2YNOA

Yeast betaprime cop 1-304h6
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
310
Chain Sequence
MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLGNDEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for Recognition of Dilysine Trafficking Motifs by Copi.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords COATOMER SUBUNIT BETA'
total genus 90
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ynoA01
5JWZA 1RI6A 2AH1A 3NVXA 2H6KA 3I8EA 5THAA 1PGUA 3I2NA 4X63B 5I5IA 4J78A 4X60B 2AGLA 5GXIA 1SQ9A 2G9AA 3UVNA 2H13A 3L4MD 4CY5A 1JJUB 3OL2A 3RLMD 4CC9A 1TBGA 4A08B 4JSXC 3C99A 4GM8A 1K8KC 3V7DB 3SBPA 5FKTA 4G56B 4CI8A 4J79A 3UKUC 4A7JA 3JPXA 5FA5B 3SHFA 2H14A 4FA5D 4O9DA 3GFCA 3I8CA 4CI1A 4Z8LA 3UR4A 5HE0B 4FA1D 4JSNC 3MZKA 1XHMA 4XYIA 3RFGA 4A11A 2YNPA 4O1QD 1B9XA 1K32A 3JAMg 5A2Qg 5CYKB 3SCYA 2J55H 3UVLA 2CO0C 4XYHA 3EMHA 2IAAA 1NEXB 4ZOZA 3SMRA 3MMYA 3F3GA 3IIWA 2YB8B 3SBRA 1PI6A 4GGDA 4ERYA 3V5WB 3SWSD 2IWFA 2H9LA 5FKRA 3EI1A 4GQ2P 5B4WA 5CXBA 3BG0A 4E5ZB 3DSMA 3ORVD 4OWRA 4JXMA 3OKWA 1GXRA 4CI2A 2P9UC 5C2VB 5CXCB 1GOTB 1NR0A 4JD2C 2OVRB 2PBIB 3C9CA 2GC4A 3I7NA 4GMBA 4OZUA 1JMXB 2P9IC 2H9PA 5FQDA 4JT5C 3SFZA 4H5JA 2HYEA 2XYIA 3L4OD 2PM9A 5GMKn 4ES0A 3C5MA 2HJBA 2AH0A 2OVQB 2OJYA 3UKRC 4H5IA 2YMUA 3I7LA 1Q47A 3EI4B 3DM0A 2TRCB 1OLZA 1XKSA 3CFVA 2IWKA 2CE8A 2IUVA 2GNQA 2UZYB 3KRWB 4XEIC 5EM2B 4PSXB 2HJ4A 2HESX 4J87A 4PBZA 3RN0D 1JOFA 2H6NA 2XU7A 1N6FA 3ZWLB 1P22A 2AGWA 1GP2B 1L0QA 2UZXB 4GZ8A 4A0AA 4I79A 3IJ1A 3UVMA 3PXWD 4PSWB 2H47A 4KFMB 2OIZA 4L1QD 5EMKB 2Z2PA 3ULEC 4A09B 3SN6B 4CY3A 5FLXg 5H1MA 4A0BA 4A2LA 3E0CA 3EI2A 3AL9A 3JB9L 3I7KA 4FAVD 3N0EA 2IURA 2Z2NA 3AFCA 3C75H 4J0WA 3RMZD 5IJ8E 2AGYA 4IA9A 4Y7RA 3I89A 5AMSA 5TF2A 4U7AA 4CI3A 2W18A 3VGZA 1MG2A 2OVPB 4PNKB 3IJCA 3EWEA 3OL2B 3A0FA 3CFSB 3FRXA 2H9MA 5EAPA 4EWRA 4QL1A 4L3HD 3IJ0A 4R7AB 2XL3A 5I5JA 4CZVA 4J0XA 2J56H 3PSCB 4J77A 4FA9D 2CO0A 5IGOA 3W15A 3I7PA 2I0RA 3FM0A 4YVDA 5SXMA 3J80g 2B5MA 3SJLD 4ERZA 4QT8A 4L3GD 4E5ZA 1A0RB 2EBSA 4J86A 5IGQA 4E54B 2GC7A 5EMJB 3K27A 4MK0B 4K3JB 1SHYB 4CY2A 4CZYA 1ERJA 5KDOB 1N6DA 1B9YA 2O9KA 4ZOYA 2PM7B 5H14A 3CIKB 4FAND 3GREA 1JMZB 5C9ZB 1MDAH 3VA6A 5HYNB 3OTTA 1YFQA 3AL8A 4LG9A 3NVNA 5EALA 3SVWD 4GM9A 3SBQA 2BCJB 2H3XA 4JSVC 4ZOXA 3EI1B 3JZNA 5GSAA 3K26A 4O3UB 1PBYB 3IKOA 4J84A 4NSXA 5FKSA 3HFQA 4ESGA 3RFHA 3ODTA 4FWWA 5FXYA 3U4YA 5C2WB 5EMLB 2Z2OA 3RN1D 4A2MA 5GXHA 1U4CA 3DXMC 2YNOA 4PBYA 3RSEC 3J81g 2J57G 3OKYB 2CE9A 4QQEA 4U1EI 2CN3A 3JROA 2HKRA 2OK6A 3PVWB 5FKQA 2PM9B 4O45A 2P9PC 3PXTD 1FWXA 2CNXA 5CXCA 3JZHA 5I5MA 3EI4A 2AQ5A 3EI3B 2HXCA 4LG8A 4LGNA 3AH8B 3V9FA 2YNNA 2G99A 5TEFA 2I0SA 1S4UX 2I0TA 4ERQA 1XIPA 2AGZA 3N0DA 3F3FA 3RRMC 1OMWB 3P4FA 3JRPA 5CYKA 4ZOVA 3NVQA 4X3EA 3PE7A 2IUQA 2CN2A 3BWSA 2PM6B 4J81A 4J82A 3IIYA 1QNIA 4N14A 4FHLA 2P9SC 1U2VC 4GM3A 2BBKH 4AEZA 3PVUB 4GQ1A 3OKTA 5IJ7E 4JSPC 5CXBB 4GGCA 4A11B 3EG6A 5K1CC 5HE2B 4A08A 5HE1B 5EMMB 3KRXB 4CZXA 2IUPA 4O3TB 3SXTD 2Q7QA 2H68A 3I7HA 1R5MA 5EAMA 4QRJA 2OK4A 3OW8A 4A0AB 3DWLC 4FA4D 4ZN4A 3MXXA 4K3ID 3AL8B 2P9LC 4PC0A 2YBAA 5K19A 1TYQC 3I7OA 2HKMA 2B4EA 4JT6C 4AOWA 2P9KC 5TEEA 2QC5A 1MG3A 1PEVA 2B5LA 3EU7A 3MKQA 4BL0A 4TZ4A 3UVOA 2I3SA 3VH0A 2B5NA 5EARA 5TDHB 3F3PA 3OKYA 2H9NA 4J8GA 2I3TA 4HDJA 2XL2A 4FB1D 2H6QA 5AJAA 3B7FA 3PSLA 2MTAH 3JZGA 5EM2A 2AGXA 4L9OA 4J73A 4A09A 2QXVA 5IC7A 1GG2B 1N6EA 3BG1A 4A0BB 3SLED 3EI3A 4UI9R 5AFU3 3UVKA 3EI2B 4J8BA 4BH6A 4D0KA 2P9NC 4X61B 4E54A 5HE3B 3MKSB 4PXWA 4GQBB 4GGAA 3PXSD 4CY1A 4IMMA 5HQGA 5IT9g 3MZLA 1SQJA 5H17A 1VYHC 3DXKC 3FGBA 4BUJC 4Y5RD 4D6VA
chains in the Genus database with same CATH superfamily
2VDPA 3V4VA 5JWZA 1RI6A 2AH1A 1H2WA 1QFMA 3NVXA 2H6KA 3I8EA 5THAA 1PGUA 3I2NA 4X63B 5I5IA 4J78A 4X60B 2AGLA 5GXIA 1SQ9A 2G9AA 3UVNA 2H13A 3L4MD 4CY5A 1JJUB 3OL2A 3RLMD 4CC9A 1TBGA 4A08B 4JSXC 3IJEA 3K71A 2VZ3A 3O4HA 4UM9A 3C99A 4GM8A 1K8KC 3GD1I 4MMXA 3V7DB 3SBPA 4JHNA 3VI4A 5FKTA 1QFSA 4G56B 4CI8A 1I2MB 1M1XA 1JV2A 4J79A 3UKUC 4A7JA 1L5GA 3JPXA 5FA5B 3SHFA 3T3MA 3NIFA 2H14A 4FA5D 4O9DA 4O02A 3GFCA 3I8CA 4CI1A 4Z8LA 3UR4A 5HE0B 4FA1D 4AN1A 4JSNC 3MZKA 1XHMA 4XYIA 3RFGA 1VZ2A 3IVMA 4A11A 2YNPA 4O1QD 1B9XA 1K32A 4AN0A 5C92A 3JAMg 5A2Qg 1E8NA 1GOGA 5CYKB 3SCYA 3NIGA 2J55H 3UVLA 2CO0C 3EMHA 4XYHA 2IAAA 1NEXB 4ZOZA 3SMRA 3MMYA 3F3GA 3IIWA 5M5TA 2YB8B 3SBRA 1PI6A 4GGDA 4ERYA 3V5WB 3FCUA 3SWSD 2IWFA 2H9LA 5FKRA 3EI1A 4GQ2P 5B4WA 5CXBA 3BG0A 4E5ZB 3DSMA 3ORVD 4OWRA 4JXMA 3OKWA 1GXRA 4CI2A 3O4GA 2P9UC 5C2VB 5CXCB 1GOTB 1NR0A 4JD2C 3ZE2A 1UOOA 2OVRB 3QI0A 4Z7OA 2PBIB 3C9CA 2GC4A 3I7NA 3FCSA 4G1MA 4GMBA 4OZUA 1JMXB 2P9IC 2H9PA 5FQDA 4JT5C 3SFZA 4H5JA 2HYEA 3K72A 2XYIA 3L4OD 1GOFA 2PM9A 3MUOA 5M5RA 5GMKn 4ES0A 3C5MA 4Z7NA 2HJBA 2AH0A 3IUNA 2OVQB 2OJYA 3UKRC 4MMZA 3GC3B 4H5IA 2YMUA 3I7LA 4BP8A 1Q47A 3EI4B 3DM0A 4NC4A 3ZDYA 5E6RA 2TRCB 1OLZA 1VE7A 1XKSA 3CFVA 3KCIA 2IWKA 4BCCA 2CE8A 2IUVA 2GNQA 2UZYB 3KRWB 4XEIC 5EM2B 4PSXB 2HJ4A 2HESX 4J87A 4PBZA 3RN0D 1JOFA 4NENA 2H6NA 2XU7A 1N6FA 3ZWLB 3NIDA 1P22A 2AGWA 5M5SA 1GP2B 1L0QA 2UZXB 4L1MA 4GZ8A 3O4IA 4A0AA 4I79A 3IJ1A 3UVMA 3PXWD 4PSWB 2H47A 4KFMB 2OIZA 4L1QD 5EMKB 2Z2PA 3ULEC 2VZ1A 4A09B 3SN6B 4CY3A 5FLXg 5H1MA 4A0BA 4A2LA 3E0CA 3EI2A 3AL9A 4G55A 3JB9L 3I7KA 4FAVD 2VDOA 3N0EA 3V4PA 2IURA 2Z2NA 4WK0A 3AFCA 3C75H 4J0WA 3RMZD 3EQ8A 5E6SA 2AGYA 5IJ8E 4IA9A 4Y7RA 3I89A 3DDUA 5AMSA 5TF2A 4JHPC 4U7AA 4CI3A 2W18A 3VGZA 1MG2A 2OVPB 4PNKB 3IJCA 3IUQA 3EWEA 3OL2B 3A0FA 3CFSB 3FRXA 2H9MA 5EAPA 1VZ3A 4EWRA 4NAAA 4QL1A 4L3HD 3IJ0A 4R7AB 2XL3A 2VDLA 5I5JA 4CZVA 4J0XA 2J56H 3PSCB 4J77A 4FA9D 4IRZA 2CO0A 1UOQA 5IGOA 3W15A 3I7PA 2I0RA 3FM0A 4YVDA 5SXMA 3J80g 4DNUA 2VDNA 2B5MA 3SJLD 4ERZA 4QT8A 5FFOA 4L3GD 3T3PA 4E5ZA 1A0RB 2EBSA 1UTCA 4J86A 5IGQA 4E54B 2GC7A 5EMJB 3K27A 4MK0B 4K3JB 2EICA 1SHYB 1O6GA 4CY2A 4CZYA 5M5UA 1ERJA 5KDOB 1N6DA 1B9YA 2O9KA 2QR5A 3O4JA 4ZOYA 2PM7B 5H14A 3CIKB 4FAND 3GREA 1JMZB 5C9ZB 1MDAH 4Y5RD 2BKLA 3VA6A 5HYNB 3OTTA 3OF7A 1YFQA 3AL8A 4LG9A 3NVNA 5EALA 3SVWD 4GM9A 2HU5A 3SBQA 2BCJB 2H3XA 4JSVC 4Z7QA 4ZOXA 3EI1B 3JZNA 5GSAA 1C9IA 1K3IA 2EIDA 3K26A 4O3UB 1PBYB 3IKOA 4J84A 4NSXA 5FKSA 3HFQA 4ESGA 5M61A 4RE6A 3RFHA 3ODTA 4FWWA 2WQ8A 5FXYA 5C2WB 3U4YA 5EMLB 2Z2OA 3RN1D 4A2MA 5GXHA 1U4CA 3DXMC 2YNOA 4PBYA 4WK4A 3RSEC 1E8MA 5FFGA 3J81g 2J57G 3OKYB 2CE9A 4QQEA 4U1EI 2CN3A 2XE4A 3JROA 2HKRA 2OK6A 3MUNA 3PVWB 5FKQA 2PM9B 1H2YA 2P9PC 2QZPA 1YR2A 3PXTD 4AMYA 1FWXA 2CNXA 5CXCA 3JZHA 5I5MA 3EI4A 2AQ5A 3EI3B 2HXCA 4LG8A 4LGNA 3AH8B 3V9FA 2YNNA 2G99A 5TEFA 2I0SA 1S4UX 2I0TA 4QAMA 4ERQA 1XIPA 2AGZA 3N0DA 3F3FA 3RRMC 1OMWB 5HDBA 3P4FA 3JRPA 5CYKA 2HU7A 4NBMA 4ZOVA 3NVQA 4X3EA 1E5TA 3PE7A 2IUQA 2CN2A 3BWSA 2PM6B 1BPOA 4J81A 3IIYA 3IURA 4J82A 1QNIA 2VDMA 4UM8A 4N14A 4FHLA 1UOPA 2P9SC 4AMZA 1U2VC 4GM3A 2BBKH 4AEZA 3PVUB 1GOHA 4GQ1A 3K6SA 3OKTA 5IJ7E 1H2ZA 4JSPC 4RE5A 3EQ7A 3MVDK 4WK2A 5CXBB 4GGCA 4A11B 5E6UA 3EG6A 5K1CC 5HE2B 4A08A 5HE1B 2JKXA 5EMMB 4D9SA 3KRXB 4CZXA 4WJKA 2IUPA 4O3TB 1A12A 3SXTD 5C86A 2Q7QA 2H68A 1TYEA 2VC2A 3I7HA 1R5MA 5EAMA 4QRJA 2OK4A 3OW8A 4MMYA 4A0AB 3ZDXA 2VDRA 3QHYB 3DWLC 3VI3A 4FA4D 4ZN4A 3MXXA 4K3ID 2VDKA 3AL8B 2P9LC 4PC0A 2YBAA 5K19A 1TYQC 3I7OA 2HKMA 2B4EA 4JT6C 4DNWA 1H2XA 3ZDZA 4AOWA 2P9KC 3EQ9A 5TEEA 4BP9A 2QC5A 1MG3A 2EIEA 4BCBA 1PEVA 2B5LA 3EU7A 3MKQA 4BL0A 1VE6A 4TZ4A 3UVOA 2I3SA 2VDQA 3VH0A 2B5NA 5EARA 5TDHB 3F3PA 1O6FA 3OKYA 2H9NA 4J8GA 2I3TA 4G1EA 2XDWA 4HDJA 2XL2A 4FB1D 2EIBA 2H6QA 3B7FA 5AJAA 3PSLA 2MTAH 3JZGA 3IUJA 5EM2A 2AGXA 4L9OA 4J73A 4A09A 3IUMA 3IULA 2QXVA 5IC7A 1GG2B 1N6EA 3BG1A 4A0BB 3SLED 3EI3A 4UI9R 5AFU3 3UVKA 3EI2B 1JTDB 4J8BA 3ZE0A 4BH6A 4D0KA 3ZE1A 2P9NC 4X61B 4E54A 5HE3B 3MKSB 1T2XA 4PXWA 4GQBB 4GGAA 3PXSD 4CY1A 4IMMA 5HQGA 2HU8A 4BCDA 1C9LA 5IT9g 3MZLA 1SQJA 4AX4A 4O2WA 5H17A 1VYHC 1U8CA 3DXKC 4DNVA 5M5VA 3FGBA 4BUJC 2XZGA 4O45A 4D6VA
chains in the Genus database with same CATH topology
5JWZA 1RI6A 2AH1A 3NVXA 2H6KA 3I8EA 5THAA 1PGUA 3I2NA 4X63B 5I5IA 4J78A 4X60B 2AGLA 5GXIA 1SQ9A 2G9AA 3UVNA 2H13A 3L4MD 4CY5A 1JJUB 3OL2A 3RLMD 4CC9A 1TBGA 4A08B 4JSXC 3C99A 4GM8A 1K8KC 3V7DB 3SBPA 5FKTA 4G56B 4CI8A 4J79A 3UKUC 4A7JA 3JPXA 5FA5B 3SHFA 2H14A 4FA5D 4O9DA 3GFCA 3I8CA 4CI1A 4Z8LA 3UR4A 5HE0B 4FA1D 4JSNC 3MZKA 1XHMA 4XYIA 3RFGA 4A11A 2YNPA 4O1QD 1B9XA 1K32A 3JAMg 5A2Qg 5CYKB 3SCYA 2J55H 3UVLA 2CO0C 4XYHA 3EMHA 2IAAA 1NEXB 4ZOZA 3SMRA 3MMYA 3F3GA 3IIWA 2YB8B 3SBRA 1PI6A 4GGDA 4ERYA 3V5WB 3SWSD 2IWFA 2H9LA 5FKRA 3EI1A 4GQ2P 5B4WA 5CXBA 3BG0A 4E5ZB 3DSMA 3ORVD 4OWRA 4JXMA 3OKWA 1GXRA 4CI2A 2P9UC 5C2VB 5CXCB 1GOTB 1NR0A 4JD2C 2OVRB 2PBIB 3C9CA 2GC4A 3I7NA 4GMBA 4OZUA 1JMXB 2P9IC 2H9PA 5FQDA 4JT5C 3SFZA 4H5JA 2HYEA 2XYIA 3L4OD 2PM9A 5GMKn 4ES0A 3C5MA 2HJBA 2AH0A 2OVQB 2OJYA 3UKRC 4H5IA 2YMUA 3I7LA 1Q47A 3EI4B 3DM0A 2TRCB 1OLZA 1XKSA 3CFVA 2IWKA 2CE8A 2IUVA 2GNQA 2UZYB 3KRWB 4XEIC 5EM2B 4PSXB 2HJ4A 2HESX 4J87A 4PBZA 3RN0D 1JOFA 2H6NA 2XU7A 1N6FA 3ZWLB 1P22A 2AGWA 1GP2B 1L0QA 2UZXB 4GZ8A 4A0AA 4I79A 3IJ1A 3UVMA 3PXWD 4PSWB 2H47A 4KFMB 2OIZA 4L1QD 5EMKB 2Z2PA 3ULEC 4A09B 3SN6B 4CY3A 5FLXg 5H1MA 4A0BA 4A2LA 3E0CA 3EI2A 3AL9A 3JB9L 3I7KA 4FAVD 3N0EA 2IURA 2Z2NA 3AFCA 3C75H 4J0WA 3RMZD 5IJ8E 2AGYA 4IA9A 4Y7RA 3I89A 5AMSA 5TF2A 4U7AA 4CI3A 2W18A 3VGZA 1MG2A 2OVPB 4PNKB 3IJCA 3EWEA 3OL2B 3A0FA 3CFSB 3FRXA 2H9MA 5EAPA 4EWRA 4QL1A 4L3HD 3IJ0A 4R7AB 2XL3A 5I5JA 4CZVA 4J0XA 2J56H 3PSCB 4J77A 4FA9D 2CO0A 5IGOA 3W15A 3I7PA 2I0RA 3FM0A 4YVDA 5SXMA 3J80g 2B5MA 3SJLD 4ERZA 4QT8A 4L3GD 4E5ZA 1A0RB 2EBSA 4J86A 5IGQA 4E54B 2GC7A 5EMJB 3K27A 4MK0B 4K3JB 1SHYB 4CY2A 4CZYA 1ERJA 5KDOB 1N6DA 1B9YA 2O9KA 4ZOYA 2PM7B 5H14A 3CIKB 4FAND 3GREA 1JMZB 5C9ZB 1MDAH 3VA6A 5HYNB 3OTTA 1YFQA 3AL8A 4LG9A 3NVNA 5EALA 3SVWD 4GM9A 3SBQA 2BCJB 2H3XA 4JSVC 4ZOXA 3EI1B 3JZNA 5GSAA 3K26A 4O3UB 1PBYB 3IKOA 4J84A 4NSXA 5FKSA 3HFQA 4ESGA 3RFHA 3ODTA 4FWWA 5FXYA 3U4YA 5C2WB 5EMLB 2Z2OA 3RN1D 4A2MA 5GXHA 1U4CA 3DXMC 2YNOA 4PBYA 3RSEC 3J81g 2J57G 3OKYB 2CE9A 4QQEA 4U1EI 2CN3A 3JROA 2HKRA 2OK6A 3PVWB 5FKQA 2PM9B 4O45A 2P9PC 3PXTD 1FWXA 2CNXA 5CXCA 3JZHA 5I5MA 3EI4A 2AQ5A 3EI3B 2HXCA 4LG8A 4LGNA 3AH8B 3V9FA 2YNNA 2G99A 5TEFA 2I0SA 1S4UX 2I0TA 4ERQA 1XIPA 2AGZA 3N0DA 3F3FA 3RRMC 1OMWB 3P4FA 3JRPA 5CYKA 4ZOVA 3NVQA 4X3EA 3PE7A 2IUQA 2CN2A 3BWSA 2PM6B 4J81A 4J82A 3IIYA 1QNIA 4N14A 4FHLA 2P9SC 1U2VC 4GM3A 2BBKH 4AEZA 3PVUB 4GQ1A 3OKTA 5IJ7E 4JSPC 5CXBB 4GGCA 4A11B 3EG6A 5K1CC 5HE2B 4A08A 5HE1B 5EMMB 3KRXB 4CZXA 2IUPA 4O3TB 3SXTD 2Q7QA 2H68A 3I7HA 1R5MA 5EAMA 4QRJA 2OK4A 3OW8A 4A0AB 3DWLC 4FA4D 4ZN4A 3MXXA 4K3ID 3AL8B 2P9LC 4PC0A 2YBAA 5K19A 1TYQC 3I7OA 2HKMA 2B4EA 4JT6C 4AOWA 2P9KC 5TEEA 2QC5A 1MG3A 1PEVA 2B5LA 3EU7A 3MKQA 4BL0A 4TZ4A 3UVOA 2I3SA 3VH0A 2B5NA 5EARA 5TDHB 3F3PA 3OKYA 2H9NA 4J8GA 2I3TA 4HDJA 2XL2A 4FB1D 2H6QA 5AJAA 3B7FA 3PSLA 2MTAH 3JZGA 5EM2A 2AGXA 4L9OA 4J73A 4A09A 2QXVA 5IC7A 1GG2B 1N6EA 3BG1A 4A0BB 3SLED 3EI3A 4UI9R 5AFU3 3UVKA 3EI2B 4J8BA 4BH6A 4D0KA 2P9NC 4X61B 4E54A 5HE3B 3MKSB 4PXWA 4GQBB 4GGAA 3PXSD 4CY1A 4IMMA 5HQGA 5IT9g 3MZLA 1SQJA 5H17A 1VYHC 3DXKC 3FGBA 4BUJC 4Y5RD 4D6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JWZ A;  1RI6 A;  2AH1 A;  3NVX A;  2H6K A;  3I8E A;  5THA A;  1PGU A;  3I2N A;  4X63 B;  5I5I A;  4J78 A;  4X60 B;  2AGL A;  5GXI A;  1SQ9 A;  2G9A A;  3UVN A;  2H13 A;  3L4M D;  4CY5 A;  1JJU B;  3OL2 A;  3RLM D;  4CC9 A;  1TBG A;  4A08 B;  4JSX C;  3C99 A;  4GM8 A;  1K8K C;  3V7D B;  3SBP A;  5FKT A;  4G56 B;  4CI8 A;  4J79 A;  3UKU C;  4A7J A;  3JPX A;  5FA5 B;  3SHF A;  2H14 A;  4FA5 D;  4O9D A;  3GFC A;  3I8C A;  4CI1 A;  4Z8L A;  3UR4 A;  5HE0 B;  4FA1 D;  4JSN C;  3MZK A;  1XHM A;  4XYI A;  3RFG A;  4A11 A;  2YNP A;  4O1Q D;  1B9X A;  1K32 A;  3JAM g;  5A2Q g;  5CYK B;  3SCY A;  2J55 H;  3UVL A;  2CO0 C;  4XYH A;  3EMH A;  2IAA A;  1NEX B;  4ZOZ A;  3SMR A;  3MMY A;  3F3G A;  3IIW A;  2YB8 B;  3SBR A;  1PI6 A;  4GGD A;  4ERY A;  3V5W B;  3SWS D;  2IWF A;  2H9L A;  5FKR A;  3EI1 A;  4GQ2 P;  5B4W A;  5CXB A;  3BG0 A;  4E5Z B;  3DSM A;  3ORV D;  4OWR A;  4JXM A;  3OKW A;  1GXR A;  4CI2 A;  2P9U C;  5C2V B;  5CXC B;  1GOT B;  1NR0 A;  4JD2 C;  2OVR B;  2PBI B;  3C9C A;  2GC4 A;  3I7N A;  4GMB A;  4OZU A;  1JMX B;  2P9I C;  2H9P A;  5FQD A;  4JT5 C;  3SFZ A;  4H5J A;  2HYE A;  2XYI A;  3L4O D;  2PM9 A;  5GMK n;  4ES0 A;  3C5M A;  2HJB A;  2AH0 A;  2OVQ B;  2OJY A;  3UKR C;  4H5I A;  2YMU A;  3I7L A;  1Q47 A;  3EI4 B;  3DM0 A;  2TRC B;  1OLZ A;  1XKS A;  3CFV A;  2IWK A;  2CE8 A;  2IUV A;  2GNQ A;  2UZY B;  3KRW B;  4XEI C;  5EM2 B;  4PSX B;  2HJ4 A;  2HES X;  4J87 A;  4PBZ A;  3RN0 D;  1JOF A;  2H6N A;  2XU7 A;  1N6F A;  3ZWL B;  1P22 A;  2AGW A;  1GP2 B;  1L0Q A;  2UZX B;  4GZ8 A;  4A0A A;  4I79 A;  3IJ1 A;  3UVM A;  3PXW D;  4PSW B;  2H47 A;  4KFM B;  2OIZ A;  4L1Q D;  5EMK B;  2Z2P A;  3ULE C;  4A09 B;  3SN6 B;  4CY3 A;  5FLX g;  5H1M A;  4A0B A;  4A2L A;  3E0C A;  3EI2 A;  3AL9 A;  3JB9 L;  3I7K A;  4FAV D;  3N0E A;  2IUR A;  2Z2N A;  3AFC A;  3C75 H;  4J0W A;  3RMZ D;  5IJ8 E;  2AGY A;  4IA9 A;  4Y7R A;  3I89 A;  5AMS A;  5TF2 A;  4U7A A;  4CI3 A;  2W18 A;  3VGZ A;  1MG2 A;  2OVP B;  4PNK B;  3IJC A;  3EWE A;  3OL2 B;  3A0F A;  3CFS B;  3FRX A;  2H9M A;  5EAP A;  4EWR A;  4QL1 A;  4L3H D;  3IJ0 A;  4R7A B;  2XL3 A;  5I5J A;  4CZV A;  4J0X A;  2J56 H;  3PSC B;  4J77 A;  4FA9 D;  2CO0 A;  5IGO A;  3W15 A;  3I7P A;  2I0R A;  3FM0 A;  4YVD A;  5SXM A;  3J80 g;  2B5M A;  3SJL D;  4ERZ A;  4QT8 A;  4L3G D;  4E5Z A;  1A0R B;  2EBS A;  4J86 A;  5IGQ A;  4E54 B;  2GC7 A;  5EMJ B;  3K27 A;  4MK0 B;  4K3J B;  1SHY B;  4CY2 A;  4CZY A;  1ERJ A;  5KDO B;  1N6D A;  1B9Y A;  2O9K A;  4ZOY A;  2PM7 B;  5H14 A;  3CIK B;  4FAN D;  3GRE A;  1JMZ B;  5C9Z B;  1MDA H;  3VA6 A;  5HYN B;  3OTT A;  1YFQ A;  3AL8 A;  4LG9 A;  3NVN A;  5EAL A;  3SVW D;  4GM9 A;  3SBQ A;  2BCJ B;  2H3X A;  4JSV C;  4ZOX A;  3EI1 B;  3JZN A;  5GSA A;  3K26 A;  4O3U B;  1PBY B;  3IKO A;  4J84 A;  4NSX A;  5FKS A;  3HFQ A;  4ESG A;  3RFH A;  3ODT A;  4FWW A;  5FXY A;  3U4Y A;  5C2W B;  5EML B;  2Z2O A;  3RN1 D;  4A2M A;  5GXH A;  1U4C A;  3DXM C;  2YNO A;  4PBY A;  3RSE C;  3J81 g;  2J57 G;  3OKY B;  2CE9 A;  4QQE A;  4U1E I;  2CN3 A;  3JRO A;  2HKR A;  2OK6 A;  3PVW B;  5FKQ A;  2PM9 B;  4O45 A;  2P9P C;  3PXT D;  1FWX A;  2CNX A;  5CXC A;  3JZH A;  5I5M A;  3EI4 A;  2AQ5 A;  3EI3 B;  2HXC A;  4LG8 A;  4LGN A;  3AH8 B;  3V9F A;  2YNN A;  2G99 A;  5TEF A;  2I0S A;  1S4U X;  2I0T A;  4ERQ A;  1XIP A;  2AGZ A;  3N0D A;  3F3F A;  3RRM C;  1OMW B;  3P4F A;  3JRP A;  5CYK A;  4ZOV A;  3NVQ A;  4X3E A;  3PE7 A;  2IUQ A;  2CN2 A;  3BWS A;  2PM6 B;  4J81 A;  4J82 A;  3IIY A;  1QNI A;  4N14 A;  4FHL A;  2P9S C;  1U2V C;  4GM3 A;  2BBK H;  4AEZ A;  3PVU B;  4GQ1 A;  3OKT A;  5IJ7 E;  4JSP C;  5CXB B;  4GGC A;  4A11 B;  3EG6 A;  5K1C C;  5HE2 B;  4A08 A;  5HE1 B;  5EMM B;  3KRX B;  4CZX A;  2IUP A;  4O3T B;  3SXT D;  2Q7Q A;  2H68 A;  3I7H A;  1R5M A;  5EAM A;  4QRJ A;  2OK4 A;  3OW8 A;  4A0A B;  3DWL C;  4FA4 D;  4ZN4 A;  3MXX A;  4K3I D;  3AL8 B;  2P9L C;  4PC0 A;  2YBA A;  5K19 A;  1TYQ C;  3I7O A;  2HKM A;  2B4E A;  4JT6 C;  4AOW A;  2P9K C;  5TEE A;  2QC5 A;  1MG3 A;  1PEV A;  2B5L A;  3EU7 A;  3MKQ A;  4BL0 A;  4TZ4 A;  3UVO A;  2I3S A;  3VH0 A;  2B5N A;  5EAR A;  5TDH B;  3F3P A;  3OKY A;  2H9N A;  4J8G A;  2I3T A;  4HDJ A;  2XL2 A;  4FB1 D;  2H6Q A;  5AJA A;  3B7F A;  3PSL A;  2MTA H;  3JZG A;  5EM2 A;  2AGX A;  4L9O A;  4J73 A;  4A09 A;  2QXV A;  5IC7 A;  1GG2 B;  1N6E A;  3BG1 A;  4A0B B;  3SLE D;  3EI3 A;  4UI9 R;  5AFU 3;  3UVK A;  3EI2 B;  4J8B A;  4BH6 A;  4D0K A;  2P9N C;  4X61 B;  4E54 A;  5HE3 B;  3MKS B;  4PXW A;  4GQB B;  4GGA A;  3PXS D;  4CY1 A;  4IMM A;  5HQG A;  5IT9 g;  3MZL A;  1SQJ A;  5H17 A;  1VYH C;  3DXK C;  3FGB A;  4BUJ C;  4Y5R D;  4D6V A; 
#chains in the Genus database with same CATH topology
 2VDP A;  3V4V A;  5JWZ A;  1RI6 A;  2AH1 A;  1H2W A;  1QFM A;  3NVX A;  2H6K A;  3I8E A;  5THA A;  1PGU A;  3I2N A;  4X63 B;  5I5I A;  4J78 A;  4X60 B;  2AGL A;  5GXI A;  1SQ9 A;  2G9A A;  3UVN A;  2H13 A;  3L4M D;  4CY5 A;  1JJU B;  3OL2 A;  3RLM D;  4CC9 A;  1TBG A;  4A08 B;  4JSX C;  3IJE A;  3K71 A;  2VZ3 A;  3O4H A;  4UM9 A;  3C99 A;  4GM8 A;  1K8K C;  3GD1 I;  4MMX A;  3V7D B;  3SBP A;  4JHN A;  3VI4 A;  5FKT A;  1QFS A;  4G56 B;  4CI8 A;  1I2M B;  1M1X A;  1JV2 A;  4J79 A;  3UKU C;  4A7J A;  1L5G A;  3JPX A;  5FA5 B;  3SHF A;  3T3M A;  3NIF A;  2H14 A;  4FA5 D;  4O9D A;  4O02 A;  3GFC A;  3I8C A;  4CI1 A;  4Z8L A;  3UR4 A;  5HE0 B;  4FA1 D;  4AN1 A;  4JSN C;  3MZK A;  1XHM A;  4XYI A;  3RFG A;  1VZ2 A;  3IVM A;  4A11 A;  2YNP A;  4O1Q D;  1B9X A;  1K32 A;  4AN0 A;  5C92 A;  3JAM g;  5A2Q g;  1E8N A;  1GOG A;  5CYK B;  3SCY A;  3NIG A;  2J55 H;  3UVL A;  2CO0 C;  3EMH A;  4XYH A;  2IAA A;  1NEX B;  4ZOZ A;  3SMR A;  3MMY A;  3F3G A;  3IIW A;  5M5T A;  2YB8 B;  3SBR A;  1PI6 A;  4GGD A;  4ERY A;  3V5W B;  3FCU A;  3SWS D;  2IWF A;  2H9L A;  5FKR A;  3EI1 A;  4GQ2 P;  5B4W A;  5CXB A;  3BG0 A;  4E5Z B;  3DSM A;  3ORV D;  4OWR A;  4JXM A;  3OKW A;  1GXR A;  4CI2 A;  3O4G A;  2P9U C;  5C2V B;  5CXC B;  1GOT B;  1NR0 A;  4JD2 C;  3ZE2 A;  1UOO A;  2OVR B;  3QI0 A;  4Z7O A;  2PBI B;  3C9C A;  2GC4 A;  3I7N A;  3FCS A;  4G1M A;  4GMB A;  4OZU A;  1JMX B;  2P9I C;  2H9P A;  5FQD A;  4JT5 C;  3SFZ A;  4H5J A;  2HYE A;  3K72 A;  2XYI A;  3L4O D;  1GOF A;  2PM9 A;  3MUO A;  5M5R A;  5GMK n;  4ES0 A;  3C5M A;  4Z7N A;  2HJB A;  2AH0 A;  3IUN A;  2OVQ B;  2OJY A;  3UKR C;  4MMZ A;  3GC3 B;  4H5I A;  2YMU A;  3I7L A;  4BP8 A;  1Q47 A;  3EI4 B;  3DM0 A;  4NC4 A;  3ZDY A;  5E6R A;  2TRC B;  1OLZ A;  1VE7 A;  1XKS A;  3CFV A;  3KCI A;  2IWK A;  4BCC A;  2CE8 A;  2IUV A;  2GNQ A;  2UZY B;  3KRW B;  4XEI C;  5EM2 B;  4PSX B;  2HJ4 A;  2HES X;  4J87 A;  4PBZ A;  3RN0 D;  1JOF A;  4NEN A;  2H6N A;  2XU7 A;  1N6F A;  3ZWL B;  3NID A;  1P22 A;  2AGW A;  5M5S A;  1GP2 B;  1L0Q A;  2UZX B;  4L1M A;  4GZ8 A;  3O4I A;  4A0A A;  4I79 A;  3IJ1 A;  3UVM A;  3PXW D;  4PSW B;  2H47 A;  4KFM B;  2OIZ A;  4L1Q D;  5EMK B;  2Z2P A;  3ULE C;  2VZ1 A;  4A09 B;  3SN6 B;  4CY3 A;  5FLX g;  5H1M A;  4A0B A;  4A2L A;  3E0C A;  3EI2 A;  3AL9 A;  4G55 A;  3JB9 L;  3I7K A;  4FAV D;  2VDO A;  3N0E A;  3V4P A;  2IUR A;  2Z2N A;  4WK0 A;  3AFC A;  3C75 H;  4J0W A;  3RMZ D;  3EQ8 A;  5E6S A;  2AGY A;  5IJ8 E;  4IA9 A;  4Y7R A;  3I89 A;  3DDU A;  5AMS A;  5TF2 A;  4JHP C;  4U7A A;  4CI3 A;  2W18 A;  3VGZ A;  1MG2 A;  2OVP B;  4PNK B;  3IJC A;  3IUQ A;  3EWE A;  3OL2 B;  3A0F A;  3CFS B;  3FRX A;  2H9M A;  5EAP A;  1VZ3 A;  4EWR A;  4NAA A;  4QL1 A;  4L3H D;  3IJ0 A;  4R7A B;  2XL3 A;  2VDL A;  5I5J A;  4CZV A;  4J0X A;  2J56 H;  3PSC B;  4J77 A;  4FA9 D;  4IRZ A;  2CO0 A;  1UOQ A;  5IGO A;  3W15 A;  3I7P A;  2I0R A;  3FM0 A;  4YVD A;  5SXM A;  3J80 g;  4DNU A;  2VDN A;  2B5M A;  3SJL D;  4ERZ A;  4QT8 A;  5FFO A;  4L3G D;  3T3P A;  4E5Z A;  1A0R B;  2EBS A;  1UTC A;  4J86 A;  5IGQ A;  4E54 B;  2GC7 A;  5EMJ B;  3K27 A;  4MK0 B;  4K3J B;  2EIC A;  1SHY B;  1O6G A;  4CY2 A;  4CZY A;  5M5U A;  1ERJ A;  5KDO B;  1N6D A;  1B9Y A;  2O9K A;  2QR5 A;  3O4J A;  4ZOY A;  2PM7 B;  5H14 A;  3CIK B;  4FAN D;  3GRE A;  1JMZ B;  5C9Z B;  1MDA H;  4Y5R D;  2BKL A;  3VA6 A;  5HYN B;  3OTT A;  3OF7 A;  1YFQ A;  3AL8 A;  4LG9 A;  3NVN A;  5EAL A;  3SVW D;  4GM9 A;  2HU5 A;  3SBQ A;  2BCJ B;  2H3X A;  4JSV C;  4Z7Q A;  4ZOX A;  3EI1 B;  3JZN A;  5GSA A;  1C9I A;  1K3I A;  2EID A;  3K26 A;  4O3U B;  1PBY B;  3IKO A;  4J84 A;  4NSX A;  5FKS A;  3HFQ A;  4ESG A;  5M61 A;  4RE6 A;  3RFH A;  3ODT A;  4FWW A;  2WQ8 A;  5FXY A;  5C2W B;  3U4Y A;  5EML B;  2Z2O A;  3RN1 D;  4A2M A;  5GXH A;  1U4C A;  3DXM C;  2YNO A;  4PBY A;  4WK4 A;  3RSE C;  1E8M A;  5FFG A;  3J81 g;  2J57 G;  3OKY B;  2CE9 A;  4QQE A;  4U1E I;  2CN3 A;  2XE4 A;  3JRO A;  2HKR A;  2OK6 A;  3MUN A;  3PVW B;  5FKQ A;  2PM9 B;  1H2Y A;  2P9P C;  2QZP A;  1YR2 A;  3PXT D;  4AMY A;  1FWX A;  2CNX A;  5CXC A;  3JZH A;  5I5M A;  3EI4 A;  2AQ5 A;  3EI3 B;  2HXC A;  4LG8 A;  4LGN A;  3AH8 B;  3V9F A;  2YNN A;  2G99 A;  5TEF A;  2I0S A;  1S4U X;  2I0T A;  4QAM A;  4ERQ A;  1XIP A;  2AGZ A;  3N0D A;  3F3F A;  3RRM C;  1OMW B;  5HDB A;  3P4F A;  3JRP A;  5CYK A;  2HU7 A;  4NBM A;  4ZOV A;  3NVQ A;  4X3E A;  1E5T A;  3PE7 A;  2IUQ A;  2CN2 A;  3BWS A;  2PM6 B;  1BPO A;  4J81 A;  3IIY A;  3IUR A;  4J82 A;  1QNI A;  2VDM A;  4UM8 A;  4N14 A;  4FHL A;  1UOP A;  2P9S C;  4AMZ A;  1U2V C;  4GM3 A;  2BBK H;  4AEZ A;  3PVU B;  1GOH A;  4GQ1 A;  3K6S A;  3OKT A;  5IJ7 E;  1H2Z A;  4JSP C;  4RE5 A;  3EQ7 A;  3MVD K;  4WK2 A;  5CXB B;  4GGC A;  4A11 B;  5E6U A;  3EG6 A;  5K1C C;  5HE2 B;  4A08 A;  5HE1 B;  2JKX A;  5EMM B;  4D9S A;  3KRX B;  4CZX A;  4WJK A;  2IUP A;  4O3T B;  1A12 A;  3SXT D;  5C86 A;  2Q7Q A;  2H68 A;  1TYE A;  2VC2 A;  3I7H A;  1R5M A;  5EAM A;  4QRJ A;  2OK4 A;  3OW8 A;  4MMY A;  4A0A B;  3ZDX A;  2VDR A;  3QHY B;  3DWL C;  3VI3 A;  4FA4 D;  4ZN4 A;  3MXX A;  4K3I D;  2VDK A;  3AL8 B;  2P9L C;  4PC0 A;  2YBA A;  5K19 A;  1TYQ C;  3I7O A;  2HKM A;  2B4E A;  4JT6 C;  4DNW A;  1H2X A;  3ZDZ A;  4AOW A;  2P9K C;  3EQ9 A;  5TEE A;  4BP9 A;  2QC5 A;  1MG3 A;  2EIE A;  4BCB A;  1PEV A;  2B5L A;  3EU7 A;  3MKQ A;  4BL0 A;  1VE6 A;  4TZ4 A;  3UVO A;  2I3S A;  2VDQ A;  3VH0 A;  2B5N A;  5EAR A;  5TDH B;  3F3P A;  1O6F A;  3OKY A;  2H9N A;  4J8G A;  2I3T A;  4G1E A;  2XDW A;  4HDJ A;  2XL2 A;  4FB1 D;  2EIB A;  2H6Q A;  3B7F A;  5AJA A;  3PSL A;  2MTA H;  3JZG A;  3IUJ A;  5EM2 A;  2AGX A;  4L9O A;  4J73 A;  4A09 A;  3IUM A;  3IUL A;  2QXV A;  5IC7 A;  1GG2 B;  1N6E A;  3BG1 A;  4A0B B;  3SLE D;  3EI3 A;  4UI9 R;  5AFU 3;  3UVK A;  3EI2 B;  1JTD B;  4J8B A;  3ZE0 A;  4BH6 A;  4D0K A;  3ZE1 A;  2P9N C;  4X61 B;  4E54 A;  5HE3 B;  3MKS B;  1T2X A;  4PXW A;  4GQB B;  4GGA A;  3PXS D;  4CY1 A;  4IMM A;  5HQG A;  2HU8 A;  4BCD A;  1C9L A;  5IT9 g;  3MZL A;  1SQJ A;  4AX4 A;  4O2W A;  5H17 A;  1VYH C;  1U8C A;  3DXK C;  4DNV A;  5M5V A;  3FGB A;  4BUJ C;  2XZG A;  4O45 A;  4D6V A; 
#chains in the Genus database with same CATH homology
 5JWZ A;  1RI6 A;  2AH1 A;  3NVX A;  2H6K A;  3I8E A;  5THA A;  1PGU A;  3I2N A;  4X63 B;  5I5I A;  4J78 A;  4X60 B;  2AGL A;  5GXI A;  1SQ9 A;  2G9A A;  3UVN A;  2H13 A;  3L4M D;  4CY5 A;  1JJU B;  3OL2 A;  3RLM D;  4CC9 A;  1TBG A;  4A08 B;  4JSX C;  3C99 A;  4GM8 A;  1K8K C;  3V7D B;  3SBP A;  5FKT A;  4G56 B;  4CI8 A;  4J79 A;  3UKU C;  4A7J A;  3JPX A;  5FA5 B;  3SHF A;  2H14 A;  4FA5 D;  4O9D A;  3GFC A;  3I8C A;  4CI1 A;  4Z8L A;  3UR4 A;  5HE0 B;  4FA1 D;  4JSN C;  3MZK A;  1XHM A;  4XYI A;  3RFG A;  4A11 A;  2YNP A;  4O1Q D;  1B9X A;  1K32 A;  3JAM g;  5A2Q g;  5CYK B;  3SCY A;  2J55 H;  3UVL A;  2CO0 C;  4XYH A;  3EMH A;  2IAA A;  1NEX B;  4ZOZ A;  3SMR A;  3MMY A;  3F3G A;  3IIW A;  2YB8 B;  3SBR A;  1PI6 A;  4GGD A;  4ERY A;  3V5W B;  3SWS D;  2IWF A;  2H9L A;  5FKR A;  3EI1 A;  4GQ2 P;  5B4W A;  5CXB A;  3BG0 A;  4E5Z B;  3DSM A;  3ORV D;  4OWR A;  4JXM A;  3OKW A;  1GXR A;  4CI2 A;  2P9U C;  5C2V B;  5CXC B;  1GOT B;  1NR0 A;  4JD2 C;  2OVR B;  2PBI B;  3C9C A;  2GC4 A;  3I7N A;  4GMB A;  4OZU A;  1JMX B;  2P9I C;  2H9P A;  5FQD A;  4JT5 C;  3SFZ A;  4H5J A;  2HYE A;  2XYI A;  3L4O D;  2PM9 A;  5GMK n;  4ES0 A;  3C5M A;  2HJB A;  2AH0 A;  2OVQ B;  2OJY A;  3UKR C;  4H5I A;  2YMU A;  3I7L A;  1Q47 A;  3EI4 B;  3DM0 A;  2TRC B;  1OLZ A;  1XKS A;  3CFV A;  2IWK A;  2CE8 A;  2IUV A;  2GNQ A;  2UZY B;  3KRW B;  4XEI C;  5EM2 B;  4PSX B;  2HJ4 A;  2HES X;  4J87 A;  4PBZ A;  3RN0 D;  1JOF A;  2H6N A;  2XU7 A;  1N6F A;  3ZWL B;  1P22 A;  2AGW A;  1GP2 B;  1L0Q A;  2UZX B;  4GZ8 A;  4A0A A;  4I79 A;  3IJ1 A;  3UVM A;  3PXW D;  4PSW B;  2H47 A;  4KFM B;  2OIZ A;  4L1Q D;  5EMK B;  2Z2P A;  3ULE C;  4A09 B;  3SN6 B;  4CY3 A;  5FLX g;  5H1M A;  4A0B A;  4A2L A;  3E0C A;  3EI2 A;  3AL9 A;  3JB9 L;  3I7K A;  4FAV D;  3N0E A;  2IUR A;  2Z2N A;  3AFC A;  3C75 H;  4J0W A;  3RMZ D;  5IJ8 E;  2AGY A;  4IA9 A;  4Y7R A;  3I89 A;  5AMS A;  5TF2 A;  4U7A A;  4CI3 A;  2W18 A;  3VGZ A;  1MG2 A;  2OVP B;  4PNK B;  3IJC A;  3EWE A;  3OL2 B;  3A0F A;  3CFS B;  3FRX A;  2H9M A;  5EAP A;  4EWR A;  4QL1 A;  4L3H D;  3IJ0 A;  4R7A B;  2XL3 A;  5I5J A;  4CZV A;  4J0X A;  2J56 H;  3PSC B;  4J77 A;  4FA9 D;  2CO0 A;  5IGO A;  3W15 A;  3I7P A;  2I0R A;  3FM0 A;  4YVD A;  5SXM A;  3J80 g;  2B5M A;  3SJL D;  4ERZ A;  4QT8 A;  4L3G D;  4E5Z A;  1A0R B;  2EBS A;  4J86 A;  5IGQ A;  4E54 B;  2GC7 A;  5EMJ B;  3K27 A;  4MK0 B;  4K3J B;  1SHY B;  4CY2 A;  4CZY A;  1ERJ A;  5KDO B;  1N6D A;  1B9Y A;  2O9K A;  4ZOY A;  2PM7 B;  5H14 A;  3CIK B;  4FAN D;  3GRE A;  1JMZ B;  5C9Z B;  1MDA H;  3VA6 A;  5HYN B;  3OTT A;  1YFQ A;  3AL8 A;  4LG9 A;  3NVN A;  5EAL A;  3SVW D;  4GM9 A;  3SBQ A;  2BCJ B;  2H3X A;  4JSV C;  4ZOX A;  3EI1 B;  3JZN A;  5GSA A;  3K26 A;  4O3U B;  1PBY B;  3IKO A;  4J84 A;  4NSX A;  5FKS A;  3HFQ A;  4ESG A;  3RFH A;  3ODT A;  4FWW A;  5FXY A;  3U4Y A;  5C2W B;  5EML B;  2Z2O A;  3RN1 D;  4A2M A;  5GXH A;  1U4C A;  3DXM C;  2YNO A;  4PBY A;  3RSE C;  3J81 g;  2J57 G;  3OKY B;  2CE9 A;  4QQE A;  4U1E I;  2CN3 A;  3JRO A;  2HKR A;  2OK6 A;  3PVW B;  5FKQ A;  2PM9 B;  4O45 A;  2P9P C;  3PXT D;  1FWX A;  2CNX A;  5CXC A;  3JZH A;  5I5M A;  3EI4 A;  2AQ5 A;  3EI3 B;  2HXC A;  4LG8 A;  4LGN A;  3AH8 B;  3V9F A;  2YNN A;  2G99 A;  5TEF A;  2I0S A;  1S4U X;  2I0T A;  4ERQ A;  1XIP A;  2AGZ A;  3N0D A;  3F3F A;  3RRM C;  1OMW B;  3P4F A;  3JRP A;  5CYK A;  4ZOV A;  3NVQ A;  4X3E A;  3PE7 A;  2IUQ A;  2CN2 A;  3BWS A;  2PM6 B;  4J81 A;  4J82 A;  3IIY A;  1QNI A;  4N14 A;  4FHL A;  2P9S C;  1U2V C;  4GM3 A;  2BBK H;  4AEZ A;  3PVU B;  4GQ1 A;  3OKT A;  5IJ7 E;  4JSP C;  5CXB B;  4GGC A;  4A11 B;  3EG6 A;  5K1C C;  5HE2 B;  4A08 A;  5HE1 B;  5EMM B;  3KRX B;  4CZX A;  2IUP A;  4O3T B;  3SXT D;  2Q7Q A;  2H68 A;  3I7H A;  1R5M A;  5EAM A;  4QRJ A;  2OK4 A;  3OW8 A;  4A0A B;  3DWL C;  4FA4 D;  4ZN4 A;  3MXX A;  4K3I D;  3AL8 B;  2P9L C;  4PC0 A;  2YBA A;  5K19 A;  1TYQ C;  3I7O A;  2HKM A;  2B4E A;  4JT6 C;  4AOW A;  2P9K C;  5TEE A;  2QC5 A;  1MG3 A;  1PEV A;  2B5L A;  3EU7 A;  3MKQ A;  4BL0 A;  4TZ4 A;  3UVO A;  2I3S A;  3VH0 A;  2B5N A;  5EAR A;  5TDH B;  3F3P A;  3OKY A;  2H9N A;  4J8G A;  2I3T A;  4HDJ A;  2XL2 A;  4FB1 D;  2H6Q A;  5AJA A;  3B7F A;  3PSL A;  2MTA H;  3JZG A;  5EM2 A;  2AGX A;  4L9O A;  4J73 A;  4A09 A;  2QXV A;  5IC7 A;  1GG2 B;  1N6E A;  3BG1 A;  4A0B B;  3SLE D;  3EI3 A;  4UI9 R;  5AFU 3;  3UVK A;  3EI2 B;  4J8B A;  4BH6 A;  4D0K A;  2P9N C;  4X61 B;  4E54 A;  5HE3 B;  3MKS B;  4PXW A;  4GQB B;  4GGA A;  3PXS D;  4CY1 A;  4IMM A;  5HQG A;  5IT9 g;  3MZL A;  1SQJ A;  5H17 A;  1VYH C;  3DXK C;  3FGB A;  4BUJ C;  4Y5R D;  4D6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...