2YNOA

Yeast betaprime cop 1-304h6
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
310
Chain Sequence
MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLGNDEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COATOMER SUBUNIT BETA'
publication title Molecular Basis for Recognition of Dilysine Trafficking Motifs by Copi.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 90
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ynoA01
3CFVA 3EI1A 2AGXA 2YB8B 2TRCB 4A2MA 5IGOA 5HQGA 4O1QD 4K3JB 2Z2PA 3F3FA 4CY3A 2HESX 4K3ID 4O9DA 2PM6B 4J82A 4AOWA 4PBZA 3E0CA 4UI9R 2I3TA 3C99A 1MDAH 3JPXA 2BBKH 5B4WA 5HE2B 3BWSA 3I7NA 3RMZD 4A09A 4J73A 2I0SA 5C2VB 4QT8A 4A0BB 4JD2C 4NSXA 3IJ0A 2O9KA 3A0FA 3MKQA 3SLED 3SMRA 2YBAA 1N6EA 5EALA 3JZGA 3C5MA 3I2NA 3V9FA 4ZOYA 2I0RA 4HDJA 3VGZA 5FQDA 4GQ2P 5K19A 3KRWB 5H1MA 2CN2A 5AJAA 2B5MA 3FRXA 4J84A 3GFCA 5AMSA 5CYKB 4JT5C 2I0TA 4JSNC 5FXYA 5TDHB 1N6DA 3IIWA 2OK6A 4ERQA 2AGWA 2IUVA 2IUPA 1OMWB 5EARA 4O45A 4GGCA 5FKSA 4CZXA 3IIYA 3B7FA 2P9PC 3UVLA 4CY2A 5AFU3 1NEXB 4FAND 2B5NA 4EWRA 4GM3A 3JROA 4GZ8A 3EI3A 5IJ7E 5GXHA 5H17A 3AL9A 3JZNA 4J79A 3BG1A 3N0EA 2H9PA 4R7AB 3PXWD 5EMKB 2QC5A 2B5LA 3IJ1A 3SN6B 1XKSA 4ES0A 4GQ1A 4JSXC 4AEZA 4A08A 3P4FA 4L9OA 4KFMB 3PXTD 3RN0D 3UVNA 2AGLA 4QL1A 4FA1D 3U4YA 1SHYB 5EM2B 2Q7QA 1B9XA 3KRXB 5CXBB 4E5ZA 3JB9L 4ZOVA 3OKWA 4J87A 1RI6A 3IKOA 4FWWA 3SHFA 2J57G 4GM8A 4QRJA 4L1QD 4J77A 2H6QA 3AFCA 4X60B 5GMKn 1GG2B 2PM9A 2YNPA 2H14A 2OIZA 2YNOA 4A7JA 4J78A 1PBYB 2YMUA 1A0RB 4A0AA 3W15A 3AH8B 4A11A 3NVNA 2Z2OA 4FA5D 3OKYB 3PSLA 2H9MA 2P9SC 1JMZB 2UZXB 5A2Qg 2H6NA 5HE1B 5IGQA 5EMMB 3SWSD 3PXSD 3DM0A 4CI3A 5TEFA 3DXMC 3EI4B 3L4OD 4LG9A 3EI2B 4A2LA 3VH0A 4TZ4A 3PVUB 2H68A 4JT6C 3SXTD 2OK4A 3V7DB 2H13A 1TYQC 3I7OA 4CZVA 2HJBA 5IT9g 5CXCB 5HE3B 1OLZA 3FGBA 3AL8B 2OVQB 4L3GD 3SVWD 3I8EA 4X3EA 4O3UB 5EAMA 3DWLC 2G9AA 4GM9A 3UVKA 4BH6A 4D6VA 3OKTA 4CI8A 4LGNA 4PSXB 2H6KA 4FHLA 4FA4D 2XL3A 3FM0A 4J8GA 4YVDA 3DSMA 4H5JA 2YNNA 4CI1A 4CI2A 3EMHA 3EU7A 4BUJC 3I89A 3F3GA 3HFQA 4Y7RA 2AGYA 3BG0A 4PC0A 4E54B 1VYHC 1MG2A 3EI1B 1U2VC 3RFGA 1P22A 3V5WB 2CE8A 3UVOA 3MZLA 5FLXg 3I7KA 3OL2A 2J55H 2AH0A 3C75H 1R5MA 3UKRC 4QQEA 2HXCA 3CFSB 3I7HA 4GGDA 4JXMA 4PBYA 2PM9B 4J86A 1PEVA 1GP2B 4CY1A 5CYKA 2EBSA 4FA9D 3OTTA 4A09B 4L3HD 3OW8A 5JWZA 3NVXA 2HKRA 4OZUA 5FA5B 3ODTA 4GQBB 2PM7B 5FKRA 4J0XA 2H9NA 2XYIA 5IJ8E 2AQ5A 5HYNB 3NVQA 2CE9A 5I5MA 2CO0A 4J8BA 5IC7A 4JSVC 3JZHA 3SCYA 2QXVA 4OWRA 3K26A 1XHMA 2HYEA 3RRMC 2IWKA 2GNQA 4XYIA 3UR4A 3SBQA 2AH1A 1SQ9A 4J81A 4ERZA 4FB1D 5C9ZB 1GXRA 5SXMA 2GC7A 3ULEC 4O3TB 5GXIA 3MKSB 1K32A 5KDOB 2IWFA 4X61B 4U1EI 5TEEA 2XU7A 3RLMD 4BL0A 3C9CA 1JMXB 3CIKB 2BCJB 4X63B 3VA6A 2H47A 1L0QA 1MG3A 4GMBA 5EMJB 5THAA 3J81g 5I5JA 1K8KC 4PXWA 1SQJA 5EM2A 2B4EA 5GSAA 4XYHA 2P9LC 4D0KA 5I5IA 4J0WA 5CXBA 3PE7A 1FWXA 3JAMg 4IA9A 3SBRA 3SFZA 3I7LA 3SBPA 1U4CA 2J56H 3SJLD 5C2WB 3EI3B 1Q47A 2PBIB 3RN1D 3K27A 1PI6A 2W18A 1NR0A 3I8CA 4ERYA 2HKMA 3ZWLB 5H14A 3OL2B 3IJCA 1S4UX 2HJ4A 4ZOZA 4A0BA 1N6FA 4G56B 4ESGA 4A08B 3RFHA 2P9UC 4PSWB 3L4MD 2OVPB 4FAVD 4IMMA 2IURA 4U7AA 1PGUA 2H3XA 3I7PA 2IUQA 3OKYA 5FKTA 2AGZA 4XEIC 3MZKA 3EG6A 2I3SA 5FKQA 4E5ZB 1QNIA 4Z8LA 3PVWB 4CZYA 1ERJA 5EAPA 2OJYA 4LG8A 4ZOXA 1TBGA 3J80g 3EI4A 4CC9A 2P9KC 3EI2A 2P9NC 4PNKB 4N14A 4JSPC 1B9YA 3N0DA 3UVMA 3GREA 2G99A 3RSEC 4ZN4A 5CXCA 2CNXA 1GOTB 1JJUB 2OVRB 3JRPA 2MTAH 4I79A 3AL8A 3MMYA 3DXKC 4A0AB 2CO0C 5TF2A 3UKUC 2GC4A 2H9LA 5HE0B 4A11B 2XL2A 4H5IA 2P9IC 1YFQA 1JOFA 3PSCB 2IAAA 2UZYB 5EMLB 3MXXA 4CY5A 1XIPA 3EWEA 3ORVD 3F3PA 5K1CC 4GGAA 2CN3A 4E54A 4MK0B 4Y5RD 2Z2NA
chains in the Genus database with same CATH superfamily
3CFVA 3EI1A 2AGXA 2YB8B 2TRCB 3O4IA 5IGOA 4A2MA 5HQGA 4O1QD 4K3JB 2Z2PA 3F3FA 4CY3A 3O4JA 2HESX 4K3ID 4O9DA 2PM6B 4J82A 4AOWA 4PBZA 3E0CA 4UI9R 2I3TA 3C99A 2BKLA 1MDAH 4D9SA 3KCIA 3JPXA 2BBKH 5B4WA 5HE2B 3BWSA 3I7NA 3RMZD 4A09A 4L1MA 2QR5A 2VZ3A 4J73A 2I0SA 5C2VB 4QT8A 4A0BB 1K3IA 1JV2A 4JD2C 4NSXA 2XDWA 3ZDXA 3IJ0A 2O9KA 3A0FA 3MKQA 3SLED 4UM8A 3SMRA 3QHYB 3O4GA 2YBAA 3K72A 4QAMA 4WK4A 2EIBA 5HDBA 1N6EA 5EALA 3JZGA 2VDQA 3C5MA 3I2NA 3V9FA 4ZOYA 2I0RA 4HDJA 3VGZA 5FQDA 4GQ2P 4G1MA 3OF7A 5K19A 3KRWB 5E6UA 5H1MA 2CN2A 5AJAA 1U8CA 2VC2A 2B5MA 3FRXA 4J84A 4Z7OA 3MVDK 3GFCA 5AMSA 1VZ3A 5CYKB 3K71A 4JT5C 2I0TA 4JSNC 5FXYA 4O02A 5TDHB 1N6DA 3IIWA 2OK6A 4ERQA 5C86A 3T3PA 2AGWA 2IUVA 2IUPA 1OMWB 5EARA 4O45A 3ZDZA 4GGCA 5FKSA 4CZXA 3IIYA 4AMYA 3B7FA 1H2WA 2P9PC 3UVLA 2XZGA 3DDUA 3ZE2A 4CY2A 3ZDYA 3V4PA 1NEXB 4FAND 5AFU3 4UM9A 2B5NA 2VDRA 4EWRA 3IULA 4GM3A 3JROA 4GZ8A 3EI3A 5IJ7E 5GXHA 5H17A 3AL9A 3MUOA 3JZNA 4AX4A 4MMXA 4J79A 3FCSA 4DNWA 2EIDA 4BCBA 3BG1A 3N0EA 2H9PA 4R7AB 1O6FA 3PXWD 5EMKB 4AN1A 2QC5A 1M1XA 2B5LA 3IJ1A 3SN6B 1XKSA 4ES0A 4GQ1A 4JSXC 4AEZA 4A08A 3P4FA 4BP9A 4L9OA 4KFMB 3PXTD 3RN0D 3UVNA 2AGLA 4QL1A 1C9IA 4FA1D 3U4YA 1SHYB 5EM2B 2Q7QA 3ZE0A 1B9XA 3KRXB 5CXBB 4E5ZA 3JB9L 4ZOVA 3OKWA 4JHPC 4J87A 4Z7QA 1RI6A 3IKOA 4FWWA 3SHFA 2J57G 4GM8A 4QRJA 5M5TA 4L1QD 4J77A 2H6QA 3AFCA 4X60B 2VDOA 5GMKn 1GG2B 2PM9A 2YNPA 2VDKA 3EQ7A 4MMYA 2H14A 2OIZA 2YNOA 4A7JA 4J78A 3IUQA 1PBYB 2YMUA 1A0RB 2VDNA 4A0AA 3W15A 3AH8B 4A11A 3NVNA 1BPOA 2Z2OA 4O2WA 4FA5D 3OKYB 3PSLA 2H9MA 2P9SC 1JMZB 2UZXB 5A2Qg 2H6NA 3GC3B 1T2XA 5HE1B 5IGQA 5EMMB 3SWSD 3PXSD 3DM0A 4CI3A 5TEFA 2VDLA 3DXMC 3EI4B 3L4OD 4LG9A 4G55A 3EI2B 4A2LA 3VH0A 4TZ4A 3PVUB 2H68A 4JT6C 4G1EA 2OK4A 3SXTD 3V7DB 2H13A 1TYQC 3I7OA 4CZVA 2HJBA 1GOGA 3VI4A 5IT9g 2XE4A 5CXCB 3IJEA 5HE3B 4NC4A 1OLZA 3FGBA 1H2ZA 1E8MA 3AL8B 1H2YA 2OVQB 2HU5A 4L3GD 3SVWD 5M5SA 3I8EA 4X3EA 4O3UB 5EAMA 3DWLC 2G9AA 4GM9A 3UVKA 4BH6A 4D6VA 3IUJA 4DNUA 3NIGA 3OKTA 4CI8A 4LGNA 4PSXB 2H6KA 4FHLA 4FA4D 2XL3A 3FM0A 4J8GA 4YVDA 3DSMA 4H5JA 2YNNA 4CI1A 5E6SA 4CI2A 3EMHA 3EU7A 4BUJC 3I89A 1VE6A 4DNVA 3F3GA 3HFQA 4Y7RA 2AGYA 3BG0A 4PC0A 4E54B 1A12A 1VYHC 3T3MA 4BCDA 1MG2A 3IURA 3EI1B 1E8NA 1U2VC 3RFGA 1P22A 3V5WB 2CE8A 3FCUA 3UVOA 3MZLA 4AMZA 5E6RA 5FLXg 3I7KA 3OL2A 2J55H 2AH0A 3VI3A 3C75H 1R5MA 3UKRC 4QQEA 2HXCA 3CFSB 3I7HA 4GGDA 4JXMA 4PBYA 2PM9B 4J86A 1PEVA 1GP2B 4CY1A 5CYKA 2EBSA 4IRZA 4FA9D 3OTTA 4A09B 4L3HD 3OW8A 1UOQA 5JWZA 1GOHA 3NVXA 4NBMA 2HKRA 4OZUA 3MUNA 3ODTA 5FA5B 1I2MB 4GQBB 2VZ1A 2PM7B 5FKRA 4J0XA 2H9NA 4Z7NA 2XYIA 3IUMA 5IJ8E 2AQ5A 5HYNB 3NIDA 1TYEA 3NVQA 1YR2A 1E5TA 3QI0A 1GOFA 2CE9A 5I5MA 2CO0A 4J8BA 5IC7A 4JSVC 5M5UA 3JZHA 3SCYA 2QXVA 4OWRA 3K26A 2HU7A 1XHMA 2HYEA 3RRMC 2IWKA 2GNQA 4XYIA 3UR4A 1JTDB 3SBQA 2AH1A 1SQ9A 4J81A 4ERZA 4FB1D 5C9ZB 1GXRA 5SXMA 2GC7A 3ULEC 4O3TB 5GXIA 3MKSB 4NENA 1K32A 5KDOB 2IWFA 4X61B 4RE6A 4U1EI 4WK0A 5TEEA 2XU7A 3RLMD 4BL0A 4MMZA 3C9CA 1JMXB 3EQ9A 2VDPA 2BCJB 3CIKB 4X63B 3GD1I 4WK2A 3VA6A 2H47A 2QZPA 1L0QA 1MG3A 4GMBA 5EMJB 5THAA 3K6SA 3J81g 5I5JA 1K8KC 4PXWA 3O4HA 1SQJA 5EM2A 2B4EA 5GSAA 4XYHA 2P9LC 4D0KA 5I5IA 4J0WA 5CXBA 3PE7A 2HU8A 1FWXA 3JAMg 4IA9A 4NAAA 3SBRA 2VDMA 3SFZA 3I7LA 5FFOA 3SBPA 1U4CA 2J56H 3SJLD 5C2WB 3EI3B 1Q47A 2PBIB 2EIEA 3RN1D 3K27A 2WQ8A 1PI6A 2W18A 1NR0A 3I8CA 4ERYA 2HKMA 3ZWLB 3ZE1A 5H14A 3OL2B 3IJCA 1S4UX 2HJ4A 4BCCA 4ZOZA 5C92A 4A0BA 1C9LA 1L5GA 1N6FA 4G56B 4ESGA 2JKXA 4A08B 3RFHA 2P9UC 4PSWB 4WJKA 3L4MD 2OVPB 4FAVD 4IMMA 1VE7A 2IURA 4U7AA 1PGUA 3V4VA 2H3XA 3I7PA 2IUQA 3OKYA 5FKTA 2AGZA 4XEIC 3MZKA 3EG6A 2I3SA 5FKQA 4BP8A 4E5ZB 1QNIA 4Z8LA 5M61A 3PVWB 4CZYA 1ERJA 3EQ8A 5EAPA 2OJYA 4LG8A 4ZOXA 1TBGA 3J80g 3EI4A 4CC9A 2P9KC 4AN0A 3EI2A 2P9NC 4PNKB 1O6GA 4N14A 4JSPC 1B9YA 1UOOA 3N0DA 1UOPA 3NIFA 4RE5A 3UVMA 3GREA 2G99A 3RSEC 4ZN4A 5CXCA 2CNXA 4JHNA 1GOTB 1JJUB 2OVRB 3JRPA 2MTAH 4I79A 3AL8A 3MMYA 3DXKC 4A0AB 2CO0C 5TF2A 3UKUC 2GC4A 2EICA 2H9LA 3IVMA 5HE0B 4A11B 2XL2A 4H5IA 2P9IC 1YFQA 3IUNA 1UTCA 1JOFA 3PSCB 5M5RA 1VZ2A 2IAAA 5FFGA 2UZYB 5EMLB 5M5VA 3MXXA 4CY5A 1QFSA 1H2XA 1QFMA 1XIPA 3EWEA 3ORVD 3F3PA 5K1CC 4GGAA 2CN3A 4E54A 4MK0B 4Y5RD 2Z2NA
chains in the Genus database with same CATH topology
3CFVA 3EI1A 2AGXA 2YB8B 2TRCB 4A2MA 5IGOA 5HQGA 4O1QD 4K3JB 2Z2PA 3F3FA 4CY3A 2HESX 4K3ID 4O9DA 2PM6B 4J82A 4AOWA 4PBZA 3E0CA 4UI9R 2I3TA 3C99A 1MDAH 3JPXA 2BBKH 5B4WA 5HE2B 3BWSA 3I7NA 3RMZD 4A09A 4J73A 2I0SA 5C2VB 4QT8A 4A0BB 4JD2C 4NSXA 3IJ0A 2O9KA 3A0FA 3MKQA 3SLED 3SMRA 2YBAA 1N6EA 5EALA 3JZGA 3C5MA 3I2NA 3V9FA 4ZOYA 2I0RA 4HDJA 3VGZA 5FQDA 4GQ2P 5K19A 3KRWB 5H1MA 2CN2A 5AJAA 2B5MA 3FRXA 4J84A 3GFCA 5AMSA 5CYKB 4JT5C 2I0TA 4JSNC 5FXYA 5TDHB 1N6DA 3IIWA 2OK6A 4ERQA 2AGWA 2IUVA 2IUPA 1OMWB 5EARA 4O45A 4GGCA 5FKSA 4CZXA 3IIYA 3B7FA 2P9PC 3UVLA 4CY2A 5AFU3 1NEXB 4FAND 2B5NA 4EWRA 4GM3A 3JROA 4GZ8A 3EI3A 5IJ7E 5GXHA 5H17A 3AL9A 3JZNA 4J79A 3BG1A 3N0EA 2H9PA 4R7AB 3PXWD 5EMKB 2QC5A 2B5LA 3IJ1A 3SN6B 1XKSA 4ES0A 4GQ1A 4JSXC 4AEZA 4A08A 3P4FA 4L9OA 4KFMB 3PXTD 3RN0D 3UVNA 2AGLA 4QL1A 4FA1D 3U4YA 1SHYB 5EM2B 2Q7QA 1B9XA 3KRXB 5CXBB 4E5ZA 3JB9L 4ZOVA 3OKWA 4J87A 1RI6A 3IKOA 4FWWA 3SHFA 2J57G 4GM8A 4QRJA 4L1QD 4J77A 2H6QA 3AFCA 4X60B 5GMKn 1GG2B 2PM9A 2YNPA 2H14A 2OIZA 2YNOA 4A7JA 4J78A 1PBYB 2YMUA 1A0RB 4A0AA 3W15A 3AH8B 4A11A 3NVNA 2Z2OA 4FA5D 3OKYB 3PSLA 2H9MA 2P9SC 1JMZB 2UZXB 5A2Qg 2H6NA 5HE1B 5IGQA 5EMMB 3SWSD 3PXSD 3DM0A 4CI3A 5TEFA 3DXMC 3EI4B 3L4OD 4LG9A 3EI2B 4A2LA 3VH0A 4TZ4A 3PVUB 2H68A 4JT6C 3SXTD 2OK4A 3V7DB 2H13A 1TYQC 3I7OA 4CZVA 2HJBA 5IT9g 5CXCB 5HE3B 1OLZA 3FGBA 3AL8B 2OVQB 4L3GD 3SVWD 3I8EA 4X3EA 4O3UB 5EAMA 3DWLC 2G9AA 4GM9A 3UVKA 4BH6A 4D6VA 3OKTA 4CI8A 4LGNA 4PSXB 2H6KA 4FHLA 4FA4D 2XL3A 3FM0A 4J8GA 4YVDA 3DSMA 4H5JA 2YNNA 4CI1A 4CI2A 3EMHA 3EU7A 4BUJC 3I89A 3F3GA 3HFQA 4Y7RA 2AGYA 3BG0A 4PC0A 4E54B 1VYHC 1MG2A 3EI1B 1U2VC 3RFGA 1P22A 3V5WB 2CE8A 3UVOA 3MZLA 5FLXg 3I7KA 3OL2A 2J55H 2AH0A 3C75H 1R5MA 3UKRC 4QQEA 2HXCA 3CFSB 3I7HA 4GGDA 4JXMA 4PBYA 2PM9B 4J86A 1PEVA 1GP2B 4CY1A 5CYKA 2EBSA 4FA9D 3OTTA 4A09B 4L3HD 3OW8A 5JWZA 3NVXA 2HKRA 4OZUA 5FA5B 3ODTA 4GQBB 2PM7B 5FKRA 4J0XA 2H9NA 2XYIA 5IJ8E 2AQ5A 5HYNB 3NVQA 2CE9A 5I5MA 2CO0A 4J8BA 5IC7A 4JSVC 3JZHA 3SCYA 2QXVA 4OWRA 3K26A 1XHMA 2HYEA 3RRMC 2IWKA 2GNQA 4XYIA 3UR4A 3SBQA 2AH1A 1SQ9A 4J81A 4ERZA 4FB1D 5C9ZB 1GXRA 5SXMA 2GC7A 3ULEC 4O3TB 5GXIA 3MKSB 1K32A 5KDOB 2IWFA 4X61B 4U1EI 5TEEA 2XU7A 3RLMD 4BL0A 3C9CA 1JMXB 3CIKB 2BCJB 4X63B 3VA6A 2H47A 1L0QA 1MG3A 4GMBA 5EMJB 5THAA 3J81g 5I5JA 1K8KC 4PXWA 1SQJA 5EM2A 2B4EA 5GSAA 4XYHA 2P9LC 4D0KA 5I5IA 4J0WA 5CXBA 3PE7A 1FWXA 3JAMg 4IA9A 3SBRA 3SFZA 3I7LA 3SBPA 1U4CA 2J56H 3SJLD 5C2WB 3EI3B 1Q47A 2PBIB 3RN1D 3K27A 1PI6A 2W18A 1NR0A 3I8CA 4ERYA 2HKMA 3ZWLB 5H14A 3OL2B 3IJCA 1S4UX 2HJ4A 4ZOZA 4A0BA 1N6FA 4G56B 4ESGA 4A08B 3RFHA 2P9UC 4PSWB 3L4MD 2OVPB 4FAVD 4IMMA 2IURA 4U7AA 1PGUA 2H3XA 3I7PA 2IUQA 3OKYA 5FKTA 2AGZA 4XEIC 3MZKA 3EG6A 2I3SA 5FKQA 4E5ZB 1QNIA 4Z8LA 3PVWB 4CZYA 1ERJA 5EAPA 2OJYA 4LG8A 4ZOXA 1TBGA 3J80g 3EI4A 4CC9A 2P9KC 3EI2A 2P9NC 4PNKB 4N14A 4JSPC 1B9YA 3N0DA 3UVMA 3GREA 2G99A 3RSEC 4ZN4A 5CXCA 2CNXA 1GOTB 1JJUB 2OVRB 3JRPA 2MTAH 4I79A 3AL8A 3MMYA 3DXKC 4A0AB 2CO0C 5TF2A 3UKUC 2GC4A 2H9LA 5HE0B 4A11B 2XL2A 4H5IA 2P9IC 1YFQA 1JOFA 3PSCB 2IAAA 2UZYB 5EMLB 3MXXA 4CY5A 1XIPA 3EWEA 3ORVD 3F3PA 5K1CC 4GGAA 2CN3A 4E54A 4MK0B 4Y5RD 2Z2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFV A;  3EI1 A;  2AGX A;  2YB8 B;  2TRC B;  4A2M A;  5IGO A;  5HQG A;  4O1Q D;  4K3J B;  2Z2P A;  3F3F A;  4CY3 A;  2HES X;  4K3I D;  4O9D A;  2PM6 B;  4J82 A;  4AOW A;  4PBZ A;  3E0C A;  4UI9 R;  2I3T A;  3C99 A;  1MDA H;  3JPX A;  2BBK H;  5B4W A;  5HE2 B;  3BWS A;  3I7N A;  3RMZ D;  4A09 A;  4J73 A;  2I0S A;  5C2V B;  4QT8 A;  4A0B B;  4JD2 C;  4NSX A;  3IJ0 A;  2O9K A;  3A0F A;  3MKQ A;  3SLE D;  3SMR A;  2YBA A;  1N6E A;  5EAL A;  3JZG A;  3C5M A;  3I2N A;  3V9F A;  4ZOY A;  2I0R A;  4HDJ A;  3VGZ A;  5FQD A;  4GQ2 P;  5K19 A;  3KRW B;  5H1M A;  2CN2 A;  5AJA A;  2B5M A;  3FRX A;  4J84 A;  3GFC A;  5AMS A;  5CYK B;  4JT5 C;  2I0T A;  4JSN C;  5FXY A;  5TDH B;  1N6D A;  3IIW A;  2OK6 A;  4ERQ A;  2AGW A;  2IUV A;  2IUP A;  1OMW B;  5EAR A;  4O45 A;  4GGC A;  5FKS A;  4CZX A;  3IIY A;  3B7F A;  2P9P C;  3UVL A;  4CY2 A;  5AFU 3;  1NEX B;  4FAN D;  2B5N A;  4EWR A;  4GM3 A;  3JRO A;  4GZ8 A;  3EI3 A;  5IJ7 E;  5GXH A;  5H17 A;  3AL9 A;  3JZN A;  4J79 A;  3BG1 A;  3N0E A;  2H9P A;  4R7A B;  3PXW D;  5EMK B;  2QC5 A;  2B5L A;  3IJ1 A;  3SN6 B;  1XKS A;  4ES0 A;  4GQ1 A;  4JSX C;  4AEZ A;  4A08 A;  3P4F A;  4L9O A;  4KFM B;  3PXT D;  3RN0 D;  3UVN A;  2AGL A;  4QL1 A;  4FA1 D;  3U4Y A;  1SHY B;  5EM2 B;  2Q7Q A;  1B9X A;  3KRX B;  5CXB B;  4E5Z A;  3JB9 L;  4ZOV A;  3OKW A;  4J87 A;  1RI6 A;  3IKO A;  4FWW A;  3SHF A;  2J57 G;  4GM8 A;  4QRJ A;  4L1Q D;  4J77 A;  2H6Q A;  3AFC A;  4X60 B;  5GMK n;  1GG2 B;  2PM9 A;  2YNP A;  2H14 A;  2OIZ A;  2YNO A;  4A7J A;  4J78 A;  1PBY B;  2YMU A;  1A0R B;  4A0A A;  3W15 A;  3AH8 B;  4A11 A;  3NVN A;  2Z2O A;  4FA5 D;  3OKY B;  3PSL A;  2H9M A;  2P9S C;  1JMZ B;  2UZX B;  5A2Q g;  2H6N A;  5HE1 B;  5IGQ A;  5EMM B;  3SWS D;  3PXS D;  3DM0 A;  4CI3 A;  5TEF A;  3DXM C;  3EI4 B;  3L4O D;  4LG9 A;  3EI2 B;  4A2L A;  3VH0 A;  4TZ4 A;  3PVU B;  2H68 A;  4JT6 C;  3SXT D;  2OK4 A;  3V7D B;  2H13 A;  1TYQ C;  3I7O A;  4CZV A;  2HJB A;  5IT9 g;  5CXC B;  5HE3 B;  1OLZ A;  3FGB A;  3AL8 B;  2OVQ B;  4L3G D;  3SVW D;  3I8E A;  4X3E A;  4O3U B;  5EAM A;  3DWL C;  2G9A A;  4GM9 A;  3UVK A;  4BH6 A;  4D6V A;  3OKT A;  4CI8 A;  4LGN A;  4PSX B;  2H6K A;  4FHL A;  4FA4 D;  2XL3 A;  3FM0 A;  4J8G A;  4YVD A;  3DSM A;  4H5J A;  2YNN A;  4CI1 A;  4CI2 A;  3EMH A;  3EU7 A;  4BUJ C;  3I89 A;  3F3G A;  3HFQ A;  4Y7R A;  2AGY A;  3BG0 A;  4PC0 A;  4E54 B;  1VYH C;  1MG2 A;  3EI1 B;  1U2V C;  3RFG A;  1P22 A;  3V5W B;  2CE8 A;  3UVO A;  3MZL A;  5FLX g;  3I7K A;  3OL2 A;  2J55 H;  2AH0 A;  3C75 H;  1R5M A;  3UKR C;  4QQE A;  2HXC A;  3CFS B;  3I7H A;  4GGD A;  4JXM A;  4PBY A;  2PM9 B;  4J86 A;  1PEV A;  1GP2 B;  4CY1 A;  5CYK A;  2EBS A;  4FA9 D;  3OTT A;  4A09 B;  4L3H D;  3OW8 A;  5JWZ A;  3NVX A;  2HKR A;  4OZU A;  5FA5 B;  3ODT A;  4GQB B;  2PM7 B;  5FKR A;  4J0X A;  2H9N A;  2XYI A;  5IJ8 E;  2AQ5 A;  5HYN B;  3NVQ A;  2CE9 A;  5I5M A;  2CO0 A;  4J8B A;  5IC7 A;  4JSV C;  3JZH A;  3SCY A;  2QXV A;  4OWR A;  3K26 A;  1XHM A;  2HYE A;  3RRM C;  2IWK A;  2GNQ A;  4XYI A;  3UR4 A;  3SBQ A;  2AH1 A;  1SQ9 A;  4J81 A;  4ERZ A;  4FB1 D;  5C9Z B;  1GXR A;  5SXM A;  2GC7 A;  3ULE C;  4O3T B;  5GXI A;  3MKS B;  1K32 A;  5KDO B;  2IWF A;  4X61 B;  4U1E I;  5TEE A;  2XU7 A;  3RLM D;  4BL0 A;  3C9C A;  1JMX B;  3CIK B;  2BCJ B;  4X63 B;  3VA6 A;  2H47 A;  1L0Q A;  1MG3 A;  4GMB A;  5EMJ B;  5THA A;  3J81 g;  5I5J A;  1K8K C;  4PXW A;  1SQJ A;  5EM2 A;  2B4E A;  5GSA A;  4XYH A;  2P9L C;  4D0K A;  5I5I A;  4J0W A;  5CXB A;  3PE7 A;  1FWX A;  3JAM g;  4IA9 A;  3SBR A;  3SFZ A;  3I7L A;  3SBP A;  1U4C A;  2J56 H;  3SJL D;  5C2W B;  3EI3 B;  1Q47 A;  2PBI B;  3RN1 D;  3K27 A;  1PI6 A;  2W18 A;  1NR0 A;  3I8C A;  4ERY A;  2HKM A;  3ZWL B;  5H14 A;  3OL2 B;  3IJC A;  1S4U X;  2HJ4 A;  4ZOZ A;  4A0B A;  1N6F A;  4G56 B;  4ESG A;  4A08 B;  3RFH A;  2P9U C;  4PSW B;  3L4M D;  2OVP B;  4FAV D;  4IMM A;  2IUR A;  4U7A A;  1PGU A;  2H3X A;  3I7P A;  2IUQ A;  3OKY A;  5FKT A;  2AGZ A;  4XEI C;  3MZK A;  3EG6 A;  2I3S A;  5FKQ A;  4E5Z B;  1QNI A;  4Z8L A;  3PVW B;  4CZY A;  1ERJ A;  5EAP A;  2OJY A;  4LG8 A;  4ZOX A;  1TBG A;  3J80 g;  3EI4 A;  4CC9 A;  2P9K C;  3EI2 A;  2P9N C;  4PNK B;  4N14 A;  4JSP C;  1B9Y A;  3N0D A;  3UVM A;  3GRE A;  2G99 A;  3RSE C;  4ZN4 A;  5CXC A;  2CNX A;  1GOT B;  1JJU B;  2OVR B;  3JRP A;  2MTA H;  4I79 A;  3AL8 A;  3MMY A;  3DXK C;  4A0A B;  2CO0 C;  5TF2 A;  3UKU C;  2GC4 A;  2H9L A;  5HE0 B;  4A11 B;  2XL2 A;  4H5I A;  2P9I C;  1YFQ A;  1JOF A;  3PSC B;  2IAA A;  2UZY B;  5EML B;  3MXX A;  4CY5 A;  1XIP A;  3EWE A;  3ORV D;  3F3P A;  5K1C C;  4GGA A;  2CN3 A;  4E54 A;  4MK0 B;  4Y5R D;  2Z2N A; 
#chains in the Genus database with same CATH topology
 3CFV A;  3EI1 A;  2AGX A;  2YB8 B;  2TRC B;  3O4I A;  5IGO A;  4A2M A;  5HQG A;  4O1Q D;  4K3J B;  2Z2P A;  3F3F A;  4CY3 A;  3O4J A;  2HES X;  4K3I D;  4O9D A;  2PM6 B;  4J82 A;  4AOW A;  4PBZ A;  3E0C A;  4UI9 R;  2I3T A;  3C99 A;  2BKL A;  1MDA H;  4D9S A;  3KCI A;  3JPX A;  2BBK H;  5B4W A;  5HE2 B;  3BWS A;  3I7N A;  3RMZ D;  4A09 A;  4L1M A;  2QR5 A;  2VZ3 A;  4J73 A;  2I0S A;  5C2V B;  4QT8 A;  4A0B B;  1K3I A;  1JV2 A;  4JD2 C;  4NSX A;  2XDW A;  3ZDX A;  3IJ0 A;  2O9K A;  3A0F A;  3MKQ A;  3SLE D;  4UM8 A;  3SMR A;  3QHY B;  3O4G A;  2YBA A;  3K72 A;  4QAM A;  4WK4 A;  2EIB A;  5HDB A;  1N6E A;  5EAL A;  3JZG A;  2VDQ A;  3C5M A;  3I2N A;  3V9F A;  4ZOY A;  2I0R A;  4HDJ A;  3VGZ A;  5FQD A;  4GQ2 P;  4G1M A;  3OF7 A;  5K19 A;  3KRW B;  5E6U A;  5H1M A;  2CN2 A;  5AJA A;  1U8C A;  2VC2 A;  2B5M A;  3FRX A;  4J84 A;  4Z7O A;  3MVD K;  3GFC A;  5AMS A;  1VZ3 A;  5CYK B;  3K71 A;  4JT5 C;  2I0T A;  4JSN C;  5FXY A;  4O02 A;  5TDH B;  1N6D A;  3IIW A;  2OK6 A;  4ERQ A;  5C86 A;  3T3P A;  2AGW A;  2IUV A;  2IUP A;  1OMW B;  5EAR A;  4O45 A;  3ZDZ A;  4GGC A;  5FKS A;  4CZX A;  3IIY A;  4AMY A;  3B7F A;  1H2W A;  2P9P C;  3UVL A;  2XZG A;  3DDU A;  3ZE2 A;  4CY2 A;  3ZDY A;  3V4P A;  1NEX B;  4FAN D;  5AFU 3;  4UM9 A;  2B5N A;  2VDR A;  4EWR A;  3IUL A;  4GM3 A;  3JRO A;  4GZ8 A;  3EI3 A;  5IJ7 E;  5GXH A;  5H17 A;  3AL9 A;  3MUO A;  3JZN A;  4AX4 A;  4MMX A;  4J79 A;  3FCS A;  4DNW A;  2EID A;  4BCB A;  3BG1 A;  3N0E A;  2H9P A;  4R7A B;  1O6F A;  3PXW D;  5EMK B;  4AN1 A;  2QC5 A;  1M1X A;  2B5L A;  3IJ1 A;  3SN6 B;  1XKS A;  4ES0 A;  4GQ1 A;  4JSX C;  4AEZ A;  4A08 A;  3P4F A;  4BP9 A;  4L9O A;  4KFM B;  3PXT D;  3RN0 D;  3UVN A;  2AGL A;  4QL1 A;  1C9I A;  4FA1 D;  3U4Y A;  1SHY B;  5EM2 B;  2Q7Q A;  3ZE0 A;  1B9X A;  3KRX B;  5CXB B;  4E5Z A;  3JB9 L;  4ZOV A;  3OKW A;  4JHP C;  4J87 A;  4Z7Q A;  1RI6 A;  3IKO A;  4FWW A;  3SHF A;  2J57 G;  4GM8 A;  4QRJ A;  5M5T A;  4L1Q D;  4J77 A;  2H6Q A;  3AFC A;  4X60 B;  2VDO A;  5GMK n;  1GG2 B;  2PM9 A;  2YNP A;  2VDK A;  3EQ7 A;  4MMY A;  2H14 A;  2OIZ A;  2YNO A;  4A7J A;  4J78 A;  3IUQ A;  1PBY B;  2YMU A;  1A0R B;  2VDN A;  4A0A A;  3W15 A;  3AH8 B;  4A11 A;  3NVN A;  1BPO A;  2Z2O A;  4O2W A;  4FA5 D;  3OKY B;  3PSL A;  2H9M A;  2P9S C;  1JMZ B;  2UZX B;  5A2Q g;  2H6N A;  3GC3 B;  1T2X A;  5HE1 B;  5IGQ A;  5EMM B;  3SWS D;  3PXS D;  3DM0 A;  4CI3 A;  5TEF A;  2VDL A;  3DXM C;  3EI4 B;  3L4O D;  4LG9 A;  4G55 A;  3EI2 B;  4A2L A;  3VH0 A;  4TZ4 A;  3PVU B;  2H68 A;  4JT6 C;  4G1E A;  2OK4 A;  3SXT D;  3V7D B;  2H13 A;  1TYQ C;  3I7O A;  4CZV A;  2HJB A;  1GOG A;  3VI4 A;  5IT9 g;  2XE4 A;  5CXC B;  3IJE A;  5HE3 B;  4NC4 A;  1OLZ A;  3FGB A;  1H2Z A;  1E8M A;  3AL8 B;  1H2Y A;  2OVQ B;  2HU5 A;  4L3G D;  3SVW D;  5M5S A;  3I8E A;  4X3E A;  4O3U B;  5EAM A;  3DWL C;  2G9A A;  4GM9 A;  3UVK A;  4BH6 A;  4D6V A;  3IUJ A;  4DNU A;  3NIG A;  3OKT A;  4CI8 A;  4LGN A;  4PSX B;  2H6K A;  4FHL A;  4FA4 D;  2XL3 A;  3FM0 A;  4J8G A;  4YVD A;  3DSM A;  4H5J A;  2YNN A;  4CI1 A;  5E6S A;  4CI2 A;  3EMH A;  3EU7 A;  4BUJ C;  3I89 A;  1VE6 A;  4DNV A;  3F3G A;  3HFQ A;  4Y7R A;  2AGY A;  3BG0 A;  4PC0 A;  4E54 B;  1A12 A;  1VYH C;  3T3M A;  4BCD A;  1MG2 A;  3IUR A;  3EI1 B;  1E8N A;  1U2V C;  3RFG A;  1P22 A;  3V5W B;  2CE8 A;  3FCU A;  3UVO A;  3MZL A;  4AMZ A;  5E6R A;  5FLX g;  3I7K A;  3OL2 A;  2J55 H;  2AH0 A;  3VI3 A;  3C75 H;  1R5M A;  3UKR C;  4QQE A;  2HXC A;  3CFS B;  3I7H A;  4GGD A;  4JXM A;  4PBY A;  2PM9 B;  4J86 A;  1PEV A;  1GP2 B;  4CY1 A;  5CYK A;  2EBS A;  4IRZ A;  4FA9 D;  3OTT A;  4A09 B;  4L3H D;  3OW8 A;  1UOQ A;  5JWZ A;  1GOH A;  3NVX A;  4NBM A;  2HKR A;  4OZU A;  3MUN A;  3ODT A;  5FA5 B;  1I2M B;  4GQB B;  2VZ1 A;  2PM7 B;  5FKR A;  4J0X A;  2H9N A;  4Z7N A;  2XYI A;  3IUM A;  5IJ8 E;  2AQ5 A;  5HYN B;  3NID A;  1TYE A;  3NVQ A;  1YR2 A;  1E5T A;  3QI0 A;  1GOF A;  2CE9 A;  5I5M A;  2CO0 A;  4J8B A;  5IC7 A;  4JSV C;  5M5U A;  3JZH A;  3SCY A;  2QXV A;  4OWR A;  3K26 A;  2HU7 A;  1XHM A;  2HYE A;  3RRM C;  2IWK A;  2GNQ A;  4XYI A;  3UR4 A;  1JTD B;  3SBQ A;  2AH1 A;  1SQ9 A;  4J81 A;  4ERZ A;  4FB1 D;  5C9Z B;  1GXR A;  5SXM A;  2GC7 A;  3ULE C;  4O3T B;  5GXI A;  3MKS B;  4NEN A;  1K32 A;  5KDO B;  2IWF A;  4X61 B;  4RE6 A;  4U1E I;  4WK0 A;  5TEE A;  2XU7 A;  3RLM D;  4BL0 A;  4MMZ A;  3C9C A;  1JMX B;  3EQ9 A;  2VDP A;  2BCJ B;  3CIK B;  4X63 B;  3GD1 I;  4WK2 A;  3VA6 A;  2H47 A;  2QZP A;  1L0Q A;  1MG3 A;  4GMB A;  5EMJ B;  5THA A;  3K6S A;  3J81 g;  5I5J A;  1K8K C;  4PXW A;  3O4H A;  1SQJ A;  5EM2 A;  2B4E A;  5GSA A;  4XYH A;  2P9L C;  4D0K A;  5I5I A;  4J0W A;  5CXB A;  3PE7 A;  2HU8 A;  1FWX A;  3JAM g;  4IA9 A;  4NAA A;  3SBR A;  2VDM A;  3SFZ A;  3I7L A;  5FFO A;  3SBP A;  1U4C A;  2J56 H;  3SJL D;  5C2W B;  3EI3 B;  1Q47 A;  2PBI B;  2EIE A;  3RN1 D;  3K27 A;  2WQ8 A;  1PI6 A;  2W18 A;  1NR0 A;  3I8C A;  4ERY A;  2HKM A;  3ZWL B;  3ZE1 A;  5H14 A;  3OL2 B;  3IJC A;  1S4U X;  2HJ4 A;  4BCC A;  4ZOZ A;  5C92 A;  4A0B A;  1C9L A;  1L5G A;  1N6F A;  4G56 B;  4ESG A;  2JKX A;  4A08 B;  3RFH A;  2P9U C;  4PSW B;  4WJK A;  3L4M D;  2OVP B;  4FAV D;  4IMM A;  1VE7 A;  2IUR A;  4U7A A;  1PGU A;  3V4V A;  2H3X A;  3I7P A;  2IUQ A;  3OKY A;  5FKT A;  2AGZ A;  4XEI C;  3MZK A;  3EG6 A;  2I3S A;  5FKQ A;  4BP8 A;  4E5Z B;  1QNI A;  4Z8L A;  5M61 A;  3PVW B;  4CZY A;  1ERJ A;  3EQ8 A;  5EAP A;  2OJY A;  4LG8 A;  4ZOX A;  1TBG A;  3J80 g;  3EI4 A;  4CC9 A;  2P9K C;  4AN0 A;  3EI2 A;  2P9N C;  4PNK B;  1O6G A;  4N14 A;  4JSP C;  1B9Y A;  1UOO A;  3N0D A;  1UOP A;  3NIF A;  4RE5 A;  3UVM A;  3GRE A;  2G99 A;  3RSE C;  4ZN4 A;  5CXC A;  2CNX A;  4JHN A;  1GOT B;  1JJU B;  2OVR B;  3JRP A;  2MTA H;  4I79 A;  3AL8 A;  3MMY A;  3DXK C;  4A0A B;  2CO0 C;  5TF2 A;  3UKU C;  2GC4 A;  2EIC A;  2H9L A;  3IVM A;  5HE0 B;  4A11 B;  2XL2 A;  4H5I A;  2P9I C;  1YFQ A;  3IUN A;  1UTC A;  1JOF A;  3PSC B;  5M5R A;  1VZ2 A;  2IAA A;  5FFG A;  2UZY B;  5EML B;  5M5V A;  3MXX A;  4CY5 A;  1QFS A;  1H2X A;  1QFM A;  1XIP A;  3EWE A;  3ORV D;  3F3P A;  5K1C C;  4GGA A;  2CN3 A;  4E54 A;  4MK0 B;  4Y5R D;  2Z2N A; 
#chains in the Genus database with same CATH homology
 3CFV A;  3EI1 A;  2AGX A;  2YB8 B;  2TRC B;  4A2M A;  5IGO A;  5HQG A;  4O1Q D;  4K3J B;  2Z2P A;  3F3F A;  4CY3 A;  2HES X;  4K3I D;  4O9D A;  2PM6 B;  4J82 A;  4AOW A;  4PBZ A;  3E0C A;  4UI9 R;  2I3T A;  3C99 A;  1MDA H;  3JPX A;  2BBK H;  5B4W A;  5HE2 B;  3BWS A;  3I7N A;  3RMZ D;  4A09 A;  4J73 A;  2I0S A;  5C2V B;  4QT8 A;  4A0B B;  4JD2 C;  4NSX A;  3IJ0 A;  2O9K A;  3A0F A;  3MKQ A;  3SLE D;  3SMR A;  2YBA A;  1N6E A;  5EAL A;  3JZG A;  3C5M A;  3I2N A;  3V9F A;  4ZOY A;  2I0R A;  4HDJ A;  3VGZ A;  5FQD A;  4GQ2 P;  5K19 A;  3KRW B;  5H1M A;  2CN2 A;  5AJA A;  2B5M A;  3FRX A;  4J84 A;  3GFC A;  5AMS A;  5CYK B;  4JT5 C;  2I0T A;  4JSN C;  5FXY A;  5TDH B;  1N6D A;  3IIW A;  2OK6 A;  4ERQ A;  2AGW A;  2IUV A;  2IUP A;  1OMW B;  5EAR A;  4O45 A;  4GGC A;  5FKS A;  4CZX A;  3IIY A;  3B7F A;  2P9P C;  3UVL A;  4CY2 A;  5AFU 3;  1NEX B;  4FAN D;  2B5N A;  4EWR A;  4GM3 A;  3JRO A;  4GZ8 A;  3EI3 A;  5IJ7 E;  5GXH A;  5H17 A;  3AL9 A;  3JZN A;  4J79 A;  3BG1 A;  3N0E A;  2H9P A;  4R7A B;  3PXW D;  5EMK B;  2QC5 A;  2B5L A;  3IJ1 A;  3SN6 B;  1XKS A;  4ES0 A;  4GQ1 A;  4JSX C;  4AEZ A;  4A08 A;  3P4F A;  4L9O A;  4KFM B;  3PXT D;  3RN0 D;  3UVN A;  2AGL A;  4QL1 A;  4FA1 D;  3U4Y A;  1SHY B;  5EM2 B;  2Q7Q A;  1B9X A;  3KRX B;  5CXB B;  4E5Z A;  3JB9 L;  4ZOV A;  3OKW A;  4J87 A;  1RI6 A;  3IKO A;  4FWW A;  3SHF A;  2J57 G;  4GM8 A;  4QRJ A;  4L1Q D;  4J77 A;  2H6Q A;  3AFC A;  4X60 B;  5GMK n;  1GG2 B;  2PM9 A;  2YNP A;  2H14 A;  2OIZ A;  2YNO A;  4A7J A;  4J78 A;  1PBY B;  2YMU A;  1A0R B;  4A0A A;  3W15 A;  3AH8 B;  4A11 A;  3NVN A;  2Z2O A;  4FA5 D;  3OKY B;  3PSL A;  2H9M A;  2P9S C;  1JMZ B;  2UZX B;  5A2Q g;  2H6N A;  5HE1 B;  5IGQ A;  5EMM B;  3SWS D;  3PXS D;  3DM0 A;  4CI3 A;  5TEF A;  3DXM C;  3EI4 B;  3L4O D;  4LG9 A;  3EI2 B;  4A2L A;  3VH0 A;  4TZ4 A;  3PVU B;  2H68 A;  4JT6 C;  3SXT D;  2OK4 A;  3V7D B;  2H13 A;  1TYQ C;  3I7O A;  4CZV A;  2HJB A;  5IT9 g;  5CXC B;  5HE3 B;  1OLZ A;  3FGB A;  3AL8 B;  2OVQ B;  4L3G D;  3SVW D;  3I8E A;  4X3E A;  4O3U B;  5EAM A;  3DWL C;  2G9A A;  4GM9 A;  3UVK A;  4BH6 A;  4D6V A;  3OKT A;  4CI8 A;  4LGN A;  4PSX B;  2H6K A;  4FHL A;  4FA4 D;  2XL3 A;  3FM0 A;  4J8G A;  4YVD A;  3DSM A;  4H5J A;  2YNN A;  4CI1 A;  4CI2 A;  3EMH A;  3EU7 A;  4BUJ C;  3I89 A;  3F3G A;  3HFQ A;  4Y7R A;  2AGY A;  3BG0 A;  4PC0 A;  4E54 B;  1VYH C;  1MG2 A;  3EI1 B;  1U2V C;  3RFG A;  1P22 A;  3V5W B;  2CE8 A;  3UVO A;  3MZL A;  5FLX g;  3I7K A;  3OL2 A;  2J55 H;  2AH0 A;  3C75 H;  1R5M A;  3UKR C;  4QQE A;  2HXC A;  3CFS B;  3I7H A;  4GGD A;  4JXM A;  4PBY A;  2PM9 B;  4J86 A;  1PEV A;  1GP2 B;  4CY1 A;  5CYK A;  2EBS A;  4FA9 D;  3OTT A;  4A09 B;  4L3H D;  3OW8 A;  5JWZ A;  3NVX A;  2HKR A;  4OZU A;  5FA5 B;  3ODT A;  4GQB B;  2PM7 B;  5FKR A;  4J0X A;  2H9N A;  2XYI A;  5IJ8 E;  2AQ5 A;  5HYN B;  3NVQ A;  2CE9 A;  5I5M A;  2CO0 A;  4J8B A;  5IC7 A;  4JSV C;  3JZH A;  3SCY A;  2QXV A;  4OWR A;  3K26 A;  1XHM A;  2HYE A;  3RRM C;  2IWK A;  2GNQ A;  4XYI A;  3UR4 A;  3SBQ A;  2AH1 A;  1SQ9 A;  4J81 A;  4ERZ A;  4FB1 D;  5C9Z B;  1GXR A;  5SXM A;  2GC7 A;  3ULE C;  4O3T B;  5GXI A;  3MKS B;  1K32 A;  5KDO B;  2IWF A;  4X61 B;  4U1E I;  5TEE A;  2XU7 A;  3RLM D;  4BL0 A;  3C9C A;  1JMX B;  3CIK B;  2BCJ B;  4X63 B;  3VA6 A;  2H47 A;  1L0Q A;  1MG3 A;  4GMB A;  5EMJ B;  5THA A;  3J81 g;  5I5J A;  1K8K C;  4PXW A;  1SQJ A;  5EM2 A;  2B4E A;  5GSA A;  4XYH A;  2P9L C;  4D0K A;  5I5I A;  4J0W A;  5CXB A;  3PE7 A;  1FWX A;  3JAM g;  4IA9 A;  3SBR A;  3SFZ A;  3I7L A;  3SBP A;  1U4C A;  2J56 H;  3SJL D;  5C2W B;  3EI3 B;  1Q47 A;  2PBI B;  3RN1 D;  3K27 A;  1PI6 A;  2W18 A;  1NR0 A;  3I8C A;  4ERY A;  2HKM A;  3ZWL B;  5H14 A;  3OL2 B;  3IJC A;  1S4U X;  2HJ4 A;  4ZOZ A;  4A0B A;  1N6F A;  4G56 B;  4ESG A;  4A08 B;  3RFH A;  2P9U C;  4PSW B;  3L4M D;  2OVP B;  4FAV D;  4IMM A;  2IUR A;  4U7A A;  1PGU A;  2H3X A;  3I7P A;  2IUQ A;  3OKY A;  5FKT A;  2AGZ A;  4XEI C;  3MZK A;  3EG6 A;  2I3S A;  5FKQ A;  4E5Z B;  1QNI A;  4Z8L A;  3PVW B;  4CZY A;  1ERJ A;  5EAP A;  2OJY A;  4LG8 A;  4ZOX A;  1TBG A;  3J80 g;  3EI4 A;  4CC9 A;  2P9K C;  3EI2 A;  2P9N C;  4PNK B;  4N14 A;  4JSP C;  1B9Y A;  3N0D A;  3UVM A;  3GRE A;  2G99 A;  3RSE C;  4ZN4 A;  5CXC A;  2CNX A;  1GOT B;  1JJU B;  2OVR B;  3JRP A;  2MTA H;  4I79 A;  3AL8 A;  3MMY A;  3DXK C;  4A0A B;  2CO0 C;  5TF2 A;  3UKU C;  2GC4 A;  2H9L A;  5HE0 B;  4A11 B;  2XL2 A;  4H5I A;  2P9I C;  1YFQ A;  1JOF A;  3PSC B;  2IAA A;  2UZY B;  5EML B;  3MXX A;  4CY5 A;  1XIP A;  3EWE A;  3ORV D;  3F3P A;  5K1C C;  4GGA A;  2CN3 A;  4E54 A;  4MK0 B;  4Y5R D;  2Z2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...