2YNOA

Yeast betaprime cop 1-304h6
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
310
Chain Sequence
b'MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLGNDEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COATOMER SUBUNIT BETA'
publication title Molecular Basis for Recognition of Dilysine Trafficking Motifs by Copi.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 90
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ynoA01
4A08A 3IJ0A 2OIZA 3SBPA 2H6QA 4IMMA 3F3FA 4KFMB 5HE0B 1N6DA 3I7NA 3FM0A 4J78A 3CIKB 2CO0A 5CXBA 5TEFA 4X61B 1R5MA 3JZGA 3CFVA 1OMWB 2B4EA 3OTTA 4OWRA 4ZOYA 3K27A 5EALA 3N0DA 3OL2B 1JJUB 1XHMA 3MKSB 4ERYA 3JROA 3NVXA 1QNIA 2P9SC 5EMKB 4CY5A 2YBAA 4A08B 4D0KA 1NEXB 1U4CA 2H68A 4PNKB 2PM6B 3CFSB 4H5JA 1K32A 2OVQB 3UKRC 3OKYA 3SVWD 3C75H 3RFHA 1PI6A 1N6EA 1XKSA 3DM0A 3OKWA 1GXRA 4GGCA 2IURA 5EAPA 3EG6A 2I0TA 2UZXB 4PBYA 4FA4D 5KDOB 3JZNA 4X63B 4Y5RD 3SN6B 3SBRA 3JRPA 4CY2A 4PBZA 5FQDA 3I7KA 2H14A 4A2MA 5B4WA 3PSCB 4G56B 2IUQA 2IUVA 3MXXA 2P9PC 3OKYB 5HE1B 3EI3A 3RMZD 1JMXB 3BG0A 1GP2B 4CZXA 5GSAA 3U4YA 4JSVC 4A09A 3IKOA 3KRWB 1P22A 3EMHA 5HQGA 1XIPA 4J0XA 3PVUB 4BH6A 4JSPC 4ERQA 3SCYA 4U7AA 3K26A 3N0EA 2P9UC 4JSNC 2P9KC 3EU7A 3MMYA 3L4MD 3SJLD 3F3GA 3PXSD 4FB1D 2Z2NA 3JPXA 2Z2PA 5EMJB 3FRXA 3SWSD 3I7OA 4PSXB 3GFCA 4QQEA 1SQJA 4N14A 5EARA 2B5MA 2CN3A 5IC7A 4CY3A 4K3ID 4D6VA 2J56H 2PM9A 4A11B 4ESGA 5IJ7E 1MG2A 2I0SA 4GM9A 3EI1A 2PM7B 5CXCB 4X3EA 3RN0D 2G9AA 2TRCB 2I3TA 4R7AB 4GZ8A 4LGNA 3J81g 4IA9A 4BL0A 4J8BA 5H17A 2H13A 5THAA 4PC0A 1MG3A 1MDAH 3AL8B 3MZKA 3GREA 5FLXg 4FA9D 5CYKA 4O45A 2XL2A 5K1CC 4J0WA 4LG9A 4QL1A 2PM9B 5TEEA 2H9NA 2H9PA 1U2VC 3UVMA 3E0CA 4QRJA 3W15A 4CI1A 4AEZA 3SMRA 4A7JA 2H3XA 2IWFA 3KRXB 2OK6A 3UVKA 3EI1B 4CI8A 4JT6C 5EMMB 5K19A 3UKUC 5CXBB 4J8GA 2UZYB 5C2WB 2XU7A 3AL9A 1PEVA 4K3JB 3J80g 3I7LA 3I7PA 4FHLA 4BUJC 1NR0A 5FKRA 4GGAA 4FWWA 1N6FA 5AMSA 2GC7A 2OJYA 2H6NA 3PXWD 4J81A 4X60B 1S4UX 3C99A 5EM2A 5HE2B 1B9YA 3ZWLB 3IJ1A 1SQ9A 5IJ8E 3V5WB 3JAMg 1RI6A 5GXHA 2AGWA 4J87A 4CZVA 5AFU3 4QT8A 2AH0A 2J57G 2HJBA 3IJCA 1PGUA 3UVOA 4YVDA 4A2LA 1ERJA 2HKMA 3HFQA 5I5MA 1OLZA 4A0AA 1L0QA 5GXIA 5I5IA 5TF2A 2I0RA 3DXKC 3I7HA 3I2NA 4E54A 5FKQA 1A0RB 3AFCA 2Q7QA 1JMZB 3EI3B 2EBSA 4MK0B 3SBQA 3B7FA 4O3TB 3RRMC 3VH0A 1B9XA 1SHYB 3EI4A 2AQ5A 3EI2A 3L4OD 4L1QD 4PXWA 4A09B 1K8KC 2P9LC 3JB9L 4JD2C 3NVQA 3VA6A 1GOTB 2H47A 5FKSA 4J82A 4FA5D 4FAVD 4ZN4A 3I8CA 3ODTA 1Q47A 5IT9g 4TZ4A 4Y7RA 3DWLC 4ZOXA 4E54B 2AGZA 3BWSA 3SFZA 2YNNA 3PXTD 5EAMA 2YMUA 3IIWA 3I8EA 5C2VB 2AGXA 2YB8B 2I3SA 2YNPA 1PBYB 2BBKH 4GM8A 3BG1A 3EI4B 4J77A 2B5LA 2H9LA 3IIYA 3V9FA 2Z2OA 5SXMA 3OL2A 5HE3B 5C9ZB 3UR4A 2P9NC 4GGDA 4XYIA 4EWRA 2XL3A 3ORVD 4XYHA 5AJAA 2IAAA 2CO0C 2CE8A 4ES0A 2CNXA 3P4FA 4H5IA 2PBIB 1FWXA 2AGLA 2MTAH 3A0FA 4LG8A 4ZOZA 4Z8LA 4I79A 4NSXA 2H9MA 5H1MA 5IGQA 2QXVA 4ZOVA 4U1EI 5CYKB 4CY1A 4JT5C 2P9IC 1YFQA 4JXMA 4AOWA 2QC5A 2J55H 2B5NA 4UI9R 5IGOA 4JSXC 4O9DA 4GMBA 3RLMD 1VYHC 3UVNA 2CE9A 5H14A 3DSMA 4GM3A 2HJ4A 2HESX 2O9KA 4FAND 3RN1D 5TDHB 3V7DB 4L3GD 4A0BA 2HXCA 4ERZA 5I5JA 4CC9A 2HYEA 1TBGA 4HDJA 2OVRB 4L3HD 4FA1D 5EM2B 2AGYA 2IUPA 4E5ZA 2OVPB 2H6KA 3C9CA 4CI2A 5FKTA 1TYQC 3PVWB 3EWEA 3PE7A 2W18A 2GC4A 3MKQA 4J86A 3OW8A 5HYNB 4XEIC 2G99A 3SHFA 3UVLA 3AH8B 4J84A 4PSWB 4A0BB 4A0AB 4L9OA 2YNOA 2OK4A 4A11A 2GNQA 3MZLA 3RFGA 2CN2A 2AH1A 3JZHA 3ULEC 5CXCA 2BCJB 5EMLB 4E5ZB 4J73A 3DXMC 4O3UB 4OZUA 3VGZA 5A2Qg 1JOFA 1GG2B 2IWKA 3AL8A 5FXYA 4CZYA 3PSLA 4J79A 3C5MA 5FA5B 3RSEC 3SLED 3EI2B 4GQ1A 5JWZA 4O1QD 3NVNA 2XYIA 3FGBA 3F3PA 2HKRA 4GQ2P 3OKTA 5GMKn 4CI3A 3SXTD 4GQBB 3I89A
chains in the Genus database with same CATH superfamily
4A08A 3IJ0A 3EQ7A 4WK0A 2OIZA 3SBPA 2H6QA 1JTDB 1A12A 4IMMA 3F3FA 4KFMB 5HE0B 1N6DA 3I7NA 3FM0A 3ZE2A 3IJEA 4J78A 3CIKB 2CO0A 5CXBA 5TEFA 4X61B 1M1XA 4MMYA 1R5MA 3JZGA 5M5SA 3CFVA 1OMWB 2B4EA 3OTTA 4OWRA 4ZOYA 2VDPA 3K27A 5EALA 4Z7NA 5M5UA 3N0DA 3OL2B 1JJUB 1XHMA 3MKSB 4ERYA 3JROA 3NVXA 1QNIA 2P9SC 5EMKB 4CY5A 4G1EA 2YBAA 4A08B 4D0KA 1NEXB 3ZDYA 1U4CA 4G55A 2H68A 4PNKB 2XZGA 2PM6B 3CFSB 3NIFA 4H5JA 1K32A 2OVQB 3UKRC 3OKYA 3SVWD 3C75H 3RFHA 1PI6A 1N6EA 1XKSA 3DM0A 3OKWA 1GXRA 2WQ8A 4GGCA 2IURA 2VZ3A 4BCCA 3O4GA 5EAPA 3EG6A 2I0TA 2UZXB 4PBYA 4FA4D 5KDOB 4RE5A 3JZNA 4X63B 4Y5RD 1H2WA 3SN6B 3SBRA 3JRPA 4CY2A 4PBZA 5FQDA 3I7KA 2H14A 4A2MA 5B4WA 3PSCB 4G56B 2IUQA 2IUVA 3MXXA 2EICA 2P9PC 3OKYB 5HE1B 3EI3A 3RMZD 2VDLA 1JMXB 3BG0A 1GP2B 4CZXA 5GSAA 3U4YA 4JSVC 4A09A 2BKLA 3IKOA 3KRWB 1P22A 3EMHA 5HQGA 3MUOA 1XIPA 4J0XA 3PVUB 3NIGA 4BH6A 4JSPC 4ERQA 3SCYA 4U7AA 3K26A 1VE6A 2VC2A 3N0EA 1UOOA 2P9UC 4JSNC 4BCDA 2P9KC 4UM9A 3EU7A 3MMYA 3L4MD 3SJLD 3F3GA 4WK4A 3PXSD 4FB1D 2Z2NA 3JPXA 2Z2PA 4RE6A 5EMJB 1UTCA 2XDWA 3FRXA 3SWSD 3I7OA 4PSXB 3GFCA 4QQEA 1SQJA 4N14A 5EARA 4DNWA 2B5MA 1C9LA 2CN3A 5IC7A 4CY3A 4K3ID 4D6VA 2J56H 3KCIA 4NAAA 3IUMA 1QFMA 1K3IA 2PM9A 1E8MA 4A11B 4ESGA 1GOHA 5IJ7E 1MG2A 2I0SA 4GM9A 4MMXA 3EI1A 1U8CA 2PM7B 2VDMA 3MUNA 5CXCB 4X3EA 3ZE0A 4WK2A 3RN0D 2G9AA 2TRCB 2I3TA 4R7AB 4GZ8A 4LGNA 3J81g 4IA9A 4BL0A 4J8BA 5H17A 2H13A 5THAA 4PC0A 3T3PA 1MG3A 1MDAH 3AL8B 1I2MB 3GREA 3MZKA 5FLXg 4FA9D 5CYKA 4O45A 1E8NA 2XL2A 4UM8A 5K1CC 4O2WA 3IUNA 4J0WA 1BPOA 4LG9A 4QL1A 3K72A 1UOPA 2PM9B 3IURA 5TEEA 4AN1A 2H9NA 2H9PA 3V4PA 1U2VC 3UVMA 3E0CA 4QRJA 3W15A 4CI1A 4AEZA 3SMRA 4A7JA 2H3XA 2IWFA 3KRXB 2OK6A 3UVKA 3EI1B 4CI8A 3O4HA 4JT6C 5EMMB 5K19A 1H2XA 3UKUC 2VDOA 5CXBB 4J8GA 5M61A 5M5VA 2UZYB 5C2WB 2XU7A 3AL9A 1PEVA 4K3JB 3J80g 3I7LA 4IRZA 3I7PA 4FHLA 1VZ2A 4BUJC 1NR0A 5FKRA 1QFSA 4GGAA 4FWWA 1VZ3A 3EQ8A 1N6FA 5AMSA 2GC7A 3IUJA 4NBMA 5FFOA 2OJYA 2H6NA 3PXWD 4J81A 4X60B 1S4UX 3O4IA 3C99A 5EM2A 5HE2B 1B9YA 3ZWLB 2QR5A 3IJ1A 4JHPC 1SQ9A 2JKXA 5IJ8E 5E6UA 3IULA 3GD1I 3V5WB 1GOGA 1H2YA 3JAMg 1RI6A 4AN0A 5FFGA 5GXHA 1YR2A 2AGWA 4J87A 4CZVA 5AFU3 4QT8A 2AH0A 2J57G 2HJBA 3IJCA 1PGUA 3UVOA 4YVDA 4A2LA 1ERJA 2HKMA 3HFQA 5I5MA 1OLZA 4A0AA 1L0QA 5GXIA 5I5IA 5TF2A 2I0RA 4AMYA 3DXKC 5C86A 3I7HA 3I2NA 2XE4A 1O6GA 4E54A 5FKQA 1A0RB 3AFCA 4JHNA 2Q7QA 1JMZB 3EI3B 2EBSA 4MK0B 3SBQA 3B7FA 4O3TB 3RRMC 3VH0A 1B9XA 2VDNA 4G1MA 1SHYB 3EI4A 5E6RA 2AQ5A 3EI2A 1E5TA 2VDRA 3L4OD 4L1QD 4PXWA 4A09B 1K8KC 3MVDK 2P9LC 3JB9L 4JD2C 3NVQA 5M5RA 3VA6A 1GOTB 2H47A 5FKSA 4J82A 4FA5D 4FAVD 4ZN4A 3I8CA 3ODTA 1Q47A 5IT9g 2HU7A 3IVMA 4TZ4A 4Y7RA 3DWLC 3GC3B 4ZOXA 4E54B 2AGZA 2HU5A 1L5GA 3BWSA 2EIBA 2YNNA 3SFZA 3PXTD 5EAMA 2YMUA 3IIWA 3I8EA 5C2VB 2AGXA 2YB8B 2I3SA 2YNPA 1PBYB 2BBKH 4GM8A 3BG1A 4NENA 3EI4B 4J77A 2B5LA 2H9LA 1GOFA 3IIYA 3V9FA 2VZ1A 4DNVA 2Z2OA 5SXMA 3OL2A 5HE3B 5C9ZB 3EQ9A 3UR4A 4BCBA 2P9NC 4GGDA 4XYIA 4EWRA 2XL3A 3ORVD 4XYHA 5AJAA 4AX4A 5C92A 2IAAA 4D9SA 2CO0C 2CE8A 4ES0A 2CNXA 3P4FA 1UOQA 4MMZA 4QAMA 2QZPA 4H5IA 2PBIB 1FWXA 2AGLA 2MTAH 3A0FA 4LG8A 4ZOZA 4Z8LA 4I79A 4NSXA 2H9MA 5H1MA 5IGQA 2QXVA 4ZOVA 4U1EI 5CYKB 2VDQA 3FCUA 2EIDA 4CY1A 5E6SA 4JT5C 2P9IC 1YFQA 4JXMA 4AOWA 2QC5A 1T2XA 3NIDA 2J55H 2B5NA 1JV2A 4UI9R 5IGOA 4JSXC 4O9DA 4GMBA 4DNUA 3RLMD 2VDKA 1VYHC 1O6FA 3UVNA 2CE9A 4O02A 4NC4A 5H14A 3DSMA 4GM3A 2EIEA 5HDBA 2HJ4A 2HESX 4AMZA 2O9KA 4FAND 3RN1D 5TDHB 3V7DB 3VI3A 4L3GD 2HU8A 4A0BA 1TYEA 2HXCA 4ERZA 5I5JA 4CC9A 3ZE1A 2HYEA 1TBGA 4HDJA 2OVRB 4L3HD 4FA1D 5EM2B 2AGYA 2IUPA 3ZDZA 4E5ZA 2OVPB 3OF7A 2H6KA 3C9CA 3DDUA 4CI2A 5FKTA 3K71A 1TYQC 3V4VA 4BP9A 3PVWB 3EWEA 4Z7QA 3PE7A 2W18A 2GC4A 3MKQA 4J86A 3OW8A 5HYNB 4XEIC 2G99A 3SHFA 3UVLA 3AH8B 4J84A 4PSWB 4A0BB 4A0AB 4L9OA 2YNOA 2OK4A 4A11A 1C9IA 2GNQA 3FCSA 3MZLA 3RFGA 2CN2A 4WJKA 2AH1A 3T3MA 3JZHA 5M5TA 3ULEC 5CXCA 4BP8A 2BCJB 1VE7A 5EMLB 4L1MA 3QHYB 3IUQA 4E5ZB 4J73A 3DXMC 4O3UB 4OZUA 3VGZA 5A2Qg 1JOFA 3VI4A 1GG2B 2IWKA 3AL8A 5FXYA 4CZYA 3PSLA 4J79A 3QI0A 3C5MA 5FA5B 3RSEC 3SLED 3EI2B 4GQ1A 3ZDXA 5JWZA 4O1QD 3NVNA 2XYIA 3FGBA 1H2ZA 3O4JA 3F3PA 4Z7OA 2HKRA 4GQ2P 3OKTA 5GMKn 4CI3A 3SXTD 3K6SA 4GQBB 3I89A
chains in the Genus database with same CATH topology
4A08A 3IJ0A 2OIZA 3SBPA 2H6QA 4IMMA 3F3FA 4KFMB 5HE0B 1N6DA 3I7NA 3FM0A 4J78A 3CIKB 2CO0A 5CXBA 5TEFA 4X61B 1R5MA 3JZGA 3CFVA 1OMWB 2B4EA 3OTTA 4OWRA 4ZOYA 3K27A 5EALA 3N0DA 3OL2B 1JJUB 1XHMA 3MKSB 4ERYA 3JROA 3NVXA 1QNIA 2P9SC 5EMKB 4CY5A 2YBAA 4A08B 4D0KA 1NEXB 1U4CA 2H68A 4PNKB 2PM6B 3CFSB 4H5JA 1K32A 2OVQB 3UKRC 3OKYA 3SVWD 3C75H 3RFHA 1PI6A 1N6EA 1XKSA 3DM0A 3OKWA 1GXRA 4GGCA 2IURA 5EAPA 3EG6A 2I0TA 2UZXB 4PBYA 4FA4D 5KDOB 3JZNA 4X63B 4Y5RD 3SN6B 3SBRA 3JRPA 4CY2A 4PBZA 5FQDA 3I7KA 2H14A 4A2MA 5B4WA 3PSCB 4G56B 2IUQA 2IUVA 3MXXA 2P9PC 3OKYB 5HE1B 3EI3A 3RMZD 1JMXB 3BG0A 1GP2B 4CZXA 5GSAA 3U4YA 4JSVC 4A09A 3IKOA 3KRWB 1P22A 3EMHA 5HQGA 1XIPA 4J0XA 3PVUB 4BH6A 4JSPC 4ERQA 3SCYA 4U7AA 3K26A 3N0EA 2P9UC 4JSNC 2P9KC 3EU7A 3MMYA 3L4MD 3SJLD 3F3GA 3PXSD 4FB1D 2Z2NA 3JPXA 2Z2PA 5EMJB 3FRXA 3SWSD 3I7OA 4PSXB 3GFCA 4QQEA 1SQJA 4N14A 5EARA 2B5MA 2CN3A 5IC7A 4CY3A 4K3ID 4D6VA 2J56H 2PM9A 4A11B 4ESGA 5IJ7E 1MG2A 2I0SA 4GM9A 3EI1A 2PM7B 5CXCB 4X3EA 3RN0D 2G9AA 2TRCB 2I3TA 4R7AB 4GZ8A 4LGNA 3J81g 4IA9A 4BL0A 4J8BA 5H17A 2H13A 5THAA 4PC0A 1MG3A 1MDAH 3AL8B 3MZKA 3GREA 5FLXg 4FA9D 5CYKA 4O45A 2XL2A 5K1CC 4J0WA 4LG9A 4QL1A 2PM9B 5TEEA 2H9NA 2H9PA 1U2VC 3UVMA 3E0CA 4QRJA 3W15A 4CI1A 4AEZA 3SMRA 4A7JA 2H3XA 2IWFA 3KRXB 2OK6A 3UVKA 3EI1B 4CI8A 4JT6C 5EMMB 5K19A 3UKUC 5CXBB 4J8GA 2UZYB 5C2WB 2XU7A 3AL9A 1PEVA 4K3JB 3J80g 3I7LA 3I7PA 4FHLA 4BUJC 1NR0A 5FKRA 4GGAA 4FWWA 1N6FA 5AMSA 2GC7A 2OJYA 2H6NA 3PXWD 4J81A 4X60B 1S4UX 3C99A 5EM2A 5HE2B 1B9YA 3ZWLB 3IJ1A 1SQ9A 5IJ8E 3V5WB 3JAMg 1RI6A 5GXHA 2AGWA 4J87A 4CZVA 5AFU3 4QT8A 2AH0A 2J57G 2HJBA 3IJCA 1PGUA 3UVOA 4YVDA 4A2LA 1ERJA 2HKMA 3HFQA 5I5MA 1OLZA 4A0AA 1L0QA 5GXIA 5I5IA 5TF2A 2I0RA 3DXKC 3I7HA 3I2NA 4E54A 5FKQA 1A0RB 3AFCA 2Q7QA 1JMZB 3EI3B 2EBSA 4MK0B 3SBQA 3B7FA 4O3TB 3RRMC 3VH0A 1B9XA 1SHYB 3EI4A 2AQ5A 3EI2A 3L4OD 4L1QD 4PXWA 4A09B 1K8KC 2P9LC 3JB9L 4JD2C 3NVQA 3VA6A 1GOTB 2H47A 5FKSA 4J82A 4FA5D 4FAVD 4ZN4A 3I8CA 3ODTA 1Q47A 5IT9g 4TZ4A 4Y7RA 3DWLC 4ZOXA 4E54B 2AGZA 3BWSA 3SFZA 2YNNA 3PXTD 5EAMA 2YMUA 3IIWA 3I8EA 5C2VB 2AGXA 2YB8B 2I3SA 2YNPA 1PBYB 2BBKH 4GM8A 3BG1A 3EI4B 4J77A 2B5LA 2H9LA 3IIYA 3V9FA 2Z2OA 5SXMA 3OL2A 5HE3B 5C9ZB 3UR4A 2P9NC 4GGDA 4XYIA 4EWRA 2XL3A 3ORVD 4XYHA 5AJAA 2IAAA 2CO0C 2CE8A 4ES0A 2CNXA 3P4FA 4H5IA 2PBIB 1FWXA 2AGLA 2MTAH 3A0FA 4LG8A 4ZOZA 4Z8LA 4I79A 4NSXA 2H9MA 5H1MA 5IGQA 2QXVA 4ZOVA 4U1EI 5CYKB 4CY1A 4JT5C 2P9IC 1YFQA 4JXMA 4AOWA 2QC5A 2J55H 2B5NA 4UI9R 5IGOA 4JSXC 4O9DA 4GMBA 3RLMD 1VYHC 3UVNA 2CE9A 5H14A 3DSMA 4GM3A 2HJ4A 2HESX 2O9KA 4FAND 3RN1D 5TDHB 3V7DB 4L3GD 4A0BA 2HXCA 4ERZA 5I5JA 4CC9A 2HYEA 1TBGA 4HDJA 2OVRB 4L3HD 4FA1D 5EM2B 2AGYA 2IUPA 4E5ZA 2OVPB 2H6KA 3C9CA 4CI2A 5FKTA 1TYQC 3PVWB 3EWEA 3PE7A 2W18A 2GC4A 3MKQA 4J86A 3OW8A 5HYNB 4XEIC 2G99A 3SHFA 3UVLA 3AH8B 4J84A 4PSWB 4A0BB 4A0AB 4L9OA 2YNOA 2OK4A 4A11A 2GNQA 3MZLA 3RFGA 2CN2A 2AH1A 3JZHA 3ULEC 5CXCA 2BCJB 5EMLB 4E5ZB 4J73A 3DXMC 4O3UB 4OZUA 3VGZA 5A2Qg 1JOFA 1GG2B 2IWKA 3AL8A 5FXYA 4CZYA 3PSLA 4J79A 3C5MA 5FA5B 3RSEC 3SLED 3EI2B 4GQ1A 5JWZA 4O1QD 3NVNA 2XYIA 3FGBA 3F3PA 2HKRA 4GQ2P 3OKTA 5GMKn 4CI3A 3SXTD 4GQBB 3I89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A08 A;  3IJ0 A;  2OIZ A;  3SBP A;  2H6Q A;  4IMM A;  3F3F A;  4KFM B;  5HE0 B;  1N6D A;  3I7N A;  3FM0 A;  4J78 A;  3CIK B;  2CO0 A;  5CXB A;  5TEF A;  4X61 B;  1R5M A;  3JZG A;  3CFV A;  1OMW B;  2B4E A;  3OTT A;  4OWR A;  4ZOY A;  3K27 A;  5EAL A;  3N0D A;  3OL2 B;  1JJU B;  1XHM A;  3MKS B;  4ERY A;  3JRO A;  3NVX A;  1QNI A;  2P9S C;  5EMK B;  4CY5 A;  2YBA A;  4A08 B;  4D0K A;  1NEX B;  1U4C A;  2H68 A;  4PNK B;  2PM6 B;  3CFS B;  4H5J A;  1K32 A;  2OVQ B;  3UKR C;  3OKY A;  3SVW D;  3C75 H;  3RFH A;  1PI6 A;  1N6E A;  1XKS A;  3DM0 A;  3OKW A;  1GXR A;  4GGC A;  2IUR A;  5EAP A;  3EG6 A;  2I0T A;  2UZX B;  4PBY A;  4FA4 D;  5KDO B;  3JZN A;  4X63 B;  4Y5R D;  3SN6 B;  3SBR A;  3JRP A;  4CY2 A;  4PBZ A;  5FQD A;  3I7K A;  2H14 A;  4A2M A;  5B4W A;  3PSC B;  4G56 B;  2IUQ A;  2IUV A;  3MXX A;  2P9P C;  3OKY B;  5HE1 B;  3EI3 A;  3RMZ D;  1JMX B;  3BG0 A;  1GP2 B;  4CZX A;  5GSA A;  3U4Y A;  4JSV C;  4A09 A;  3IKO A;  3KRW B;  1P22 A;  3EMH A;  5HQG A;  1XIP A;  4J0X A;  3PVU B;  4BH6 A;  4JSP C;  4ERQ A;  3SCY A;  4U7A A;  3K26 A;  3N0E A;  2P9U C;  4JSN C;  2P9K C;  3EU7 A;  3MMY A;  3L4M D;  3SJL D;  3F3G A;  3PXS D;  4FB1 D;  2Z2N A;  3JPX A;  2Z2P A;  5EMJ B;  3FRX A;  3SWS D;  3I7O A;  4PSX B;  3GFC A;  4QQE A;  1SQJ A;  4N14 A;  5EAR A;  2B5M A;  2CN3 A;  5IC7 A;  4CY3 A;  4K3I D;  4D6V A;  2J56 H;  2PM9 A;  4A11 B;  4ESG A;  5IJ7 E;  1MG2 A;  2I0S A;  4GM9 A;  3EI1 A;  2PM7 B;  5CXC B;  4X3E A;  3RN0 D;  2G9A A;  2TRC B;  2I3T A;  4R7A B;  4GZ8 A;  4LGN A;  3J81 g;  4IA9 A;  4BL0 A;  4J8B A;  5H17 A;  2H13 A;  5THA A;  4PC0 A;  1MG3 A;  1MDA H;  3AL8 B;  3MZK A;  3GRE A;  5FLX g;  4FA9 D;  5CYK A;  4O45 A;  2XL2 A;  5K1C C;  4J0W A;  4LG9 A;  4QL1 A;  2PM9 B;  5TEE A;  2H9N A;  2H9P A;  1U2V C;  3UVM A;  3E0C A;  4QRJ A;  3W15 A;  4CI1 A;  4AEZ A;  3SMR A;  4A7J A;  2H3X A;  2IWF A;  3KRX B;  2OK6 A;  3UVK A;  3EI1 B;  4CI8 A;  4JT6 C;  5EMM B;  5K19 A;  3UKU C;  5CXB B;  4J8G A;  2UZY B;  5C2W B;  2XU7 A;  3AL9 A;  1PEV A;  4K3J B;  3J80 g;  3I7L A;  3I7P A;  4FHL A;  4BUJ C;  1NR0 A;  5FKR A;  4GGA A;  4FWW A;  1N6F A;  5AMS A;  2GC7 A;  2OJY A;  2H6N A;  3PXW D;  4J81 A;  4X60 B;  1S4U X;  3C99 A;  5EM2 A;  5HE2 B;  1B9Y A;  3ZWL B;  3IJ1 A;  1SQ9 A;  5IJ8 E;  3V5W B;  3JAM g;  1RI6 A;  5GXH A;  2AGW A;  4J87 A;  4CZV A;  5AFU 3;  4QT8 A;  2AH0 A;  2J57 G;  2HJB A;  3IJC A;  1PGU A;  3UVO A;  4YVD A;  4A2L A;  1ERJ A;  2HKM A;  3HFQ A;  5I5M A;  1OLZ A;  4A0A A;  1L0Q A;  5GXI A;  5I5I A;  5TF2 A;  2I0R A;  3DXK C;  3I7H A;  3I2N A;  4E54 A;  5FKQ A;  1A0R B;  3AFC A;  2Q7Q A;  1JMZ B;  3EI3 B;  2EBS A;  4MK0 B;  3SBQ A;  3B7F A;  4O3T B;  3RRM C;  3VH0 A;  1B9X A;  1SHY B;  3EI4 A;  2AQ5 A;  3EI2 A;  3L4O D;  4L1Q D;  4PXW A;  4A09 B;  1K8K C;  2P9L C;  3JB9 L;  4JD2 C;  3NVQ A;  3VA6 A;  1GOT B;  2H47 A;  5FKS A;  4J82 A;  4FA5 D;  4FAV D;  4ZN4 A;  3I8C A;  3ODT A;  1Q47 A;  5IT9 g;  4TZ4 A;  4Y7R A;  3DWL C;  4ZOX A;  4E54 B;  2AGZ A;  3BWS A;  3SFZ A;  2YNN A;  3PXT D;  5EAM A;  2YMU A;  3IIW A;  3I8E A;  5C2V B;  2AGX A;  2YB8 B;  2I3S A;  2YNP A;  1PBY B;  2BBK H;  4GM8 A;  3BG1 A;  3EI4 B;  4J77 A;  2B5L A;  2H9L A;  3IIY A;  3V9F A;  2Z2O A;  5SXM A;  3OL2 A;  5HE3 B;  5C9Z B;  3UR4 A;  2P9N C;  4GGD A;  4XYI A;  4EWR A;  2XL3 A;  3ORV D;  4XYH A;  5AJA A;  2IAA A;  2CO0 C;  2CE8 A;  4ES0 A;  2CNX A;  3P4F A;  4H5I A;  2PBI B;  1FWX A;  2AGL A;  2MTA H;  3A0F A;  4LG8 A;  4ZOZ A;  4Z8L A;  4I79 A;  4NSX A;  2H9M A;  5H1M A;  5IGQ A;  2QXV A;  4ZOV A;  4U1E I;  5CYK B;  4CY1 A;  4JT5 C;  2P9I C;  1YFQ A;  4JXM A;  4AOW A;  2QC5 A;  2J55 H;  2B5N A;  4UI9 R;  5IGO A;  4JSX C;  4O9D A;  4GMB A;  3RLM D;  1VYH C;  3UVN A;  2CE9 A;  5H14 A;  3DSM A;  4GM3 A;  2HJ4 A;  2HES X;  2O9K A;  4FAN D;  3RN1 D;  5TDH B;  3V7D B;  4L3G D;  4A0B A;  2HXC A;  4ERZ A;  5I5J A;  4CC9 A;  2HYE A;  1TBG A;  4HDJ A;  2OVR B;  4L3H D;  4FA1 D;  5EM2 B;  2AGY A;  2IUP A;  4E5Z A;  2OVP B;  2H6K A;  3C9C A;  4CI2 A;  5FKT A;  1TYQ C;  3PVW B;  3EWE A;  3PE7 A;  2W18 A;  2GC4 A;  3MKQ A;  4J86 A;  3OW8 A;  5HYN B;  4XEI C;  2G99 A;  3SHF A;  3UVL A;  3AH8 B;  4J84 A;  4PSW B;  4A0B B;  4A0A B;  4L9O A;  2YNO A;  2OK4 A;  4A11 A;  2GNQ A;  3MZL A;  3RFG A;  2CN2 A;  2AH1 A;  3JZH A;  3ULE C;  5CXC A;  2BCJ B;  5EML B;  4E5Z B;  4J73 A;  3DXM C;  4O3U B;  4OZU A;  3VGZ A;  5A2Q g;  1JOF A;  1GG2 B;  2IWK A;  3AL8 A;  5FXY A;  4CZY A;  3PSL A;  4J79 A;  3C5M A;  5FA5 B;  3RSE C;  3SLE D;  3EI2 B;  4GQ1 A;  5JWZ A;  4O1Q D;  3NVN A;  2XYI A;  3FGB A;  3F3P A;  2HKR A;  4GQ2 P;  3OKT A;  5GMK n;  4CI3 A;  3SXT D;  4GQB B;  3I89 A; 
#chains in the Genus database with same CATH topology
 4A08 A;  3IJ0 A;  3EQ7 A;  4WK0 A;  2OIZ A;  3SBP A;  2H6Q A;  1JTD B;  1A12 A;  4IMM A;  3F3F A;  4KFM B;  5HE0 B;  1N6D A;  3I7N A;  3FM0 A;  3ZE2 A;  3IJE A;  4J78 A;  3CIK B;  2CO0 A;  5CXB A;  5TEF A;  4X61 B;  1M1X A;  4MMY A;  1R5M A;  3JZG A;  5M5S A;  3CFV A;  1OMW B;  2B4E A;  3OTT A;  4OWR A;  4ZOY A;  2VDP A;  3K27 A;  5EAL A;  4Z7N A;  5M5U A;  3N0D A;  3OL2 B;  1JJU B;  1XHM A;  3MKS B;  4ERY A;  3JRO A;  3NVX A;  1QNI A;  2P9S C;  5EMK B;  4CY5 A;  4G1E A;  2YBA A;  4A08 B;  4D0K A;  1NEX B;  3ZDY A;  1U4C A;  4G55 A;  2H68 A;  4PNK B;  2XZG A;  2PM6 B;  3CFS B;  3NIF A;  4H5J A;  1K32 A;  2OVQ B;  3UKR C;  3OKY A;  3SVW D;  3C75 H;  3RFH A;  1PI6 A;  1N6E A;  1XKS A;  3DM0 A;  3OKW A;  1GXR A;  2WQ8 A;  4GGC A;  2IUR A;  2VZ3 A;  4BCC A;  3O4G A;  5EAP A;  3EG6 A;  2I0T A;  2UZX B;  4PBY A;  4FA4 D;  5KDO B;  4RE5 A;  3JZN A;  4X63 B;  4Y5R D;  1H2W A;  3SN6 B;  3SBR A;  3JRP A;  4CY2 A;  4PBZ A;  5FQD A;  3I7K A;  2H14 A;  4A2M A;  5B4W A;  3PSC B;  4G56 B;  2IUQ A;  2IUV A;  3MXX A;  2EIC A;  2P9P C;  3OKY B;  5HE1 B;  3EI3 A;  3RMZ D;  2VDL A;  1JMX B;  3BG0 A;  1GP2 B;  4CZX A;  5GSA A;  3U4Y A;  4JSV C;  4A09 A;  2BKL A;  3IKO A;  3KRW B;  1P22 A;  3EMH A;  5HQG A;  3MUO A;  1XIP A;  4J0X A;  3PVU B;  3NIG A;  4BH6 A;  4JSP C;  4ERQ A;  3SCY A;  4U7A A;  3K26 A;  1VE6 A;  2VC2 A;  3N0E A;  1UOO A;  2P9U C;  4JSN C;  4BCD A;  2P9K C;  4UM9 A;  3EU7 A;  3MMY A;  3L4M D;  3SJL D;  3F3G A;  4WK4 A;  3PXS D;  4FB1 D;  2Z2N A;  3JPX A;  2Z2P A;  4RE6 A;  5EMJ B;  1UTC A;  2XDW A;  3FRX A;  3SWS D;  3I7O A;  4PSX B;  3GFC A;  4QQE A;  1SQJ A;  4N14 A;  5EAR A;  4DNW A;  2B5M A;  1C9L A;  2CN3 A;  5IC7 A;  4CY3 A;  4K3I D;  4D6V A;  2J56 H;  3KCI A;  4NAA A;  3IUM A;  1QFM A;  1K3I A;  2PM9 A;  1E8M A;  4A11 B;  4ESG A;  1GOH A;  5IJ7 E;  1MG2 A;  2I0S A;  4GM9 A;  4MMX A;  3EI1 A;  1U8C A;  2PM7 B;  2VDM A;  3MUN A;  5CXC B;  4X3E A;  3ZE0 A;  4WK2 A;  3RN0 D;  2G9A A;  2TRC B;  2I3T A;  4R7A B;  4GZ8 A;  4LGN A;  3J81 g;  4IA9 A;  4BL0 A;  4J8B A;  5H17 A;  2H13 A;  5THA A;  4PC0 A;  3T3P A;  1MG3 A;  1MDA H;  3AL8 B;  1I2M B;  3GRE A;  3MZK A;  5FLX g;  4FA9 D;  5CYK A;  4O45 A;  1E8N A;  2XL2 A;  4UM8 A;  5K1C C;  4O2W A;  3IUN A;  4J0W A;  1BPO A;  4LG9 A;  4QL1 A;  3K72 A;  1UOP A;  2PM9 B;  3IUR A;  5TEE A;  4AN1 A;  2H9N A;  2H9P A;  3V4P A;  1U2V C;  3UVM A;  3E0C A;  4QRJ A;  3W15 A;  4CI1 A;  4AEZ A;  3SMR A;  4A7J A;  2H3X A;  2IWF A;  3KRX B;  2OK6 A;  3UVK A;  3EI1 B;  4CI8 A;  3O4H A;  4JT6 C;  5EMM B;  5K19 A;  1H2X A;  3UKU C;  2VDO A;  5CXB B;  4J8G A;  5M61 A;  5M5V A;  2UZY B;  5C2W B;  2XU7 A;  3AL9 A;  1PEV A;  4K3J B;  3J80 g;  3I7L A;  4IRZ A;  3I7P A;  4FHL A;  1VZ2 A;  4BUJ C;  1NR0 A;  5FKR A;  1QFS A;  4GGA A;  4FWW A;  1VZ3 A;  3EQ8 A;  1N6F A;  5AMS A;  2GC7 A;  3IUJ A;  4NBM A;  5FFO A;  2OJY A;  2H6N A;  3PXW D;  4J81 A;  4X60 B;  1S4U X;  3O4I A;  3C99 A;  5EM2 A;  5HE2 B;  1B9Y A;  3ZWL B;  2QR5 A;  3IJ1 A;  4JHP C;  1SQ9 A;  2JKX A;  5IJ8 E;  5E6U A;  3IUL A;  3GD1 I;  3V5W B;  1GOG A;  1H2Y A;  3JAM g;  1RI6 A;  4AN0 A;  5FFG A;  5GXH A;  1YR2 A;  2AGW A;  4J87 A;  4CZV A;  5AFU 3;  4QT8 A;  2AH0 A;  2J57 G;  2HJB A;  3IJC A;  1PGU A;  3UVO A;  4YVD A;  4A2L A;  1ERJ A;  2HKM A;  3HFQ A;  5I5M A;  1OLZ A;  4A0A A;  1L0Q A;  5GXI A;  5I5I A;  5TF2 A;  2I0R A;  4AMY A;  3DXK C;  5C86 A;  3I7H A;  3I2N A;  2XE4 A;  1O6G A;  4E54 A;  5FKQ A;  1A0R B;  3AFC A;  4JHN A;  2Q7Q A;  1JMZ B;  3EI3 B;  2EBS A;  4MK0 B;  3SBQ A;  3B7F A;  4O3T B;  3RRM C;  3VH0 A;  1B9X A;  2VDN A;  4G1M A;  1SHY B;  3EI4 A;  5E6R A;  2AQ5 A;  3EI2 A;  1E5T A;  2VDR A;  3L4O D;  4L1Q D;  4PXW A;  4A09 B;  1K8K C;  3MVD K;  2P9L C;  3JB9 L;  4JD2 C;  3NVQ A;  5M5R A;  3VA6 A;  1GOT B;  2H47 A;  5FKS A;  4J82 A;  4FA5 D;  4FAV D;  4ZN4 A;  3I8C A;  3ODT A;  1Q47 A;  5IT9 g;  2HU7 A;  3IVM A;  4TZ4 A;  4Y7R A;  3DWL C;  3GC3 B;  4ZOX A;  4E54 B;  2AGZ A;  2HU5 A;  1L5G A;  3BWS A;  2EIB A;  2YNN A;  3SFZ A;  3PXT D;  5EAM A;  2YMU A;  3IIW A;  3I8E A;  5C2V B;  2AGX A;  2YB8 B;  2I3S A;  2YNP A;  1PBY B;  2BBK H;  4GM8 A;  3BG1 A;  4NEN A;  3EI4 B;  4J77 A;  2B5L A;  2H9L A;  1GOF A;  3IIY A;  3V9F A;  2VZ1 A;  4DNV A;  2Z2O A;  5SXM A;  3OL2 A;  5HE3 B;  5C9Z B;  3EQ9 A;  3UR4 A;  4BCB A;  2P9N C;  4GGD A;  4XYI A;  4EWR A;  2XL3 A;  3ORV D;  4XYH A;  5AJA A;  4AX4 A;  5C92 A;  2IAA A;  4D9S A;  2CO0 C;  2CE8 A;  4ES0 A;  2CNX A;  3P4F A;  1UOQ A;  4MMZ A;  4QAM A;  2QZP A;  4H5I A;  2PBI B;  1FWX A;  2AGL A;  2MTA H;  3A0F A;  4LG8 A;  4ZOZ A;  4Z8L A;  4I79 A;  4NSX A;  2H9M A;  5H1M A;  5IGQ A;  2QXV A;  4ZOV A;  4U1E I;  5CYK B;  2VDQ A;  3FCU A;  2EID A;  4CY1 A;  5E6S A;  4JT5 C;  2P9I C;  1YFQ A;  4JXM A;  4AOW A;  2QC5 A;  1T2X A;  3NID A;  2J55 H;  2B5N A;  1JV2 A;  4UI9 R;  5IGO A;  4JSX C;  4O9D A;  4GMB A;  4DNU A;  3RLM D;  2VDK A;  1VYH C;  1O6F A;  3UVN A;  2CE9 A;  4O02 A;  4NC4 A;  5H14 A;  3DSM A;  4GM3 A;  2EIE A;  5HDB A;  2HJ4 A;  2HES X;  4AMZ A;  2O9K A;  4FAN D;  3RN1 D;  5TDH B;  3V7D B;  3VI3 A;  4L3G D;  2HU8 A;  4A0B A;  1TYE A;  2HXC A;  4ERZ A;  5I5J A;  4CC9 A;  3ZE1 A;  2HYE A;  1TBG A;  4HDJ A;  2OVR B;  4L3H D;  4FA1 D;  5EM2 B;  2AGY A;  2IUP A;  3ZDZ A;  4E5Z A;  2OVP B;  3OF7 A;  2H6K A;  3C9C A;  3DDU A;  4CI2 A;  5FKT A;  3K71 A;  1TYQ C;  3V4V A;  4BP9 A;  3PVW B;  3EWE A;  4Z7Q A;  3PE7 A;  2W18 A;  2GC4 A;  3MKQ A;  4J86 A;  3OW8 A;  5HYN B;  4XEI C;  2G99 A;  3SHF A;  3UVL A;  3AH8 B;  4J84 A;  4PSW B;  4A0B B;  4A0A B;  4L9O A;  2YNO A;  2OK4 A;  4A11 A;  1C9I A;  2GNQ A;  3FCS A;  3MZL A;  3RFG A;  2CN2 A;  4WJK A;  2AH1 A;  3T3M A;  3JZH A;  5M5T A;  3ULE C;  5CXC A;  4BP8 A;  2BCJ B;  1VE7 A;  5EML B;  4L1M A;  3QHY B;  3IUQ A;  4E5Z B;  4J73 A;  3DXM C;  4O3U B;  4OZU A;  3VGZ A;  5A2Q g;  1JOF A;  3VI4 A;  1GG2 B;  2IWK A;  3AL8 A;  5FXY A;  4CZY A;  3PSL A;  4J79 A;  3QI0 A;  3C5M A;  5FA5 B;  3RSE C;  3SLE D;  3EI2 B;  4GQ1 A;  3ZDX A;  5JWZ A;  4O1Q D;  3NVN A;  2XYI A;  3FGB A;  1H2Z A;  3O4J A;  3F3P A;  4Z7O A;  2HKR A;  4GQ2 P;  3OKT A;  5GMK n;  4CI3 A;  3SXT D;  3K6S A;  4GQB B;  3I89 A; 
#chains in the Genus database with same CATH homology
 4A08 A;  3IJ0 A;  2OIZ A;  3SBP A;  2H6Q A;  4IMM A;  3F3F A;  4KFM B;  5HE0 B;  1N6D A;  3I7N A;  3FM0 A;  4J78 A;  3CIK B;  2CO0 A;  5CXB A;  5TEF A;  4X61 B;  1R5M A;  3JZG A;  3CFV A;  1OMW B;  2B4E A;  3OTT A;  4OWR A;  4ZOY A;  3K27 A;  5EAL A;  3N0D A;  3OL2 B;  1JJU B;  1XHM A;  3MKS B;  4ERY A;  3JRO A;  3NVX A;  1QNI A;  2P9S C;  5EMK B;  4CY5 A;  2YBA A;  4A08 B;  4D0K A;  1NEX B;  1U4C A;  2H68 A;  4PNK B;  2PM6 B;  3CFS B;  4H5J A;  1K32 A;  2OVQ B;  3UKR C;  3OKY A;  3SVW D;  3C75 H;  3RFH A;  1PI6 A;  1N6E A;  1XKS A;  3DM0 A;  3OKW A;  1GXR A;  4GGC A;  2IUR A;  5EAP A;  3EG6 A;  2I0T A;  2UZX B;  4PBY A;  4FA4 D;  5KDO B;  3JZN A;  4X63 B;  4Y5R D;  3SN6 B;  3SBR A;  3JRP A;  4CY2 A;  4PBZ A;  5FQD A;  3I7K A;  2H14 A;  4A2M A;  5B4W A;  3PSC B;  4G56 B;  2IUQ A;  2IUV A;  3MXX A;  2P9P C;  3OKY B;  5HE1 B;  3EI3 A;  3RMZ D;  1JMX B;  3BG0 A;  1GP2 B;  4CZX A;  5GSA A;  3U4Y A;  4JSV C;  4A09 A;  3IKO A;  3KRW B;  1P22 A;  3EMH A;  5HQG A;  1XIP A;  4J0X A;  3PVU B;  4BH6 A;  4JSP C;  4ERQ A;  3SCY A;  4U7A A;  3K26 A;  3N0E A;  2P9U C;  4JSN C;  2P9K C;  3EU7 A;  3MMY A;  3L4M D;  3SJL D;  3F3G A;  3PXS D;  4FB1 D;  2Z2N A;  3JPX A;  2Z2P A;  5EMJ B;  3FRX A;  3SWS D;  3I7O A;  4PSX B;  3GFC A;  4QQE A;  1SQJ A;  4N14 A;  5EAR A;  2B5M A;  2CN3 A;  5IC7 A;  4CY3 A;  4K3I D;  4D6V A;  2J56 H;  2PM9 A;  4A11 B;  4ESG A;  5IJ7 E;  1MG2 A;  2I0S A;  4GM9 A;  3EI1 A;  2PM7 B;  5CXC B;  4X3E A;  3RN0 D;  2G9A A;  2TRC B;  2I3T A;  4R7A B;  4GZ8 A;  4LGN A;  3J81 g;  4IA9 A;  4BL0 A;  4J8B A;  5H17 A;  2H13 A;  5THA A;  4PC0 A;  1MG3 A;  1MDA H;  3AL8 B;  3MZK A;  3GRE A;  5FLX g;  4FA9 D;  5CYK A;  4O45 A;  2XL2 A;  5K1C C;  4J0W A;  4LG9 A;  4QL1 A;  2PM9 B;  5TEE A;  2H9N A;  2H9P A;  1U2V C;  3UVM A;  3E0C A;  4QRJ A;  3W15 A;  4CI1 A;  4AEZ A;  3SMR A;  4A7J A;  2H3X A;  2IWF A;  3KRX B;  2OK6 A;  3UVK A;  3EI1 B;  4CI8 A;  4JT6 C;  5EMM B;  5K19 A;  3UKU C;  5CXB B;  4J8G A;  2UZY B;  5C2W B;  2XU7 A;  3AL9 A;  1PEV A;  4K3J B;  3J80 g;  3I7L A;  3I7P A;  4FHL A;  4BUJ C;  1NR0 A;  5FKR A;  4GGA A;  4FWW A;  1N6F A;  5AMS A;  2GC7 A;  2OJY A;  2H6N A;  3PXW D;  4J81 A;  4X60 B;  1S4U X;  3C99 A;  5EM2 A;  5HE2 B;  1B9Y A;  3ZWL B;  3IJ1 A;  1SQ9 A;  5IJ8 E;  3V5W B;  3JAM g;  1RI6 A;  5GXH A;  2AGW A;  4J87 A;  4CZV A;  5AFU 3;  4QT8 A;  2AH0 A;  2J57 G;  2HJB A;  3IJC A;  1PGU A;  3UVO A;  4YVD A;  4A2L A;  1ERJ A;  2HKM A;  3HFQ A;  5I5M A;  1OLZ A;  4A0A A;  1L0Q A;  5GXI A;  5I5I A;  5TF2 A;  2I0R A;  3DXK C;  3I7H A;  3I2N A;  4E54 A;  5FKQ A;  1A0R B;  3AFC A;  2Q7Q A;  1JMZ B;  3EI3 B;  2EBS A;  4MK0 B;  3SBQ A;  3B7F A;  4O3T B;  3RRM C;  3VH0 A;  1B9X A;  1SHY B;  3EI4 A;  2AQ5 A;  3EI2 A;  3L4O D;  4L1Q D;  4PXW A;  4A09 B;  1K8K C;  2P9L C;  3JB9 L;  4JD2 C;  3NVQ A;  3VA6 A;  1GOT B;  2H47 A;  5FKS A;  4J82 A;  4FA5 D;  4FAV D;  4ZN4 A;  3I8C A;  3ODT A;  1Q47 A;  5IT9 g;  4TZ4 A;  4Y7R A;  3DWL C;  4ZOX A;  4E54 B;  2AGZ A;  3BWS A;  3SFZ A;  2YNN A;  3PXT D;  5EAM A;  2YMU A;  3IIW A;  3I8E A;  5C2V B;  2AGX A;  2YB8 B;  2I3S A;  2YNP A;  1PBY B;  2BBK H;  4GM8 A;  3BG1 A;  3EI4 B;  4J77 A;  2B5L A;  2H9L A;  3IIY A;  3V9F A;  2Z2O A;  5SXM A;  3OL2 A;  5HE3 B;  5C9Z B;  3UR4 A;  2P9N C;  4GGD A;  4XYI A;  4EWR A;  2XL3 A;  3ORV D;  4XYH A;  5AJA A;  2IAA A;  2CO0 C;  2CE8 A;  4ES0 A;  2CNX A;  3P4F A;  4H5I A;  2PBI B;  1FWX A;  2AGL A;  2MTA H;  3A0F A;  4LG8 A;  4ZOZ A;  4Z8L A;  4I79 A;  4NSX A;  2H9M A;  5H1M A;  5IGQ A;  2QXV A;  4ZOV A;  4U1E I;  5CYK B;  4CY1 A;  4JT5 C;  2P9I C;  1YFQ A;  4JXM A;  4AOW A;  2QC5 A;  2J55 H;  2B5N A;  4UI9 R;  5IGO A;  4JSX C;  4O9D A;  4GMB A;  3RLM D;  1VYH C;  3UVN A;  2CE9 A;  5H14 A;  3DSM A;  4GM3 A;  2HJ4 A;  2HES X;  2O9K A;  4FAN D;  3RN1 D;  5TDH B;  3V7D B;  4L3G D;  4A0B A;  2HXC A;  4ERZ A;  5I5J A;  4CC9 A;  2HYE A;  1TBG A;  4HDJ A;  2OVR B;  4L3H D;  4FA1 D;  5EM2 B;  2AGY A;  2IUP A;  4E5Z A;  2OVP B;  2H6K A;  3C9C A;  4CI2 A;  5FKT A;  1TYQ C;  3PVW B;  3EWE A;  3PE7 A;  2W18 A;  2GC4 A;  3MKQ A;  4J86 A;  3OW8 A;  5HYN B;  4XEI C;  2G99 A;  3SHF A;  3UVL A;  3AH8 B;  4J84 A;  4PSW B;  4A0B B;  4A0A B;  4L9O A;  2YNO A;  2OK4 A;  4A11 A;  2GNQ A;  3MZL A;  3RFG A;  2CN2 A;  2AH1 A;  3JZH A;  3ULE C;  5CXC A;  2BCJ B;  5EML B;  4E5Z B;  4J73 A;  3DXM C;  4O3U B;  4OZU A;  3VGZ A;  5A2Q g;  1JOF A;  1GG2 B;  2IWK A;  3AL8 A;  5FXY A;  4CZY A;  3PSL A;  4J79 A;  3C5M A;  5FA5 B;  3RSE C;  3SLE D;  3EI2 B;  4GQ1 A;  5JWZ A;  4O1Q D;  3NVN A;  2XYI A;  3FGB A;  3F3P A;  2HKR A;  4GQ2 P;  3OKT A;  5GMK n;  4CI3 A;  3SXT D;  4GQB B;  3I89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...