2YNOA

Yeast betaprime cop 1-304h6
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
310
Chain Sequence
MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLGNDEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords COATOMER SUBUNIT BETA'
publication title Molecular Basis for Recognition of Dilysine Trafficking Motifs by Copi.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 90
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ynoA01
3OW8A 5C2WB 4BUJC 2IUQA 5IGQA 4A0AB 4O3UB 3SBPA 3SXTD 2OVRB 1K8KC 2YB8B 3MZLA 5FKSA 5HQGA 3V5WB 1B9XA 4J77A 4GM9A 1JMXB 4ERYA 1PEVA 3MKSB 3SBRA 4E5ZB 2H47A 5EM2B 2HKMA 3JZGA 1NEXB 2PM7B 4QQEA 5SXMA 5H17A 4J86A 2H68A 3J80g 4QL1A 1RI6A 1GXRA 1GP2B 4TZ4A 3DSMA 3I7PA 5C2VB 3C75H 5IT9g 3E0CA 2OK4A 4L9OA 4CY3A 3EI1B 3C5MA 3VA6A 4PSWB 3BG0A 4X60B 4FA9D 3IJ1A 2OJYA 3I7KA 1QNIA 2I3SA 2J56H 4GQ2P 4JSPC 2HJBA 3IJCA 4CI2A 4GM3A 5FLXg 2G9AA 5IC7A 4E54B 4J73A 3SVWD 2B5NA 2CE9A 3N0DA 4L3HD 2H9LA 4FA4D 3EMHA 2I0SA 2IWFA 1XIPA 4GMBA 3F3FA 3SHFA 4FWWA 3UVOA 5AFU3 2HYEA 5GSAA 5EMMB 3AL9A 3VGZA 4CZXA 4XYHA 4BL0A 1GOTB 3I7OA 2CO0A 4A11A 3U4YA 1U2VC 4XEIC 1SHYB 4OZUA 4A0AA 2AGXA 3AL8A 1SQJA 4D0KA 2AH0A 3AFCA 3P4FA 4X61B 1FWXA 3EWEA 3UVLA 1TBGA 1MDAH 1Q47A 4E5ZA 4A0BB 2H13A 3A0FA 5EM2A 5H1MA 5CXCB 3RMZD 3NVXA 2P9PC 2MTAH 3NVNA 3EU7A 5FXYA 2QXVA 2IUPA 3OKTA 2Q7QA 4CY1A 4ZOYA 2CN3A 3CIKB 5HE0B 2CNXA 5HE1B 3KRWB 4X63B 3RFHA 4ZOZA 4ESGA 3EI1A 4LG9A 2AH1A 5FQDA 2CE8A 5K19A 3K26A 5B4WA 4FA5D 5EMKB 3ORVD 4AOWA 5A2Qg 1MG2A 3AL8B 2AGYA 2O9KA 5FKRA 3W15A 4CY5A 5EAMA 5TF2A 4A2LA 4E54A 2B4EA 3I89A 4HDJA 4J0WA 4O1QD 3FM0A 2HKRA 4Y5RD 2CO0C 4L3GD 4JSXC 3I7LA 5EMLB 5IGOA 2PM6B 4GQ1A 2P9KC 4J8GA 3UR4A 2I3TA 3DM0A 2G99A 2OIZA 1NR0A 1ERJA 3V7DB 2XL3A 2H3XA 4A7JA 2AQ5A 2BCJB 1OMWB 3HFQA 1PI6A 3MMYA 3OKWA 2P9UC 4LG8A 5I5IA 4EWRA 1PBYB 4A0BA 4A08A 3JRPA 3CFVA 5CXCA 4FB1D 4FA1D 3RSEC 3PSLA 2GC7A 2GC4A 2B5LA 5C9ZB 3C9CA 4O45A 4PXWA 4J87A 2P9NC 4ERQA 1R5MA 4J78A 2H6NA 3SBQA 5KDOB 3UKUC 5FKQA 3UVNA 4O9DA 4CZVA 1U4CA 2PBIB 3F3PA 3IIWA 3JZNA 3OTTA 4CY2A 4ZOVA 3PSCB 3SMRA 4JT5C 2H6KA 1JMZB 2PM9B 2BBKH 2AGZA 2XL2A 4K3JB 5THAA 4GGCA 3JAMg 4KFMB 2J55H 5CYKB 4PBYA 2IUVA 3EI2B 4G56B 4FAND 3EI3B 4N14A 5GXHA 3L4OD 4IA9A 4JSNC 4PC0A 2QC5A 1L0QA 5CXBB 4A08B 3BWSA 3DWLC 3I7NA 4CZYA 4Z8LA 4LGNA 2IAAA 3ULEC 2I0TA 1N6FA 5HE3B 3AH8B 5H14A 2HXCA 3I2NA 3UVKA 1VYHC 1N6EA 1OLZA 4U7AA 2HESX 4H5IA 5EMJB 4A2MA 2CN2A 3F3GA 3CFSB 5EALA 5AJAA 2Z2OA 5HYNB 3OKYA 3EI4B 3RN0D 1B9YA 3L4MD 5TEFA 1YFQA 3IKOA 2P9LC 2H14A 4JT6C 5JWZA 2AGLA 3MZKA 3NVQA 4OWRA 4O3TB 2YNNA 3PVWB 3SFZA 3VH0A 1JJUB 4PBZA 4ZOXA 4YVDA 2UZYB 5K1CC 1SQ9A 3JZHA 2P9SC 2XYIA 4CI3A 3RFGA 3J81g 3C99A 4ERZA 5TEEA 4A09B 2PM9A 4GQBB 4MK0B 3RRMC 4JSVC 4U1EI 2J57G 2B5MA 3N0EA 3OL2B 5EAPA 3SWSD 3B7FA 4JD2C 5CYKA 3FGBA 2P9IC 3EI2A 3EI3A 1PGUA 3OKYB 1P22A 3PXWD 4J8BA 3SLED 3GREA 4GZ8A 1S4UX 2H9NA 5CXBA 5HE2B 2TRCB 4QT8A 2EBSA 1GG2B 2YBAA 3JPXA 3RLMD 1N6DA 4J79A 3DXMC 3IIYA 2AGWA 2GNQA 4AEZA 4JXMA 3ZWLB 3EG6A 4ZN4A 4GM8A 2HJ4A 4J82A 4BH6A 3GFCA 3PE7A 4UI9R 3UVMA 5TDHB 2W18A 2XU7A 3DXKC 5FKTA 4PSXB 3V9FA 4PNKB 4Y7RA 2YNOA 4NSXA 2OK6A 3FRXA 3SJLD 3IJ0A 3EI4A 5FA5B 2I0RA 3SN6B 4XYIA 4FHLA 4FAVD 4QRJA 3SCYA 2YNPA 3PXSD 3MXXA 5IJ7E 4IMMA 2Z2NA 5GXIA 1JOFA 4H5JA 4J0XA 2H9MA 1K32A 2IWKA 3I8EA 2H6QA 2OVPB 3I8CA 4CI8A 2OVQB 2UZXB 3BG1A 3I7HA 4I79A 4J84A 4CC9A 4J81A 4K3ID 3ODTA 3JB9L 3KRXB 4L1QD 3RN1D 4A09A 3PXTD 4R7AB 3K27A 4GGAA 1TYQC 3UKRC 4CI1A 2YMUA 3OL2A 1XHMA 5IJ8E 5I5MA 5GMKn 4X3EA 3JROA 2IURA 4D6VA 1XKSA 1MG3A 4ES0A 3PVUB 2Z2PA 1A0RB 5AMSA 5I5JA 3MKQA 4GGDA 2H9PA 5EARA 4A11B
chains in the Genus database with same CATH superfamily
3OW8A 5C2WB 4BUJC 2IUQA 5IGQA 4A0AB 4O3UB 3SBPA 3SXTD 2OVRB 1K8KC 2YB8B 3GC3B 3MZLA 5FKSA 5HQGA 3V5WB 1O6FA 1B9XA 3DDUA 4GM9A 4J77A 1JMXB 4ERYA 1PEVA 3MKSB 3SBRA 4E5ZB 2H47A 5EM2B 4AMZA 2HKMA 3JZGA 1NEXB 1YR2A 1A12A 2PM7B 4QQEA 3K72A 3IUJA 5SXMA 5H17A 4J86A 2H68A 3J80g 4QL1A 1RI6A 1GXRA 1GP2B 4TZ4A 3DSMA 3I7PA 5C2VB 3C75H 1H2ZA 5IT9g 3E0CA 2OK4A 3NIGA 4L9OA 1M1XA 4CY3A 3EI1B 3C5MA 3VA6A 4PSWB 3BG0A 4X60B 4FA9D 3ZDXA 3IJ1A 2OJYA 3I7KA 1QNIA 2I3SA 2J56H 4GQ2P 4O02A 4JSPC 2HJBA 1H2XA 3IJCA 3ZDYA 2HU7A 4CI2A 4AMYA 4GM3A 5FLXg 2G9AA 5IC7A 4E54B 4J73A 3SVWD 3VI3A 2B5NA 2CE9A 3N0DA 2QR5A 4L3HD 2H9LA 4FA4D 5FFOA 3EMHA 2I0SA 2IWFA 2VDRA 1XIPA 4GMBA 3FCUA 5FFGA 3F3FA 3SHFA 4NAAA 4FWWA 3UVOA 5AFU3 5M5TA 2HYEA 5GSAA 2HU5A 5EMMB 3AL9A 3IURA 3VGZA 4CZXA 4XYHA 4BL0A 3IUNA 1GOTB 3I7OA 2CO0A 4A11A 3U4YA 1U2VC 2XE4A 4XEIC 5E6RA 1SHYB 4OZUA 5HDBA 2AGXA 4A0AA 3AL8A 1SQJA 2VZ1A 4D0KA 2AH0A 3AFCA 3P4FA 4Z7NA 4X61B 1FWXA 1QFSA 3EWEA 1TBGA 3UVLA 4WJKA 1MDAH 1Q47A 4E5ZA 4A0BB 2H13A 3A0FA 5EM2A 5H1MA 3NIDA 5CXCB 2JKXA 3RMZD 2P9PC 3NVXA 2MTAH 4WK0A 1BPOA 3NVNA 3EU7A 2VDOA 5FXYA 2QXVA 2IUPA 3OKTA 2Q7QA 1GOFA 4CY1A 4RE6A 4ZOYA 3EQ8A 4DNUA 2CN3A 3CIKB 5HE0B 3O4IA 2CNXA 3VI4A 5HE1B 1UOQA 3KRWB 4X63B 3RFHA 4ZOZA 4ESGA 3EI1A 2VC2A 2AH1A 4LG9A 5FQDA 2CE8A 5K19A 2XDWA 3K26A 5B4WA 3V4VA 4FA5D 5M5RA 5EMKB 3ORVD 5M5UA 3K71A 4AOWA 5A2Qg 1MG2A 4G55A 3AL8B 2AGYA 2O9KA 5FKRA 3W15A 4CY5A 4BCBA 5EAMA 5TF2A 4A2LA 4E54A 2B4EA 1VE7A 3I89A 4HDJA 5C86A 4J0WA 4O1QD 3FM0A 2HKRA 4AN1A 4Y5RD 2CO0C 4L3GD 4JSXC 3O4HA 1JTDB 3I7LA 5EMLB 5IGOA 4BCCA 2PM6B 4GQ1A 2P9KC 4J8GA 3UR4A 2I3TA 3O4GA 3DM0A 2G99A 2OIZA 1VZ3A 1NR0A 1ERJA 3V7DB 1L5GA 3T3PA 2XL3A 2H3XA 4A7JA 2AQ5A 2BCJB 3IJEA 1OMWB 3HFQA 1PI6A 3QI0A 4WK2A 3MMYA 3OKWA 2P9UC 3T3MA 4LG8A 5I5IA 3GD1I 4UM9A 4EWRA 3OF7A 1PBYB 4A0BA 4A08A 3JRPA 3CFVA 5CXCA 4FB1D 4FA1D 2EIBA 3RSEC 3PSLA 4NC4A 1C9LA 2GC7A 2GC4A 2B5LA 5C9ZB 3C9CA 4O45A 4PXWA 4J87A 2P9NC 4ERQA 1R5MA 1GOHA 1O6GA 4J78A 3K6SA 2H6NA 3SBQA 3V4PA 3UKUC 5KDOB 1E8NA 5FKQA 3UVNA 4BCDA 5M5SA 4O9DA 4CZVA 1U4CA 2PBIB 3F3PA 3IIWA 3IULA 3JZNA 3OTTA 4CY2A 4ZOVA 2HU8A 2VDKA 3PSCB 4JT5C 3SMRA 2H6KA 1JMZB 3MUNA 2PM9B 2BBKH 2AGZA 2XL2A 4K3JB 3ZDZA 5THAA 4GGCA 3JAMg 4KFMB 2J55H 5CYKB 4PBYA 4DNWA 2IUVA 3EI2B 4G56B 4FAND 3EQ7A 4BP8A 3EI3B 4N14A 5GXHA 3L4OD 4IA9A 4JSNC 3ZE0A 4PC0A 2QC5A 1L0QA 3EQ9A 2VZ3A 1QFMA 5CXBB 4A08B 5E6UA 4NENA 3BWSA 4NBMA 3DWLC 3I7NA 4CZYA 1H2YA 1JV2A 4Z8LA 3QHYB 4LGNA 2IAAA 3ULEC 2I0TA 1N6FA 5HE3B 3AH8B 5H14A 2HXCA 3I2NA 3UVKA 1VYHC 1N6EA 1OLZA 4U7AA 2HESX 4H5IA 5EMJB 4A2MA 2CN2A 3F3GA 3CFSB 5EALA 1T2XA 5AJAA 2Z2OA 5HYNB 3OKYA 3EI4B 3O4JA 3RN0D 1B9YA 3IVMA 5M5VA 3L4MD 5TEFA 4D9SA 1YFQA 1VZ2A 3IKOA 2P9LC 2H14A 4JT6C 2EICA 5JWZA 3MZKA 2AGLA 2WQ8A 3NVQA 4OWRA 2VDPA 4O3TB 4QAMA 3MVDK 1GOGA 2YNNA 1UTCA 1E5TA 3PVWB 3SFZA 3VH0A 1JJUB 4PBZA 4ZOXA 3MUOA 4YVDA 4AX4A 2UZYB 5K1CC 1SQ9A 3JZHA 2P9SC 2XYIA 4CI3A 3RFGA 3J81g 3C99A 4G1EA 4ERZA 1UOOA 5TEEA 4A09B 2PM9A 4GQBB 4MK0B 3RRMC 4JSVC 4U1EI 2J57G 2B5MA 3N0EA 3OL2B 5EAPA 3SWSD 3B7FA 4JD2C 5CYKA 3FGBA 2P9IC 3EI2A 3EI3A 1PGUA 3OKYB 1P22A 2XZGA 3PXWD 4J8BA 3SLED 3GREA 4GZ8A 1S4UX 2H9NA 5CXBA 5HE2B 2TRCB 4UM8A 1E8MA 2EIDA 1I2MB 4QT8A 4AN0A 2EBSA 1GG2B 2YBAA 3JPXA 3RLMD 1N6DA 4J79A 3DXMC 3IIYA 2BKLA 2AGWA 2GNQA 4AEZA 4JXMA 3ZWLB 5E6SA 3EG6A 4ZN4A 3ZE2A 4GM8A 2HJ4A 4J82A 4RE5A 4BH6A 3GFCA 3PE7A 4UI9R 3UVMA 5TDHB 2W18A 4MMZA 2XU7A 3DXKC 5FKTA 4PSXB 3V9FA 4PNKB 4IRZA 4Y7RA 2YNOA 4NSXA 2OK6A 3FRXA 3SJLD 3FCSA 2QZPA 3IJ0A 3EI4A 5FA5B 2I0RA 3SN6B 4XYIA 4FHLA 4FAVD 4QRJA 3SCYA 2YNPA 3IUQA 1TYEA 3ZE1A 1VE6A 4BP9A 2VDQA 3PXSD 2VDNA 3MXXA 4MMYA 4DNVA 4WK4A 1U8CA 4Z7OA 1H2WA 4JHPC 4IMMA 5IJ7E 2Z2NA 5GXIA 1JOFA 3KCIA 4H5JA 4J0XA 2H9MA 1K32A 2IWKA 3I8EA 1K3IA 2H6QA 2OVPB 4O2WA 2VDMA 3I8CA 4CI8A 2OVQB 2UZXB 3BG1A 3I7HA 4I79A 4J84A 4CC9A 4J81A 4K3ID 3ODTA 3JB9L 3KRXB 4L1QD 3RN1D 4A09A 3PXTD 4R7AB 3K27A 2EIEA 4GGAA 1TYQC 1UOPA 3UKRC 4CI1A 2YMUA 3OL2A 5C92A 4G1MA 1XHMA 4MMXA 4Z7QA 5IJ8E 5I5MA 5GMKn 4X3EA 3JROA 2IURA 4D6VA 1XKSA 1MG3A 4ES0A 3PVUB 2Z2PA 5M61A 2VDLA 1A0RB 5AMSA 5I5JA 3MKQA 1C9IA 2H9PA 4GGDA 3NIFA 4JHNA 5EARA 4A11B 4L1MA 3IUMA
chains in the Genus database with same CATH topology
3OW8A 5C2WB 4BUJC 2IUQA 5IGQA 4A0AB 4O3UB 3SBPA 3SXTD 2OVRB 1K8KC 2YB8B 3MZLA 5FKSA 5HQGA 3V5WB 1B9XA 4J77A 4GM9A 1JMXB 4ERYA 1PEVA 3MKSB 3SBRA 4E5ZB 2H47A 5EM2B 2HKMA 3JZGA 1NEXB 2PM7B 4QQEA 5SXMA 5H17A 4J86A 2H68A 3J80g 4QL1A 1RI6A 1GXRA 1GP2B 4TZ4A 3DSMA 3I7PA 5C2VB 3C75H 5IT9g 3E0CA 2OK4A 4L9OA 4CY3A 3EI1B 3C5MA 3VA6A 4PSWB 3BG0A 4X60B 4FA9D 3IJ1A 2OJYA 3I7KA 1QNIA 2I3SA 2J56H 4GQ2P 4JSPC 2HJBA 3IJCA 4CI2A 4GM3A 5FLXg 2G9AA 5IC7A 4E54B 4J73A 3SVWD 2B5NA 2CE9A 3N0DA 4L3HD 2H9LA 4FA4D 3EMHA 2I0SA 2IWFA 1XIPA 4GMBA 3F3FA 3SHFA 4FWWA 3UVOA 5AFU3 2HYEA 5GSAA 5EMMB 3AL9A 3VGZA 4CZXA 4XYHA 4BL0A 1GOTB 3I7OA 2CO0A 4A11A 3U4YA 1U2VC 4XEIC 1SHYB 4OZUA 4A0AA 2AGXA 3AL8A 1SQJA 4D0KA 2AH0A 3AFCA 3P4FA 4X61B 1FWXA 3EWEA 3UVLA 1TBGA 1MDAH 1Q47A 4E5ZA 4A0BB 2H13A 3A0FA 5EM2A 5H1MA 5CXCB 3RMZD 3NVXA 2P9PC 2MTAH 3NVNA 3EU7A 5FXYA 2QXVA 2IUPA 3OKTA 2Q7QA 4CY1A 4ZOYA 2CN3A 3CIKB 5HE0B 2CNXA 5HE1B 3KRWB 4X63B 3RFHA 4ZOZA 4ESGA 3EI1A 4LG9A 2AH1A 5FQDA 2CE8A 5K19A 3K26A 5B4WA 4FA5D 5EMKB 3ORVD 4AOWA 5A2Qg 1MG2A 3AL8B 2AGYA 2O9KA 5FKRA 3W15A 4CY5A 5EAMA 5TF2A 4A2LA 4E54A 2B4EA 3I89A 4HDJA 4J0WA 4O1QD 3FM0A 2HKRA 4Y5RD 2CO0C 4L3GD 4JSXC 3I7LA 5EMLB 5IGOA 2PM6B 4GQ1A 2P9KC 4J8GA 3UR4A 2I3TA 3DM0A 2G99A 2OIZA 1NR0A 1ERJA 3V7DB 2XL3A 2H3XA 4A7JA 2AQ5A 2BCJB 1OMWB 3HFQA 1PI6A 3MMYA 3OKWA 2P9UC 4LG8A 5I5IA 4EWRA 1PBYB 4A0BA 4A08A 3JRPA 3CFVA 5CXCA 4FB1D 4FA1D 3RSEC 3PSLA 2GC7A 2GC4A 2B5LA 5C9ZB 3C9CA 4O45A 4PXWA 4J87A 2P9NC 4ERQA 1R5MA 4J78A 2H6NA 3SBQA 5KDOB 3UKUC 5FKQA 3UVNA 4O9DA 4CZVA 1U4CA 2PBIB 3F3PA 3IIWA 3JZNA 3OTTA 4CY2A 4ZOVA 3PSCB 3SMRA 4JT5C 2H6KA 1JMZB 2PM9B 2BBKH 2AGZA 2XL2A 4K3JB 5THAA 4GGCA 3JAMg 4KFMB 2J55H 5CYKB 4PBYA 2IUVA 3EI2B 4G56B 4FAND 3EI3B 4N14A 5GXHA 3L4OD 4IA9A 4JSNC 4PC0A 2QC5A 1L0QA 5CXBB 4A08B 3BWSA 3DWLC 3I7NA 4CZYA 4Z8LA 4LGNA 2IAAA 3ULEC 2I0TA 1N6FA 5HE3B 3AH8B 5H14A 2HXCA 3I2NA 3UVKA 1VYHC 1N6EA 1OLZA 4U7AA 2HESX 4H5IA 5EMJB 4A2MA 2CN2A 3F3GA 3CFSB 5EALA 5AJAA 2Z2OA 5HYNB 3OKYA 3EI4B 3RN0D 1B9YA 3L4MD 5TEFA 1YFQA 3IKOA 2P9LC 2H14A 4JT6C 5JWZA 2AGLA 3MZKA 3NVQA 4OWRA 4O3TB 2YNNA 3PVWB 3SFZA 3VH0A 1JJUB 4PBZA 4ZOXA 4YVDA 2UZYB 5K1CC 1SQ9A 3JZHA 2P9SC 2XYIA 4CI3A 3RFGA 3J81g 3C99A 4ERZA 5TEEA 4A09B 2PM9A 4GQBB 4MK0B 3RRMC 4JSVC 4U1EI 2J57G 2B5MA 3N0EA 3OL2B 5EAPA 3SWSD 3B7FA 4JD2C 5CYKA 3FGBA 2P9IC 3EI2A 3EI3A 1PGUA 3OKYB 1P22A 3PXWD 4J8BA 3SLED 3GREA 4GZ8A 1S4UX 2H9NA 5CXBA 5HE2B 2TRCB 4QT8A 2EBSA 1GG2B 2YBAA 3JPXA 3RLMD 1N6DA 4J79A 3DXMC 3IIYA 2AGWA 2GNQA 4AEZA 4JXMA 3ZWLB 3EG6A 4ZN4A 4GM8A 2HJ4A 4J82A 4BH6A 3GFCA 3PE7A 4UI9R 3UVMA 5TDHB 2W18A 2XU7A 3DXKC 5FKTA 4PSXB 3V9FA 4PNKB 4Y7RA 2YNOA 4NSXA 2OK6A 3FRXA 3SJLD 3IJ0A 3EI4A 5FA5B 2I0RA 3SN6B 4XYIA 4FHLA 4FAVD 4QRJA 3SCYA 2YNPA 3PXSD 3MXXA 5IJ7E 4IMMA 2Z2NA 5GXIA 1JOFA 4H5JA 4J0XA 2H9MA 1K32A 2IWKA 3I8EA 2H6QA 2OVPB 3I8CA 4CI8A 2OVQB 2UZXB 3BG1A 3I7HA 4I79A 4J84A 4CC9A 4J81A 4K3ID 3ODTA 3JB9L 3KRXB 4L1QD 3RN1D 4A09A 3PXTD 4R7AB 3K27A 4GGAA 1TYQC 3UKRC 4CI1A 2YMUA 3OL2A 1XHMA 5IJ8E 5I5MA 5GMKn 4X3EA 3JROA 2IURA 4D6VA 1XKSA 1MG3A 4ES0A 3PVUB 2Z2PA 1A0RB 5AMSA 5I5JA 3MKQA 4GGDA 2H9PA 5EARA 4A11B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW8 A;  5C2W B;  4BUJ C;  2IUQ A;  5IGQ A;  4A0A B;  4O3U B;  3SBP A;  3SXT D;  2OVR B;  1K8K C;  2YB8 B;  3MZL A;  5FKS A;  5HQG A;  3V5W B;  1B9X A;  4J77 A;  4GM9 A;  1JMX B;  4ERY A;  1PEV A;  3MKS B;  3SBR A;  4E5Z B;  2H47 A;  5EM2 B;  2HKM A;  3JZG A;  1NEX B;  2PM7 B;  4QQE A;  5SXM A;  5H17 A;  4J86 A;  2H68 A;  3J80 g;  4QL1 A;  1RI6 A;  1GXR A;  1GP2 B;  4TZ4 A;  3DSM A;  3I7P A;  5C2V B;  3C75 H;  5IT9 g;  3E0C A;  2OK4 A;  4L9O A;  4CY3 A;  3EI1 B;  3C5M A;  3VA6 A;  4PSW B;  3BG0 A;  4X60 B;  4FA9 D;  3IJ1 A;  2OJY A;  3I7K A;  1QNI A;  2I3S A;  2J56 H;  4GQ2 P;  4JSP C;  2HJB A;  3IJC A;  4CI2 A;  4GM3 A;  5FLX g;  2G9A A;  5IC7 A;  4E54 B;  4J73 A;  3SVW D;  2B5N A;  2CE9 A;  3N0D A;  4L3H D;  2H9L A;  4FA4 D;  3EMH A;  2I0S A;  2IWF A;  1XIP A;  4GMB A;  3F3F A;  3SHF A;  4FWW A;  3UVO A;  5AFU 3;  2HYE A;  5GSA A;  5EMM B;  3AL9 A;  3VGZ A;  4CZX A;  4XYH A;  4BL0 A;  1GOT B;  3I7O A;  2CO0 A;  4A11 A;  3U4Y A;  1U2V C;  4XEI C;  1SHY B;  4OZU A;  4A0A A;  2AGX A;  3AL8 A;  1SQJ A;  4D0K A;  2AH0 A;  3AFC A;  3P4F A;  4X61 B;  1FWX A;  3EWE A;  3UVL A;  1TBG A;  1MDA H;  1Q47 A;  4E5Z A;  4A0B B;  2H13 A;  3A0F A;  5EM2 A;  5H1M A;  5CXC B;  3RMZ D;  3NVX A;  2P9P C;  2MTA H;  3NVN A;  3EU7 A;  5FXY A;  2QXV A;  2IUP A;  3OKT A;  2Q7Q A;  4CY1 A;  4ZOY A;  2CN3 A;  3CIK B;  5HE0 B;  2CNX A;  5HE1 B;  3KRW B;  4X63 B;  3RFH A;  4ZOZ A;  4ESG A;  3EI1 A;  4LG9 A;  2AH1 A;  5FQD A;  2CE8 A;  5K19 A;  3K26 A;  5B4W A;  4FA5 D;  5EMK B;  3ORV D;  4AOW A;  5A2Q g;  1MG2 A;  3AL8 B;  2AGY A;  2O9K A;  5FKR A;  3W15 A;  4CY5 A;  5EAM A;  5TF2 A;  4A2L A;  4E54 A;  2B4E A;  3I89 A;  4HDJ A;  4J0W A;  4O1Q D;  3FM0 A;  2HKR A;  4Y5R D;  2CO0 C;  4L3G D;  4JSX C;  3I7L A;  5EML B;  5IGO A;  2PM6 B;  4GQ1 A;  2P9K C;  4J8G A;  3UR4 A;  2I3T A;  3DM0 A;  2G99 A;  2OIZ A;  1NR0 A;  1ERJ A;  3V7D B;  2XL3 A;  2H3X A;  4A7J A;  2AQ5 A;  2BCJ B;  1OMW B;  3HFQ A;  1PI6 A;  3MMY A;  3OKW A;  2P9U C;  4LG8 A;  5I5I A;  4EWR A;  1PBY B;  4A0B A;  4A08 A;  3JRP A;  3CFV A;  5CXC A;  4FB1 D;  4FA1 D;  3RSE C;  3PSL A;  2GC7 A;  2GC4 A;  2B5L A;  5C9Z B;  3C9C A;  4O45 A;  4PXW A;  4J87 A;  2P9N C;  4ERQ A;  1R5M A;  4J78 A;  2H6N A;  3SBQ A;  5KDO B;  3UKU C;  5FKQ A;  3UVN A;  4O9D A;  4CZV A;  1U4C A;  2PBI B;  3F3P A;  3IIW A;  3JZN A;  3OTT A;  4CY2 A;  4ZOV A;  3PSC B;  3SMR A;  4JT5 C;  2H6K A;  1JMZ B;  2PM9 B;  2BBK H;  2AGZ A;  2XL2 A;  4K3J B;  5THA A;  4GGC A;  3JAM g;  4KFM B;  2J55 H;  5CYK B;  4PBY A;  2IUV A;  3EI2 B;  4G56 B;  4FAN D;  3EI3 B;  4N14 A;  5GXH A;  3L4O D;  4IA9 A;  4JSN C;  4PC0 A;  2QC5 A;  1L0Q A;  5CXB B;  4A08 B;  3BWS A;  3DWL C;  3I7N A;  4CZY A;  4Z8L A;  4LGN A;  2IAA A;  3ULE C;  2I0T A;  1N6F A;  5HE3 B;  3AH8 B;  5H14 A;  2HXC A;  3I2N A;  3UVK A;  1VYH C;  1N6E A;  1OLZ A;  4U7A A;  2HES X;  4H5I A;  5EMJ B;  4A2M A;  2CN2 A;  3F3G A;  3CFS B;  5EAL A;  5AJA A;  2Z2O A;  5HYN B;  3OKY A;  3EI4 B;  3RN0 D;  1B9Y A;  3L4M D;  5TEF A;  1YFQ A;  3IKO A;  2P9L C;  2H14 A;  4JT6 C;  5JWZ A;  2AGL A;  3MZK A;  3NVQ A;  4OWR A;  4O3T B;  2YNN A;  3PVW B;  3SFZ A;  3VH0 A;  1JJU B;  4PBZ A;  4ZOX A;  4YVD A;  2UZY B;  5K1C C;  1SQ9 A;  3JZH A;  2P9S C;  2XYI A;  4CI3 A;  3RFG A;  3J81 g;  3C99 A;  4ERZ A;  5TEE A;  4A09 B;  2PM9 A;  4GQB B;  4MK0 B;  3RRM C;  4JSV C;  4U1E I;  2J57 G;  2B5M A;  3N0E A;  3OL2 B;  5EAP A;  3SWS D;  3B7F A;  4JD2 C;  5CYK A;  3FGB A;  2P9I C;  3EI2 A;  3EI3 A;  1PGU A;  3OKY B;  1P22 A;  3PXW D;  4J8B A;  3SLE D;  3GRE A;  4GZ8 A;  1S4U X;  2H9N A;  5CXB A;  5HE2 B;  2TRC B;  4QT8 A;  2EBS A;  1GG2 B;  2YBA A;  3JPX A;  3RLM D;  1N6D A;  4J79 A;  3DXM C;  3IIY A;  2AGW A;  2GNQ A;  4AEZ A;  4JXM A;  3ZWL B;  3EG6 A;  4ZN4 A;  4GM8 A;  2HJ4 A;  4J82 A;  4BH6 A;  3GFC A;  3PE7 A;  4UI9 R;  3UVM A;  5TDH B;  2W18 A;  2XU7 A;  3DXK C;  5FKT A;  4PSX B;  3V9F A;  4PNK B;  4Y7R A;  2YNO A;  4NSX A;  2OK6 A;  3FRX A;  3SJL D;  3IJ0 A;  3EI4 A;  5FA5 B;  2I0R A;  3SN6 B;  4XYI A;  4FHL A;  4FAV D;  4QRJ A;  3SCY A;  2YNP A;  3PXS D;  3MXX A;  5IJ7 E;  4IMM A;  2Z2N A;  5GXI A;  1JOF A;  4H5J A;  4J0X A;  2H9M A;  1K32 A;  2IWK A;  3I8E A;  2H6Q A;  2OVP B;  3I8C A;  4CI8 A;  2OVQ B;  2UZX B;  3BG1 A;  3I7H A;  4I79 A;  4J84 A;  4CC9 A;  4J81 A;  4K3I D;  3ODT A;  3JB9 L;  3KRX B;  4L1Q D;  3RN1 D;  4A09 A;  3PXT D;  4R7A B;  3K27 A;  4GGA A;  1TYQ C;  3UKR C;  4CI1 A;  2YMU A;  3OL2 A;  1XHM A;  5IJ8 E;  5I5M A;  5GMK n;  4X3E A;  3JRO A;  2IUR A;  4D6V A;  1XKS A;  1MG3 A;  4ES0 A;  3PVU B;  2Z2P A;  1A0R B;  5AMS A;  5I5J A;  3MKQ A;  4GGD A;  2H9P A;  5EAR A;  4A11 B; 
#chains in the Genus database with same CATH topology
 3OW8 A;  5C2W B;  4BUJ C;  2IUQ A;  5IGQ A;  4A0A B;  4O3U B;  3SBP A;  3SXT D;  2OVR B;  1K8K C;  2YB8 B;  3GC3 B;  3MZL A;  5FKS A;  5HQG A;  3V5W B;  1O6F A;  1B9X A;  3DDU A;  4GM9 A;  4J77 A;  1JMX B;  4ERY A;  1PEV A;  3MKS B;  3SBR A;  4E5Z B;  2H47 A;  5EM2 B;  4AMZ A;  2HKM A;  3JZG A;  1NEX B;  1YR2 A;  1A12 A;  2PM7 B;  4QQE A;  3K72 A;  3IUJ A;  5SXM A;  5H17 A;  4J86 A;  2H68 A;  3J80 g;  4QL1 A;  1RI6 A;  1GXR A;  1GP2 B;  4TZ4 A;  3DSM A;  3I7P A;  5C2V B;  3C75 H;  1H2Z A;  5IT9 g;  3E0C A;  2OK4 A;  3NIG A;  4L9O A;  1M1X A;  4CY3 A;  3EI1 B;  3C5M A;  3VA6 A;  4PSW B;  3BG0 A;  4X60 B;  4FA9 D;  3ZDX A;  3IJ1 A;  2OJY A;  3I7K A;  1QNI A;  2I3S A;  2J56 H;  4GQ2 P;  4O02 A;  4JSP C;  2HJB A;  1H2X A;  3IJC A;  3ZDY A;  2HU7 A;  4CI2 A;  4AMY A;  4GM3 A;  5FLX g;  2G9A A;  5IC7 A;  4E54 B;  4J73 A;  3SVW D;  3VI3 A;  2B5N A;  2CE9 A;  3N0D A;  2QR5 A;  4L3H D;  2H9L A;  4FA4 D;  5FFO A;  3EMH A;  2I0S A;  2IWF A;  2VDR A;  1XIP A;  4GMB A;  3FCU A;  5FFG A;  3F3F A;  3SHF A;  4NAA A;  4FWW A;  3UVO A;  5AFU 3;  5M5T A;  2HYE A;  5GSA A;  2HU5 A;  5EMM B;  3AL9 A;  3IUR A;  3VGZ A;  4CZX A;  4XYH A;  4BL0 A;  3IUN A;  1GOT B;  3I7O A;  2CO0 A;  4A11 A;  3U4Y A;  1U2V C;  2XE4 A;  4XEI C;  5E6R A;  1SHY B;  4OZU A;  5HDB A;  2AGX A;  4A0A A;  3AL8 A;  1SQJ A;  2VZ1 A;  4D0K A;  2AH0 A;  3AFC A;  3P4F A;  4Z7N A;  4X61 B;  1FWX A;  1QFS A;  3EWE A;  1TBG A;  3UVL A;  4WJK A;  1MDA H;  1Q47 A;  4E5Z A;  4A0B B;  2H13 A;  3A0F A;  5EM2 A;  5H1M A;  3NID A;  5CXC B;  2JKX A;  3RMZ D;  2P9P C;  3NVX A;  2MTA H;  4WK0 A;  1BPO A;  3NVN A;  3EU7 A;  2VDO A;  5FXY A;  2QXV A;  2IUP A;  3OKT A;  2Q7Q A;  1GOF A;  4CY1 A;  4RE6 A;  4ZOY A;  3EQ8 A;  4DNU A;  2CN3 A;  3CIK B;  5HE0 B;  3O4I A;  2CNX A;  3VI4 A;  5HE1 B;  1UOQ A;  3KRW B;  4X63 B;  3RFH A;  4ZOZ A;  4ESG A;  3EI1 A;  2VC2 A;  2AH1 A;  4LG9 A;  5FQD A;  2CE8 A;  5K19 A;  2XDW A;  3K26 A;  5B4W A;  3V4V A;  4FA5 D;  5M5R A;  5EMK B;  3ORV D;  5M5U A;  3K71 A;  4AOW A;  5A2Q g;  1MG2 A;  4G55 A;  3AL8 B;  2AGY A;  2O9K A;  5FKR A;  3W15 A;  4CY5 A;  4BCB A;  5EAM A;  5TF2 A;  4A2L A;  4E54 A;  2B4E A;  1VE7 A;  3I89 A;  4HDJ A;  5C86 A;  4J0W A;  4O1Q D;  3FM0 A;  2HKR A;  4AN1 A;  4Y5R D;  2CO0 C;  4L3G D;  4JSX C;  3O4H A;  1JTD B;  3I7L A;  5EML B;  5IGO A;  4BCC A;  2PM6 B;  4GQ1 A;  2P9K C;  4J8G A;  3UR4 A;  2I3T A;  3O4G A;  3DM0 A;  2G99 A;  2OIZ A;  1VZ3 A;  1NR0 A;  1ERJ A;  3V7D B;  1L5G A;  3T3P A;  2XL3 A;  2H3X A;  4A7J A;  2AQ5 A;  2BCJ B;  3IJE A;  1OMW B;  3HFQ A;  1PI6 A;  3QI0 A;  4WK2 A;  3MMY A;  3OKW A;  2P9U C;  3T3M A;  4LG8 A;  5I5I A;  3GD1 I;  4UM9 A;  4EWR A;  3OF7 A;  1PBY B;  4A0B A;  4A08 A;  3JRP A;  3CFV A;  5CXC A;  4FB1 D;  4FA1 D;  2EIB A;  3RSE C;  3PSL A;  4NC4 A;  1C9L A;  2GC7 A;  2GC4 A;  2B5L A;  5C9Z B;  3C9C A;  4O45 A;  4PXW A;  4J87 A;  2P9N C;  4ERQ A;  1R5M A;  1GOH A;  1O6G A;  4J78 A;  3K6S A;  2H6N A;  3SBQ A;  3V4P A;  3UKU C;  5KDO B;  1E8N A;  5FKQ A;  3UVN A;  4BCD A;  5M5S A;  4O9D A;  4CZV A;  1U4C A;  2PBI B;  3F3P A;  3IIW A;  3IUL A;  3JZN A;  3OTT A;  4CY2 A;  4ZOV A;  2HU8 A;  2VDK A;  3PSC B;  4JT5 C;  3SMR A;  2H6K A;  1JMZ B;  3MUN A;  2PM9 B;  2BBK H;  2AGZ A;  2XL2 A;  4K3J B;  3ZDZ A;  5THA A;  4GGC A;  3JAM g;  4KFM B;  2J55 H;  5CYK B;  4PBY A;  4DNW A;  2IUV A;  3EI2 B;  4G56 B;  4FAN D;  3EQ7 A;  4BP8 A;  3EI3 B;  4N14 A;  5GXH A;  3L4O D;  4IA9 A;  4JSN C;  3ZE0 A;  4PC0 A;  2QC5 A;  1L0Q A;  3EQ9 A;  2VZ3 A;  1QFM A;  5CXB B;  4A08 B;  5E6U A;  4NEN A;  3BWS A;  4NBM A;  3DWL C;  3I7N A;  4CZY A;  1H2Y A;  1JV2 A;  4Z8L A;  3QHY B;  4LGN A;  2IAA A;  3ULE C;  2I0T A;  1N6F A;  5HE3 B;  3AH8 B;  5H14 A;  2HXC A;  3I2N A;  3UVK A;  1VYH C;  1N6E A;  1OLZ A;  4U7A A;  2HES X;  4H5I A;  5EMJ B;  4A2M A;  2CN2 A;  3F3G A;  3CFS B;  5EAL A;  1T2X A;  5AJA A;  2Z2O A;  5HYN B;  3OKY A;  3EI4 B;  3O4J A;  3RN0 D;  1B9Y A;  3IVM A;  5M5V A;  3L4M D;  5TEF A;  4D9S A;  1YFQ A;  1VZ2 A;  3IKO A;  2P9L C;  2H14 A;  4JT6 C;  2EIC A;  5JWZ A;  3MZK A;  2AGL A;  2WQ8 A;  3NVQ A;  4OWR A;  2VDP A;  4O3T B;  4QAM A;  3MVD K;  1GOG A;  2YNN A;  1UTC A;  1E5T A;  3PVW B;  3SFZ A;  3VH0 A;  1JJU B;  4PBZ A;  4ZOX A;  3MUO A;  4YVD A;  4AX4 A;  2UZY B;  5K1C C;  1SQ9 A;  3JZH A;  2P9S C;  2XYI A;  4CI3 A;  3RFG A;  3J81 g;  3C99 A;  4G1E A;  4ERZ A;  1UOO A;  5TEE A;  4A09 B;  2PM9 A;  4GQB B;  4MK0 B;  3RRM C;  4JSV C;  4U1E I;  2J57 G;  2B5M A;  3N0E A;  3OL2 B;  5EAP A;  3SWS D;  3B7F A;  4JD2 C;  5CYK A;  3FGB A;  2P9I C;  3EI2 A;  3EI3 A;  1PGU A;  3OKY B;  1P22 A;  2XZG A;  3PXW D;  4J8B A;  3SLE D;  3GRE A;  4GZ8 A;  1S4U X;  2H9N A;  5CXB A;  5HE2 B;  2TRC B;  4UM8 A;  1E8M A;  2EID A;  1I2M B;  4QT8 A;  4AN0 A;  2EBS A;  1GG2 B;  2YBA A;  3JPX A;  3RLM D;  1N6D A;  4J79 A;  3DXM C;  3IIY A;  2BKL A;  2AGW A;  2GNQ A;  4AEZ A;  4JXM A;  3ZWL B;  5E6S A;  3EG6 A;  4ZN4 A;  3ZE2 A;  4GM8 A;  2HJ4 A;  4J82 A;  4RE5 A;  4BH6 A;  3GFC A;  3PE7 A;  4UI9 R;  3UVM A;  5TDH B;  2W18 A;  4MMZ A;  2XU7 A;  3DXK C;  5FKT A;  4PSX B;  3V9F A;  4PNK B;  4IRZ A;  4Y7R A;  2YNO A;  4NSX A;  2OK6 A;  3FRX A;  3SJL D;  3FCS A;  2QZP A;  3IJ0 A;  3EI4 A;  5FA5 B;  2I0R A;  3SN6 B;  4XYI A;  4FHL A;  4FAV D;  4QRJ A;  3SCY A;  2YNP A;  3IUQ A;  1TYE A;  3ZE1 A;  1VE6 A;  4BP9 A;  2VDQ A;  3PXS D;  2VDN A;  3MXX A;  4MMY A;  4DNV A;  4WK4 A;  1U8C A;  4Z7O A;  1H2W A;  4JHP C;  4IMM A;  5IJ7 E;  2Z2N A;  5GXI A;  1JOF A;  3KCI A;  4H5J A;  4J0X A;  2H9M A;  1K32 A;  2IWK A;  3I8E A;  1K3I A;  2H6Q A;  2OVP B;  4O2W A;  2VDM A;  3I8C A;  4CI8 A;  2OVQ B;  2UZX B;  3BG1 A;  3I7H A;  4I79 A;  4J84 A;  4CC9 A;  4J81 A;  4K3I D;  3ODT A;  3JB9 L;  3KRX B;  4L1Q D;  3RN1 D;  4A09 A;  3PXT D;  4R7A B;  3K27 A;  2EIE A;  4GGA A;  1TYQ C;  1UOP A;  3UKR C;  4CI1 A;  2YMU A;  3OL2 A;  5C92 A;  4G1M A;  1XHM A;  4MMX A;  4Z7Q A;  5IJ8 E;  5I5M A;  5GMK n;  4X3E A;  3JRO A;  2IUR A;  4D6V A;  1XKS A;  1MG3 A;  4ES0 A;  3PVU B;  2Z2P A;  5M61 A;  2VDL A;  1A0R B;  5AMS A;  5I5J A;  3MKQ A;  1C9I A;  2H9P A;  4GGD A;  3NIF A;  4JHN A;  5EAR A;  4A11 B;  4L1M A;  3IUM A; 
#chains in the Genus database with same CATH homology
 3OW8 A;  5C2W B;  4BUJ C;  2IUQ A;  5IGQ A;  4A0A B;  4O3U B;  3SBP A;  3SXT D;  2OVR B;  1K8K C;  2YB8 B;  3MZL A;  5FKS A;  5HQG A;  3V5W B;  1B9X A;  4J77 A;  4GM9 A;  1JMX B;  4ERY A;  1PEV A;  3MKS B;  3SBR A;  4E5Z B;  2H47 A;  5EM2 B;  2HKM A;  3JZG A;  1NEX B;  2PM7 B;  4QQE A;  5SXM A;  5H17 A;  4J86 A;  2H68 A;  3J80 g;  4QL1 A;  1RI6 A;  1GXR A;  1GP2 B;  4TZ4 A;  3DSM A;  3I7P A;  5C2V B;  3C75 H;  5IT9 g;  3E0C A;  2OK4 A;  4L9O A;  4CY3 A;  3EI1 B;  3C5M A;  3VA6 A;  4PSW B;  3BG0 A;  4X60 B;  4FA9 D;  3IJ1 A;  2OJY A;  3I7K A;  1QNI A;  2I3S A;  2J56 H;  4GQ2 P;  4JSP C;  2HJB A;  3IJC A;  4CI2 A;  4GM3 A;  5FLX g;  2G9A A;  5IC7 A;  4E54 B;  4J73 A;  3SVW D;  2B5N A;  2CE9 A;  3N0D A;  4L3H D;  2H9L A;  4FA4 D;  3EMH A;  2I0S A;  2IWF A;  1XIP A;  4GMB A;  3F3F A;  3SHF A;  4FWW A;  3UVO A;  5AFU 3;  2HYE A;  5GSA A;  5EMM B;  3AL9 A;  3VGZ A;  4CZX A;  4XYH A;  4BL0 A;  1GOT B;  3I7O A;  2CO0 A;  4A11 A;  3U4Y A;  1U2V C;  4XEI C;  1SHY B;  4OZU A;  4A0A A;  2AGX A;  3AL8 A;  1SQJ A;  4D0K A;  2AH0 A;  3AFC A;  3P4F A;  4X61 B;  1FWX A;  3EWE A;  3UVL A;  1TBG A;  1MDA H;  1Q47 A;  4E5Z A;  4A0B B;  2H13 A;  3A0F A;  5EM2 A;  5H1M A;  5CXC B;  3RMZ D;  3NVX A;  2P9P C;  2MTA H;  3NVN A;  3EU7 A;  5FXY A;  2QXV A;  2IUP A;  3OKT A;  2Q7Q A;  4CY1 A;  4ZOY A;  2CN3 A;  3CIK B;  5HE0 B;  2CNX A;  5HE1 B;  3KRW B;  4X63 B;  3RFH A;  4ZOZ A;  4ESG A;  3EI1 A;  4LG9 A;  2AH1 A;  5FQD A;  2CE8 A;  5K19 A;  3K26 A;  5B4W A;  4FA5 D;  5EMK B;  3ORV D;  4AOW A;  5A2Q g;  1MG2 A;  3AL8 B;  2AGY A;  2O9K A;  5FKR A;  3W15 A;  4CY5 A;  5EAM A;  5TF2 A;  4A2L A;  4E54 A;  2B4E A;  3I89 A;  4HDJ A;  4J0W A;  4O1Q D;  3FM0 A;  2HKR A;  4Y5R D;  2CO0 C;  4L3G D;  4JSX C;  3I7L A;  5EML B;  5IGO A;  2PM6 B;  4GQ1 A;  2P9K C;  4J8G A;  3UR4 A;  2I3T A;  3DM0 A;  2G99 A;  2OIZ A;  1NR0 A;  1ERJ A;  3V7D B;  2XL3 A;  2H3X A;  4A7J A;  2AQ5 A;  2BCJ B;  1OMW B;  3HFQ A;  1PI6 A;  3MMY A;  3OKW A;  2P9U C;  4LG8 A;  5I5I A;  4EWR A;  1PBY B;  4A0B A;  4A08 A;  3JRP A;  3CFV A;  5CXC A;  4FB1 D;  4FA1 D;  3RSE C;  3PSL A;  2GC7 A;  2GC4 A;  2B5L A;  5C9Z B;  3C9C A;  4O45 A;  4PXW A;  4J87 A;  2P9N C;  4ERQ A;  1R5M A;  4J78 A;  2H6N A;  3SBQ A;  5KDO B;  3UKU C;  5FKQ A;  3UVN A;  4O9D A;  4CZV A;  1U4C A;  2PBI B;  3F3P A;  3IIW A;  3JZN A;  3OTT A;  4CY2 A;  4ZOV A;  3PSC B;  3SMR A;  4JT5 C;  2H6K A;  1JMZ B;  2PM9 B;  2BBK H;  2AGZ A;  2XL2 A;  4K3J B;  5THA A;  4GGC A;  3JAM g;  4KFM B;  2J55 H;  5CYK B;  4PBY A;  2IUV A;  3EI2 B;  4G56 B;  4FAN D;  3EI3 B;  4N14 A;  5GXH A;  3L4O D;  4IA9 A;  4JSN C;  4PC0 A;  2QC5 A;  1L0Q A;  5CXB B;  4A08 B;  3BWS A;  3DWL C;  3I7N A;  4CZY A;  4Z8L A;  4LGN A;  2IAA A;  3ULE C;  2I0T A;  1N6F A;  5HE3 B;  3AH8 B;  5H14 A;  2HXC A;  3I2N A;  3UVK A;  1VYH C;  1N6E A;  1OLZ A;  4U7A A;  2HES X;  4H5I A;  5EMJ B;  4A2M A;  2CN2 A;  3F3G A;  3CFS B;  5EAL A;  5AJA A;  2Z2O A;  5HYN B;  3OKY A;  3EI4 B;  3RN0 D;  1B9Y A;  3L4M D;  5TEF A;  1YFQ A;  3IKO A;  2P9L C;  2H14 A;  4JT6 C;  5JWZ A;  2AGL A;  3MZK A;  3NVQ A;  4OWR A;  4O3T B;  2YNN A;  3PVW B;  3SFZ A;  3VH0 A;  1JJU B;  4PBZ A;  4ZOX A;  4YVD A;  2UZY B;  5K1C C;  1SQ9 A;  3JZH A;  2P9S C;  2XYI A;  4CI3 A;  3RFG A;  3J81 g;  3C99 A;  4ERZ A;  5TEE A;  4A09 B;  2PM9 A;  4GQB B;  4MK0 B;  3RRM C;  4JSV C;  4U1E I;  2J57 G;  2B5M A;  3N0E A;  3OL2 B;  5EAP A;  3SWS D;  3B7F A;  4JD2 C;  5CYK A;  3FGB A;  2P9I C;  3EI2 A;  3EI3 A;  1PGU A;  3OKY B;  1P22 A;  3PXW D;  4J8B A;  3SLE D;  3GRE A;  4GZ8 A;  1S4U X;  2H9N A;  5CXB A;  5HE2 B;  2TRC B;  4QT8 A;  2EBS A;  1GG2 B;  2YBA A;  3JPX A;  3RLM D;  1N6D A;  4J79 A;  3DXM C;  3IIY A;  2AGW A;  2GNQ A;  4AEZ A;  4JXM A;  3ZWL B;  3EG6 A;  4ZN4 A;  4GM8 A;  2HJ4 A;  4J82 A;  4BH6 A;  3GFC A;  3PE7 A;  4UI9 R;  3UVM A;  5TDH B;  2W18 A;  2XU7 A;  3DXK C;  5FKT A;  4PSX B;  3V9F A;  4PNK B;  4Y7R A;  2YNO A;  4NSX A;  2OK6 A;  3FRX A;  3SJL D;  3IJ0 A;  3EI4 A;  5FA5 B;  2I0R A;  3SN6 B;  4XYI A;  4FHL A;  4FAV D;  4QRJ A;  3SCY A;  2YNP A;  3PXS D;  3MXX A;  5IJ7 E;  4IMM A;  2Z2N A;  5GXI A;  1JOF A;  4H5J A;  4J0X A;  2H9M A;  1K32 A;  2IWK A;  3I8E A;  2H6Q A;  2OVP B;  3I8C A;  4CI8 A;  2OVQ B;  2UZX B;  3BG1 A;  3I7H A;  4I79 A;  4J84 A;  4CC9 A;  4J81 A;  4K3I D;  3ODT A;  3JB9 L;  3KRX B;  4L1Q D;  3RN1 D;  4A09 A;  3PXT D;  4R7A B;  3K27 A;  4GGA A;  1TYQ C;  3UKR C;  4CI1 A;  2YMU A;  3OL2 A;  1XHM A;  5IJ8 E;  5I5M A;  5GMK n;  4X3E A;  3JRO A;  2IUR A;  4D6V A;  1XKS A;  1MG3 A;  4ES0 A;  3PVU B;  2Z2P A;  1A0R B;  5AMS A;  5I5J A;  3MKQ A;  4GGD A;  2H9P A;  5EAR A;  4A11 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...