 1YR2A 3HFQA 4J73A 2CO0A 1PBYB 4QAMA 5CYKB 4O45A 1T2XA 3JPXA 1VZ3A 3I7LA 5FKSA 3OKYB 5HE2B 4JD2C 3W15A 4KFMB 1C9LA 3EWEA 4A2MA 4ZOXA 4K3ID 3EG6A 5HDBA 2Z2PA 3C5MA 3SN6B 4GGCA 4J8GA 5IT9g 2AGWA 4XYHA 4JSNC 4AMZA 4GGAA 5EARA 1QNIA 4I79A 4QL1A 3OKTA 4LG9A 3EI3A 4U7AA 2H6NA 3V7DB 1MDAH 1QFMA 3F3PA 1PI6A 3O4IA 1Q47A 3IJ0A 3UVLA 4MMYA 2VDRA 5FQDA 5E6UA 1SQJA 5FFOA 1VZ2A 3E0CA 2PM6B 3SFZA 3MUNA 3T3PA 4BCDA 2BCJB 1A0RB 1TYEA 3C99A 3MZLA 4NAAA 4AOWA 4D6VA 5C86A 2Z2OA 3NIGA 4AN0A 1JMXB 4DNWA 3DWLC 2AGYA 3IIYA 3MZKA 3EI1B 1U8CA 3SBPA 1OLZA 2OVQB 2H14A 2YNOA 4J84A 1SQ9A 4LG8A 3NIFA 3I7HA 3UVKA 3EI1A 2YMUA 4H5IA 2H47A 3L4MD 4Y5RD 5C9ZB 5EALA 1N6DA 1H2YA 5EMLB 3JZHA 3C75H 4L1QD 1C9IA 3KRWB 2OK6A 3EQ7A 3PSLA 3PE7A 3JZGA 4MMZA 5A2Qg 5E6SA 4PXWA 2B4EA 5CYKA 3SJLD 2HU7A 2HESX 2HXCA 3OKYA 3MKSB 4FHLA 4A08B 4JSVC 3IIWA 3GFCA 3PVWB 4QT8A 5IJ7E 2J56H 4X63B 3AL9A 4ERQA 2VDMA 3FM0A 3NIDA 1E5TA 3UKUC 4ZN4A 3ZDXA 4GGDA 2AGLA 3OF7A 4A09A 4TZ4A 4H5JA 3I7KA 1GOHA 3IUQA 4O9DA 3SBQA 5TF2A 4D9SA 4BP8A 1JOFA 2AGXA 2I3SA 1O6GA 3ZDYA 5GMKn 4JT6C 5H14A 4JSXC 3FGBA 4L9OA 1UOQA 5FKTA 4ES0A 1R5MA 5I5JA 3RMZD 3I7NA 2QZPA 5HYNB 3L4OD 5FKQA 2OJYA 1U2VC 3V4VA 3UKRC 4FWWA 3MUOA 4UM8A 2UZYB 2H6QA 2P9IC 4CI3A 2QR5A 5M5SA 4X61B 3ULEC 2VDNA 1TBGA 3O4JA 3CFVA 4J78A 2AGZA 2PBIB 2I3TA 5FLXg 4PBYA 1VE7A 4PSWB 2I0SA 3JROA 2B5NA 2VDPA 5I5IA 5IJ8E 1GOFA 2EIDA 4GM3A 2XYIA 5M5VA 1MG2A 2IWKA 3JB9L 4AN1A 4J77A 2P9NC 1O6FA 4Y7RA 2VZ1A 5HE0B 1OMWB 4Z7QA 2AH1A 2PM9B 2VDLA 2PM7B 3DXMC 3EQ9A 1I2MB 3PXSD 4AX4A 2VC2A 2P9LC 3I7PA 2VZ3A 3SBRA 1TYQC 4CI1A 2H13A 5TEFA 2B5MA 4LGNA 3NVNA 5M5UA 5H17A 1K8KC 4CZXA 3DDUA 4GMBA 5IGOA 1GOGA 2IAAA 2H6KA 3GC3B 4QRJA 1UTCA 3JZNA 3K26A 4WK2A 3RLMD 4O3UB 3EI3B 5CXCB 1ERJA 3RFGA 3IUNA 2CE8A 4GQ1A 4WJKA 4HDJA 3V9FA 4G56B 4O1QD 2H68A 3VA6A 3ODTA 2MTAH 3RSEC 4CY5A 4BCBA 5EMMB 3I8EA 1S4UX 5TEEA 3IVMA 4JSPC 1K3IA 1UOOA 3N0DA 2YNPA 4A11B 2EBSA 2EIEA 1GOTB 4R7AB 4X3EA 4IMMA 4CY3A 2XDWA 4A09B 5EMKB 3A0FA 2J57G 3OL2B 1N6FA 5JWZA 3U4YA 1E8MA 3UR4A 3AL8A 4Z7NA 4D0KA 5B4WA 2QC5A 4JHNA 2PM9A 3PSCB 4UM9A 5FFGA 5GXHA 1L0QA 2HJ4A 4CZYA 3VH0A 3CFSB 2P9SC 2CO0C
chains in the Genus database with same CATH topology
2VDMA 2VDKA 2VDRA 3NIDA 4MMYA 3K71A 4MMXA 5E6UA 3ZDXA 4Z7QA 3T3MA 5FFOA 3ZE0A 3K6SA 1L5GA 2VDNA 5HDBA 3T3PA 2VDLA 3VI3A 3V4PA 4WJKA 2VDOA 1TYEA 2VC2A 3FCSA 4MMZA 1M1XA 3NIGA 5E6SA 3IJEA 3ZE2A 2VDPA 4G1EA 3ZDYA 5E6RA 4G1MA 4NENA 4IRZA 3ZDZA 1U8CA 3FCUA 4Z7NA 4O02A 2VDQA 3ZE1A 4WK4A 4UM9A 5FFGA 3VI4A 4WK2A 3V4VA 4Z7OA 4WK0A 3K72A 3NIFA 1JV2A 4UM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDM A;  2VDK A;  2VDR A;  3NID A;  4MMY A;  3K71 A;  4MMX A;  5E6U A;  3ZDX A;  4Z7Q A;  3T3M A;  5FFO A;  3ZE0 A;  3K6S A;  1L5G A;  2VDN A;  5HDB A;  3T3P A;  2VDL A;  3VI3 A;  3V4P A;  4WJK A;  2VDO A;  1TYE A;  2VC2 A;  3FCS A;  4MMZ A;  1M1X A;  3NIG A;  5E6S A;  3IJE A;  3ZE2 A;  2VDP A;  4G1E A;  3ZDY A;  5E6R A;  4G1M A;  4NEN A;  4IRZ A;  3ZDZ A;  1U8C A;  3FCU A;  4Z7N A;  4O02 A;  2VDQ A;  3ZE1 A;  4WK4 A;  4UM9 A;  5FFG A;  3VI4 A;  4WK2 A;  3V4V A;  4Z7O A;  4WK0 A;  3K72 A;  3NIF A;  1JV2 A;  4UM8 A; 
#chains in the Genus database with same CATH topology
 1JJU B;  3IJC A;  5K1C C;  3FRX A;  1PEV A;  3K6S A;  3N0E A;  4ZOV A;  3MVD K;  4RE6 A;  3VI3 A;  4A2L A;  5H1M A;  3RN1 D;  3PXT D;  5EMJ B;  3SCY A;  4G55 A;  5AFU 3;  1M1X A;  5M5R A;  2HKR A;  1VYH C;  1BPO A;  4GM9 A;  1YFQ A;  4RE5 A;  3IJE A;  3ZE2 A;  4OZU A;  2YBA A;  4G1E A;  4NBM A;  3MKQ A;  5E6R A;  2I0R A;  2IUV A;  2HU8 A;  4X60 B;  3P4F A;  1NR0 A;  1XKS A;  3UVN A;  5FXY A;  2HU5 A;  4OWR A;  1GP2 B;  4GQB B;  2CE9 A;  3UVM A;  5FKR A;  3J81 g;  4O2W A;  3C9C A;  2VDK A;  2Z2N A;  3KRX B;  3ZWL B;  3ORV D;  2IUQ A;  3EI2 B;  4E54 A;  3O4H A;  4J82 A;  4BH6 A;  1H2Z A;  3B7F A;  4AMY A;  4Z8L A;  2EIB A;  2WQ8 A;  3BG0 A;  4CZV A;  4BL0 A;  3MMY A;  4AEZ A;  5GSA A;  2IUR A;  2P9P C;  4G1M A;  3EI2 A;  2AQ5 A;  2GC4 A;  4J81 A;  4NC4 A;  3IUM A;  3DM0 A;  5THA A;  5I5M A;  3RN0 D;  2H3X A;  4J0X A;  3IJ1 A;  4MK0 B;  1JV2 A;  3I8C A;  3K71 A;  5HE1 B;  4J87 A;  3T3M A;  4E54 B;  5C2V B;  4PBZ A;  2XZG A;  2H9M A;  5AMS A;  3EMH A;  3I2N A;  4CY1 A;  2VDO A;  3FCS A;  2YB8 B;  4A0B B;  3OTT A;  4XEI C;  4ERZ A;  1JMZ B;  4ERY A;  1H2X A;  1FWX A;  1PGU A;  2Q7Q A;  3NVQ A;  4JXM A;  4IRZ A;  3GRE A;  3DXK C;  5AJA A;  4ESG A;  4PSX B;  3V5W B;  1QFS A;  2H9L A;  2P9K C;  3ZE1 A;  4FA4 D;  2OK4 A;  3F3G A;  2QXV A;  2O9K A;  2HYE A;  2AH0 A;  2IWF A;  4J8B A;  5M61 A;  3EQ8 A;  5EM2 B;  3ZE0 A;  3SLE D;  2GC7 A;  5TDH B;  4A11 A;  4GZ8 A;  3GD1 I;  5M5T A;  4CY2 A;  4YVD A;  4A0A B;  2OVP B;  1K32 A;  4JT5 C;  5CXC A;  2HJB A;  3UVO A;  5EM2 A;  4GQ2 P;  3J80 g;  2G9A A;  5CXB A;  4FAN D;  5GXI A;  3IUR A;  4BUJ C;  1GXR A;  4N14 A;  4CC9 A;  3PVU B;  3I7O A;  2H9P A;  1A12 A;  3JAM g;  1N6E A;  4DNV A;  4E5Z A;  1L5G A;  5CXB B;  4CI2 A;  2P9U C;  2XL2 A;  2OIZ A;  4K3J B;  1NEX B;  2HKM A;  4DNU A;  1P22 A;  1XHM A;  4PC0 A;  3EU7 A;  4FA9 D;  4JHP C;  3EI4 B;  2BBK H;  3SHF A;  4GM8 A;  3RFH A;  2W18 A;  4WK4 A;  3I89 A;  5EAP A;  5K19 A;  4Z7O A;  4J86 A;  4WK0 A;  3K72 A;  4BCC A;  3SWS D;  2G99 A;  3RRM C;  3O4G A;  3MXX A;  4MMX A;  3AFC A;  3F3F A;  3VGZ A;  4IA9 A;  5HQG A;  1B9X A;  3V4P A;  5IC7 A;  3JRP A;  3QHY B;  4A08 A;  4L3H D;  4QQE A;  4FA5 D;  4U1E I;  3SVW D;  4A7J A;  5SXM A;  4J0W A;  2TRC B;  4NEN A;  4XYI A;  3ZDZ A;  5KDO B;  2XU7 A;  4O02 A;  1E8N A;  3BG1 A;  4L1M A;  1MG3 A;  5EAM A;  2GNQ A;  2I0T A;  2XL3 A;  2UZX B;  2JKX A;  4A0A A;  2H9N A;  2CNX A;  4L3G D;  4FA1 D;  3CIK B;  3IUL A;  4O3T B;  4A0B A;  2BKL A;  2EIC A;  4ZOZ A;  3AL8 B;  1H2W A;  3BWS A;  3SMR A;  1VE6 A;  4ZOY A;  3K27 A;  2YNN A;  3FCU A;  4EWR A;  1XIP A;  3QI0 A;  3PXW D;  2CN2 A;  2CN3 A;  2VDQ A;  4CI8 A;  4E5Z B;  5C2W B;  1RI6 A;  1UOP A;  4UI9 R;  1JTD B;  2IUP A;  3OL2 A;  3OW8 A;  2J55 H;  4J79 A;  3IUJ A;  3KCI A;  3AH8 B;  5HE3 B;  4FB1 D;  3EI4 A;  3NVX A;  2OVR B;  2B5L A;  3SXT D;  3IKO A;  5C92 A;  1B9Y A;  4PNK B;  5FA5 B;  4BP9 A;  5IGQ A;  1GG2 B;  2XE4 A;  4FAV D;  4NSX A;  3OKW A;  1SHY B;  1U4C A;  3DSM A;  3VI4 A;  1YR2 A;  3HFQ A;  4J73 A;  2CO0 A;  1PBY B;  4QAM A;  5CYK B;  4O45 A;  1T2X A;  3JPX A;  1VZ3 A;  3I7L A;  5FKS A;  3OKY B;  5HE2 B;  4JD2 C;  3W15 A;  4KFM B;  1C9L A;  3EWE A;  4A2M A;  4ZOX A;  4K3I D;  3EG6 A;  5HDB A;  2Z2P A;  3C5M A;  3SN6 B;  4GGC A;  4J8G A;  5IT9 g;  2AGW A;  4XYH A;  4JSN C;  4AMZ A;  4GGA A;  5EAR A;  1QNI A;  4I79 A;  4QL1 A;  3OKT A;  4LG9 A;  3EI3 A;  4U7A A;  2H6N A;  3V7D B;  1MDA H;  1QFM A;  3F3P A;  1PI6 A;  3O4I A;  1Q47 A;  3IJ0 A;  3UVL A;  4MMY A;  2VDR A;  5FQD A;  5E6U A;  1SQJ A;  5FFO A;  1VZ2 A;  3E0C A;  2PM6 B;  3SFZ A;  3MUN A;  3T3P A;  4BCD A;  2BCJ B;  1A0R B;  1TYE A;  3C99 A;  3MZL A;  4NAA A;  4AOW A;  4D6V A;  5C86 A;  2Z2O A;  3NIG A;  4AN0 A;  1JMX B;  4DNW A;  3DWL C;  2AGY A;  3IIY A;  3MZK A;  3EI1 B;  1U8C A;  3SBP A;  1OLZ A;  2OVQ B;  2H14 A;  2YNO A;  4J84 A;  1SQ9 A;  4LG8 A;  3NIF A;  3I7H A;  3UVK A;  3EI1 A;  2YMU A;  4H5I A;  2H47 A;  3L4M D;  4Y5R D;  5C9Z B;  5EAL A;  1N6D A;  1H2Y A;  5EML B;  3JZH A;  3C75 H;  4L1Q D;  1C9I A;  3KRW B;  2OK6 A;  3EQ7 A;  3PSL A;  3PE7 A;  3JZG A;  4MMZ A;  5A2Q g;  5E6S A;  4PXW A;  2B4E A;  5CYK A;  3SJL D;  2HU7 A;  2HES X;  2HXC A;  3OKY A;  3MKS B;  4FHL A;  4A08 B;  4JSV C;  3IIW A;  3GFC A;  3PVW B;  4QT8 A;  5IJ7 E;  2J56 H;  4X63 B;  3AL9 A;  4ERQ A;  2VDM A;  3FM0 A;  3NID A;  1E5T A;  3UKU C;  4ZN4 A;  3ZDX A;  4GGD A;  2AGL A;  3OF7 A;  4A09 A;  4TZ4 A;  4H5J A;  3I7K A;  1GOH A;  3IUQ A;  4O9D A;  3SBQ A;  5TF2 A;  4D9S A;  4BP8 A;  1JOF A;  2AGX A;  2I3S A;  1O6G A;  3ZDY A;  5GMK n;  4JT6 C;  5H14 A;  4JSX C;  3FGB A;  4L9O A;  1UOQ A;  5FKT A;  4ES0 A;  1R5M A;  5I5J A;  3RMZ D;  3I7N A;  2QZP A;  5HYN B;  3L4O D;  5FKQ A;  2OJY A;  1U2V C;  3V4V A;  3UKR C;  4FWW A;  3MUO A;  4UM8 A;  2UZY B;  2H6Q A;  2P9I C;  4CI3 A;  2QR5 A;  5M5S A;  4X61 B;  3ULE C;  2VDN A;  1TBG A;  3O4J A;  3CFV A;  4J78 A;  2AGZ A;  2PBI B;  2I3T A;  5FLX g;  4PBY A;  1VE7 A;  4PSW B;  2I0S A;  3JRO A;  2B5N A;  2VDP A;  5I5I A;  5IJ8 E;  1GOF A;  2EID A;  4GM3 A;  2XYI A;  5M5V A;  1MG2 A;  2IWK A;  3JB9 L;  4AN1 A;  4J77 A;  2P9N C;  1O6F A;  4Y7R A;  2VZ1 A;  5HE0 B;  1OMW B;  4Z7Q A;  2AH1 A;  2PM9 B;  2VDL A;  2PM7 B;  3DXM C;  3EQ9 A;  1I2M B;  3PXS D;  4AX4 A;  2VC2 A;  2P9L C;  3I7P A;  2VZ3 A;  3SBR A;  1TYQ C;  4CI1 A;  2H13 A;  5TEF A;  2B5M A;  4LGN A;  3NVN A;  5M5U A;  5H17 A;  1K8K C;  4CZX A;  3DDU A;  4GMB A;  5IGO A;  1GOG A;  2IAA A;  2H6K A;  3GC3 B;  4QRJ A;  1UTC A;  3JZN A;  3K26 A;  4WK2 A;  3RLM D;  4O3U B;  3EI3 B;  5CXC B;  1ERJ A;  3RFG A;  3IUN A;  2CE8 A;  4GQ1 A;  4WJK A;  4HDJ A;  3V9F A;  4G56 B;  4O1Q D;  2H68 A;  3VA6 A;  3ODT A;  2MTA H;  3RSE C;  4CY5 A;  4BCB A;  5EMM B;  3I8E A;  1S4U X;  5TEE A;  3IVM A;  4JSP C;  1K3I A;  1UOO A;  3N0D A;  2YNP A;  4A11 B;  2EBS A;  2EIE A;  1GOT B;  4R7A B;  4X3E A;  4IMM A;  4CY3 A;  2XDW A;  4A09 B;  5EMK B;  3A0F A;  2J57 G;  3OL2 B;  1N6F A;  5JWZ A;  3U4Y A;  1E8M A;  3UR4 A;  3AL8 A;  4Z7N A;  4D0K A;  5B4W A;  2QC5 A;  4JHN A;  2PM9 A;  3PSC B;  4UM9 A;  5FFG A;  5GXH A;  1L0Q A;  2HJ4 A;  4CZY A;  3VH0 A;  3CFS B;  2P9S C;  2CO0 C; 
#chains in the Genus database with same CATH homology
 2VDM A;  2VDK A;  2VDR A;  3NID A;  4MMY A;  3K71 A;  4MMX A;  5E6U A;  3ZDX A;  4Z7Q A;  3T3M A;  5FFO A;  3ZE0 A;  3K6S A;  1L5G A;  2VDN A;  5HDB A;  3T3P A;  2VDL A;  3VI3 A;  3V4P A;  4WJK A;  2VDO A;  1TYE A;  2VC2 A;  3FCS A;  4MMZ A;  1M1X A;  3NIG A;  5E6S A;  3IJE A;  3ZE2 A;  2VDP A;  4G1E A;  3ZDY A;  5E6R A;  4G1M A;  4NEN A;  4IRZ A;  3ZDZ A;  1U8C A;  3FCU A;  4Z7N A;  4O02 A;  2VDQ A;  3ZE1 A;  4WK4 A;  4UM9 A;  5FFG A;  3VI4 A;  4WK2 A;  3V4V A;  4Z7O A;  4WK0 A;  3K72 A;  3NIF A;  1JV2 A;  4UM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...