5IGOA

Wd40 domain of arabidopsis thaliana e3 ubiquitin ligase cop1 in complex with peptide from trib1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
321
structure length
321
Chain Sequence
b'SRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase COP1
publication title Structural Basis for Substrate Selectivity of the E3 Ligase COP1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase/peptide
total genus 82
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5igoA00
4HDJA 3RSEC 4A08A 3C5MA 1JMZB 3AH8B 2YBAA 4XYHA 3FGBA 3MKSB 3C9CA 4J77A 3SBPA 5A2Qg 2OK6A 3RMZD 2AGWA 3I89A 3RRMC 3SJLD 3IIYA 3AL9A 2CN3A 2Q7QA 1NEXB 5K1CC 4JSPC 5IGQA 4N14A 4FWWA 3PSCB 5CXCA 2P9LC 4MK0B 2J57G 5AJAA 4J78A 3JROA 2I3SA 1PBYB 4QL1A 3FM0A 4KFMB 3I7OA 3V9FA 3GFCA 4PNKB 4O3TB 4OZUA 2H6NA 3IKOA 1R5MA 2BCJB 2QC5A 5HE1B 3MMYA 4GZ8A 4NSXA 3F3PA 3SBRA 3VH0A 4CZYA 1N6EA 3F3FA 1GP2B 2PM9B 5SXMA 3ULEC 2IAAA 3B7FA 1B9XA 3UR4A 2YNOA 4L3GD 4AEZA 5HE2B 4A7JA 1A0RB 3EMHA 4D0KA 2UZXB 2QXVA 3RN1D 4J8BA 5GMKn 3EI1B 2OK4A 4A0BB 2Z2NA 4L1QD 2AQ5A 1GG2B 3V5WB 2HKMA 3RLMD 1VYHC 2H6QA 4JSXC 4J79A 3N0EA 5IC7A 3UVNA 3I7HA 4A08B 4UI9R 4ZOYA 4CI2A 2H14A 4X60B 5HE0B 4O3UB 1FWXA 3C99A 2HESX 3RFGA 3SHFA 5EALA 2GC4A 4E5ZA 3JZNA 4PXWA 3SXTD 4K3ID 5FQDA 5CXCB 3DM0A 2B5MA 3BG1A 2J55H 2H9LA 3J80g 3OKTA 1XKSA 3UVOA 5EARA 1QNIA 3OTTA 2AGLA 3SLED 3RFHA 2XL3A 3IIWA 2EBSA 1B9YA 2B5LA 1S4UX 2GC7A 5TF2A 5AFU3 2AGZA 3EI4A 4X3EA 4CZXA 2YB8B 2GNQA 2AH1A 4I79A 1N6DA 5TEEA 5EMJB 3J81g 4GM3A 3OL2A 4A2MA 5FKTA 3AFCA 4H5IA 4R7AB 5CXBA 4ES0A 3SBQA 4FA1D 4XYIA 2OVPB 4CY3A 2P9IC 3CIKB 4GGAA 2HXCA 5GXIA 5FKRA 4Y5RD 4GM8A 4LG9A 5HYNB 4U1EI 4ESGA 3W15A 4D6VA 3NVQA 2HKRA 3I2NA 2XL2A 4PC0A 4H5JA 3CFSB 4E54A 3IJCA 3K26A 3PXWD 5EM2A 5H1MA 1SQ9A 1YFQA 3PXSD 1JMXB 1K32A 3PVUB 2HJ4A 4U7AA 3RN0D 4E5ZB 1OMWB 3JZGA 4FA9D 3JAMg 3EU7A 5FKSA 3C75H 4FB1D 4O9DA 4CI3A 4OWRA 3EI3A 3FRXA 1JJUB 2BBKH 1N6FA 2P9PC 4YVDA 3EI2A 2P9SC 4A11A 4JT6C 5K19A 2AH0A 3CFVA 3PE7A 3MXXA 2I0TA 5KDOB 3E0CA 4ERYA 3U4YA 2H3XA 5C9ZB 5I5JA 2XU7A 2IWFA 2CE8A 4J84A 2IUPA 3UKUC 2B5NA 5AMSA 4CY5A 3SWSD 2CN2A 3A0FA 5I5MA 2Z2OA 3EI4B 3DSMA 5I5IA 3GREA 2YNNA 3I7KA 4LG8A 3OL2B 3HFQA 2MTAH 2J56H 2OVRB 3JZHA 3ORVD 4ERZA 1P22A 2CO0A 4J82A 5H14A 5HQGA 2CNXA 2OVQB 3MZKA 2H6KA 3JRPA 5CYKA 5EMMB 5FA5B 4BH6A 4GQBB 2HJBA 3K27A 2H68A 4ZOZA 4GQ2P 2YMUA 3MZLA 4CY1A 4BL0A 1L0QA 2O9KA 3OKYA 4GMBA 4FAVD 3PXTD 2IUQA 4E54B 1RI6A 5FLXg 3VA6A 4JXMA 2IWKA 3KRXB 5EM2B 2PM6B 2TRCB 4FA5D 5H17A 4QRJA 4X61B 3OKWA 3ZWLB 3DXKC 5EMKB 3L4MD 1TYQC 5C2VB 2HYEA 4BUJC 5IGOA 4GM9A 3V7DB 5TDHB 4GGCA 4A09A 3EI3B 2P9KC 4QT8A 2H13A 1PGUA 3EI2B 4A11B 2IUVA 1TBGA 5B4WA 3I8CA 4XEIC 4A0AA 3OW8A 4K3JB 2IURA 3AL8A 4J73A 2G9AA 1GXRA 3VGZA 5TEFA 1MG2A 5EAPA 2CO0C 1NR0A 1GOTB 2Z2PA 3BG0A 4PBYA 4CC9A 4AOWA 4IMMA 3EG6A 2PM7B 3NVXA 3KRWB 1XHMA 2B4EA 3N0DA 4JSNC 3I7NA 2H47A 5GXHA 3IJ0A 2CE9A 2H9MA 2XYIA 5CYKB 4ZOVA 2YNPA 2P9UC 3SVWD 4J8GA 3SFZA 3NVNA 1PEVA 5FKQA 4FAND 2W18A 5JWZA 3UKRC 2I0SA 3OKYB 3JPXA 3L4OD 1XIPA 3SMRA 4L3HD 3PSLA 4JD2C 5HE3B 4J0WA 4EWRA 4TZ4A 4O1QD 3SN6B 5THAA 5EAMA 4GQ1A 2AGXA 2I0RA 3PVWB 1MDAH 4J0XA 3UVKA 5EMLB 4A2LA 1ERJA 4ZN4A 4G56B 1MG3A 4Z8LA 4GGDA 5CXBB 1SQJA 4LGNA 4QQEA 4L9OA 4Y7RA 4CZVA 3ODTA 1JOFA 2H9NA 4A09B 4PSWB 3P4FA 4FA4D 5GSAA 1OLZA 4FHLA 2OJYA 3SCYA 3F3GA 1K8KC 4PBZA 5IT9g 4O45A 3IJ1A 2PM9A 1PI6A 2AGYA 4A0AB 4CI1A 1SHYB 3UVLA 3AL8B 3DXMC 2PBIB 3DWLC 1U2VC 3I8EA 4J81A 3BWSA 2OIZA 4X63B 3MKQA 4CY2A 5C2WB 5IJ7E 2I3TA 4J87A 2UZYB 1Q47A 3I7PA 2G99A 3EI1A 4A0BA 4JSVC 4JT5C 3EWEA 4ZOXA 1U4CA 2H9PA 4PSXB 4J86A 5IJ8E 2P9NC 3I7LA 5FXYA 4CI8A 4ERQA 3UVMA 3JB9L 4IA9A
chains in the Genus database with same CATH superfamily
4HDJA 3EQ9A 3RSEC 4BP9A 4A08A 3C5MA 1JMZB 3AH8B 2YBAA 1QFMA 2QZPA 4XYHA 3FGBA 3MKSB 3MUNA 3C9CA 4J77A 3SBPA 5A2Qg 2OK6A 3RMZD 2AGWA 3I89A 3RRMC 4MMZA 1O6GA 3SJLD 3IIYA 3AL9A 5HDBA 2CN3A 2Q7QA 1NEXB 1TYEA 2VZ3A 5K1CC 4JSPC 5IGQA 4N14A 4FWWA 3PSCB 5CXCA 5E6RA 5C92A 2P9LC 4L1MA 4MK0B 2J57G 5AJAA 1A12A 4J78A 1H2WA 3JROA 2I3SA 4WK4A 1PBYB 3GD1I 4RE6A 4AN1A 4QL1A 1BPOA 3FM0A 4KFMB 3I7OA 3IURA 4AMZA 1O6FA 3V9FA 1C9LA 1H2ZA 3GFCA 4PNKB 4O3TB 5M5RA 2XE4A 4OZUA 2H6NA 3IKOA 1R5MA 2BCJB 2QC5A 5HE1B 3MMYA 4GZ8A 4NSXA 3F3PA 3SBRA 3VH0A 4CZYA 1N6EA 3F3FA 1GP2B 2PM9B 2HU7A 1E8MA 1U8CA 5SXMA 3ZE1A 3ULEC 2IAAA 3B7FA 5M5SA 1B9XA 3UR4A 2YNOA 4L3GD 4AEZA 5HE2B 4A7JA 1A0RB 3EMHA 4D0KA 2UZXB 2QXVA 1VZ3A 3RN1D 4J8BA 5GMKn 3EI1B 2OK4A 4A0BB 2Z2NA 1T2XA 4BCBA 4L1QD 2AQ5A 1GG2B 3V5WB 4AX4A 3O4GA 2HKMA 3RLMD 1VYHC 2H6QA 4JSXC 3T3PA 4J79A 3O4JA 1E5TA 3N0EA 5IC7A 3UVNA 3I7HA 1VZ2A 4IRZA 4A08B 4UI9R 4ZOYA 4CI2A 2H14A 3K71A 1E8NA 4X60B 2WQ8A 1H2XA 5HE0B 4O3UB 1FWXA 3C99A 4AMYA 2HESX 3ZDXA 2VDPA 3RFGA 3SHFA 5EALA 2GC4A 4E5ZA 3JZNA 4PXWA 3FCSA 3SXTD 4K3ID 3NIFA 5FQDA 5CXCB 3DM0A 2B5MA 3NIGA 3BG1A 3IUMA 2J55H 2H9LA 3J80g 3OKTA 1XKSA 3UVOA 5EARA 3VI4A 1QNIA 3OTTA 2AGLA 3SLED 3RFHA 2XL3A 3IIWA 4BCDA 2EICA 2EBSA 1B9YA 2B5LA 3DDUA 2VC2A 1S4UX 2GC7A 5FFGA 5TF2A 5AFU3 2AGZA 3EI4A 4X3EA 4CZXA 2YB8B 2GNQA 2VDLA 2AH1A 4JHPC 1UOQA 4NBMA 4I79A 1N6DA 5TEEA 1VE6A 3O4IA 5EMJB 4GM3A 3J81g 4UM8A 3OL2A 3ZDZA 4A2MA 5FKTA 3AFCA 4H5IA 4R7AB 5CXBA 4ES0A 3SBQA 4FA1D 4XYIA 2OVPB 3IULA 1QFSA 4CY3A 2P9IC 3CIKB 3EQ8A 2EIEA 4GGAA 2HXCA 5GXIA 1I2MB 5FKRA 5M61A 3K6SA 4Y5RD 3EQ7A 4GM8A 4LG9A 4D9SA 1JV2A 4U1EI 4ESGA 5HYNB 3NIDA 3W15A 4D6VA 4G55A 3NVQA 2HKRA 3I2NA 2XL2A 4PC0A 4H5JA 3VI3A 3CFSB 4E54A 3IJCA 2VDOA 3K26A 3PXWD 5EM2A 5H1MA 1C9IA 1SQ9A 1YFQA 3PXSD 1JMXB 1K32A 3PVUB 2HJ4A 4U7AA 3RN0D 2EIDA 3GC3B 4E5ZB 1OMWB 3JZGA 4FA9D 3JAMg 5M5VA 3EU7A 5FKSA 3C75H 4FB1D 4O9DA 5FFOA 4CI3A 4OWRA 3EI3A 3FRXA 1JJUB 2BBKH 1N6FA 2P9PC 4YVDA 3EI2A 2P9SC 4A11A 4JT6C 5K19A 2AH0A 3CFVA 3PE7A 3MXXA 2I0TA 5KDOB 3E0CA 4ERYA 3U4YA 2VDNA 2H3XA 4Z7QA 5C9ZB 5I5JA 2XU7A 2IWFA 2CE8A 2QR5A 3IVMA 4J84A 2IUPA 2EIBA 3UKUC 1UOOA 2B5NA 5AMSA 4CY5A 3SWSD 2CN2A 3A0FA 5I5MA 2VDQA 3FCUA 2Z2OA 3EI4B 4MMXA 2XZGA 3DSMA 5I5IA 3GREA 2YNNA 1VE7A 3IUQA 3QHYB 3I7KA 4LG8A 4MMYA 3OL2B 3HFQA 4JHNA 2MTAH 4UM9A 2J56H 2OVRB 3IUJA 3JZHA 3ORVD 4ERZA 1P22A 2CO0A 4J82A 5H14A 5HQGA 2CNXA 2OVQB 3MZKA 2H6KA 4G1EA 3JRPA 3K72A 5CYKA 3QI0A 5EMMB 5FA5B 4BH6A 4GQBB 2HJBA 3K27A 2H68A 4ZOZA 4GQ2P 3V4VA 2VDKA 2YMUA 3ZE0A 3MZLA 4CY1A 4BL0A 1L0QA 4AN0A 2O9KA 3ZDYA 3OKYA 4GMBA 4FAVD 3PXTD 2IUQA 4E54B 4G1MA 1RI6A 3OF7A 5FLXg 3VA6A 4JXMA 2IWKA 3KRXB 5EM2B 2PM6B 3T3MA 2TRCB 4FA5D 5H17A 4QRJA 4X61B 3OKWA 3ZWLB 3DXKC 5EMKB 3L4MD 1TYQC 4O02A 5C2VB 2HYEA 4BUJC 5IGOA 4GM9A 4NENA 3V7DB 5TDHB 4GGCA 4A09A 3EI3B 2P9KC 4QT8A 2H13A 1PGUA 3V4PA 3EI2B 4A11B 2IUVA 5M5UA 1TBGA 5B4WA 1GOFA 3I8CA 4XEIC 4A0AA 3OW8A 4K3JB 2IURA 4NAAA 3AL8A 4J73A 1GXRA 2G9AA 1GOGA 3VGZA 5TEFA 1MG2A 5EAPA 2CO0C 1NR0A 1GOTB 2Z2PA 3BG0A 1GOHA 4PBYA 2HU5A 4CC9A 4AOWA 4IMMA 4RE5A 3EG6A 2PM7B 3NVXA 2HU8A 4WJKA 3KRWB 3KCIA 1YR2A 3IUNA 1XHMA 2B4EA 4DNVA 3N0DA 4JSNC 3I7NA 4NC4A 2H47A 5GXHA 3IJ0A 2CE9A 2H9MA 2XYIA 4DNUA 4Z7OA 5CYKB 4ZOVA 2YNPA 2P9UC 4WK0A 3SVWD 4J8GA 3MUOA 3SFZA 3NVNA 4Z7NA 1PEVA 5FKQA 5E6SA 2W18A 4FAND 5JWZA 4BP8A 3UKRC 2I0SA 3OKYB 3JPXA 4QAMA 3L4OD 4DNWA 1XIPA 3SMRA 4L3HD 3PSLA 4JD2C 5HE3B 4J0WA 4EWRA 4TZ4A 4O1QD 3SN6B 5THAA 5EAMA 4GQ1A 2AGXA 2I0RA 3PVWB 1MDAH 1K3IA 4J0XA 3UVKA 2JKXA 5M5TA 5EMLB 4A2LA 1ERJA 2XDWA 5E6UA 4ZN4A 4G56B 1MG3A 2VDRA 4GGDA 4Z8LA 5CXBB 1SQJA 4LGNA 4QQEA 4L9OA 4Y7RA 4CZVA 1M1XA 3ODTA 1JOFA 3O4HA 2H9NA 4A09B 4PSWB 3P4FA 1L5GA 4FA4D 5GSAA 1OLZA 4FHLA 2OJYA 3SCYA 1H2YA 3F3GA 1K8KC 4PBZA 4WK2A 5IT9g 4O45A 3IJEA 3ZE2A 3IJ1A 2PM9A 1PI6A 2AGYA 4A0AB 4CI1A 1SHYB 3UVLA 3AL8B 3DXMC 4O2WA 2PBIB 3DWLC 1U2VC 3I8EA 4J81A 3BWSA 2OIZA 4X63B 3MKQA 4CY2A 5C2WB 2BKLA 4BCCA 2I3TA 5IJ7E 4J87A 2UZYB 1Q47A 1UTCA 3I7PA 1UOPA 2G99A 3EI1A 4A0BA 2VZ1A 4JSVC 4JT5C 3MVDK 3EWEA 2VDMA 1U4CA 4ZOXA 5C86A 2H9PA 4PSXB 4J86A 5IJ8E 2P9NC 3I7LA 5FXYA 4CI8A 4ERQA 3UVMA 3JB9L 4IA9A 1JTDB
chains in the Genus database with same CATH topology
4HDJA 3RSEC 4A08A 3C5MA 1JMZB 3AH8B 2YBAA 4XYHA 3FGBA 3MKSB 3C9CA 4J77A 3SBPA 5A2Qg 2OK6A 3RMZD 2AGWA 3I89A 3RRMC 3SJLD 3IIYA 3AL9A 2CN3A 2Q7QA 1NEXB 5K1CC 4JSPC 5IGQA 4N14A 4FWWA 3PSCB 5CXCA 2P9LC 4MK0B 2J57G 5AJAA 4J78A 3JROA 2I3SA 1PBYB 4QL1A 3FM0A 4KFMB 3I7OA 3V9FA 3GFCA 4PNKB 4O3TB 4OZUA 2H6NA 3IKOA 1R5MA 2BCJB 2QC5A 5HE1B 3MMYA 4GZ8A 4NSXA 3F3PA 3SBRA 3VH0A 4CZYA 1N6EA 3F3FA 1GP2B 2PM9B 5SXMA 3ULEC 2IAAA 3B7FA 1B9XA 3UR4A 2YNOA 4L3GD 4AEZA 5HE2B 4A7JA 1A0RB 3EMHA 4D0KA 2UZXB 2QXVA 3RN1D 4J8BA 5GMKn 3EI1B 2OK4A 4A0BB 2Z2NA 4L1QD 2AQ5A 1GG2B 3V5WB 2HKMA 3RLMD 1VYHC 2H6QA 4JSXC 4J79A 3N0EA 5IC7A 3UVNA 3I7HA 4A08B 4UI9R 4ZOYA 4CI2A 2H14A 4X60B 5HE0B 4O3UB 1FWXA 3C99A 2HESX 3RFGA 3SHFA 5EALA 2GC4A 4E5ZA 3JZNA 4PXWA 3SXTD 4K3ID 5FQDA 5CXCB 3DM0A 2B5MA 3BG1A 2J55H 2H9LA 3J80g 3OKTA 1XKSA 3UVOA 5EARA 1QNIA 3OTTA 2AGLA 3SLED 3RFHA 2XL3A 3IIWA 2EBSA 1B9YA 2B5LA 1S4UX 2GC7A 5TF2A 5AFU3 2AGZA 3EI4A 4X3EA 4CZXA 2YB8B 2GNQA 2AH1A 4I79A 1N6DA 5TEEA 5EMJB 3J81g 4GM3A 3OL2A 4A2MA 5FKTA 3AFCA 4H5IA 4R7AB 5CXBA 4ES0A 3SBQA 4FA1D 4XYIA 2OVPB 4CY3A 2P9IC 3CIKB 4GGAA 2HXCA 5GXIA 5FKRA 4Y5RD 4GM8A 4LG9A 5HYNB 4U1EI 4ESGA 3W15A 4D6VA 3NVQA 2HKRA 3I2NA 2XL2A 4PC0A 4H5JA 3CFSB 4E54A 3IJCA 3K26A 3PXWD 5EM2A 5H1MA 1SQ9A 1YFQA 3PXSD 1JMXB 1K32A 3PVUB 2HJ4A 4U7AA 3RN0D 4E5ZB 1OMWB 3JZGA 4FA9D 3JAMg 3EU7A 5FKSA 3C75H 4FB1D 4O9DA 4CI3A 4OWRA 3EI3A 3FRXA 1JJUB 2BBKH 1N6FA 2P9PC 4YVDA 3EI2A 2P9SC 4A11A 4JT6C 5K19A 2AH0A 3CFVA 3PE7A 3MXXA 2I0TA 5KDOB 3E0CA 4ERYA 3U4YA 2H3XA 5C9ZB 5I5JA 2XU7A 2IWFA 2CE8A 4J84A 2IUPA 3UKUC 2B5NA 5AMSA 4CY5A 3SWSD 2CN2A 3A0FA 5I5MA 2Z2OA 3EI4B 3DSMA 5I5IA 3GREA 2YNNA 3I7KA 4LG8A 3OL2B 3HFQA 2MTAH 2J56H 2OVRB 3JZHA 3ORVD 4ERZA 1P22A 2CO0A 4J82A 5H14A 5HQGA 2CNXA 2OVQB 3MZKA 2H6KA 3JRPA 5CYKA 5EMMB 5FA5B 4BH6A 4GQBB 2HJBA 3K27A 2H68A 4ZOZA 4GQ2P 2YMUA 3MZLA 4CY1A 4BL0A 1L0QA 2O9KA 3OKYA 4GMBA 4FAVD 3PXTD 2IUQA 4E54B 1RI6A 5FLXg 3VA6A 4JXMA 2IWKA 3KRXB 5EM2B 2PM6B 2TRCB 4FA5D 5H17A 4QRJA 4X61B 3OKWA 3ZWLB 3DXKC 5EMKB 3L4MD 1TYQC 5C2VB 2HYEA 4BUJC 5IGOA 4GM9A 3V7DB 5TDHB 4GGCA 4A09A 3EI3B 2P9KC 4QT8A 2H13A 1PGUA 3EI2B 4A11B 2IUVA 1TBGA 5B4WA 3I8CA 4XEIC 4A0AA 3OW8A 4K3JB 2IURA 3AL8A 4J73A 2G9AA 1GXRA 3VGZA 5TEFA 1MG2A 5EAPA 2CO0C 1NR0A 1GOTB 2Z2PA 3BG0A 4PBYA 4CC9A 4AOWA 4IMMA 3EG6A 2PM7B 3NVXA 3KRWB 1XHMA 2B4EA 3N0DA 4JSNC 3I7NA 2H47A 5GXHA 3IJ0A 2CE9A 2H9MA 2XYIA 5CYKB 4ZOVA 2YNPA 2P9UC 3SVWD 4J8GA 3SFZA 3NVNA 1PEVA 5FKQA 4FAND 2W18A 5JWZA 3UKRC 2I0SA 3OKYB 3JPXA 3L4OD 1XIPA 3SMRA 4L3HD 3PSLA 4JD2C 5HE3B 4J0WA 4EWRA 4TZ4A 4O1QD 3SN6B 5THAA 5EAMA 4GQ1A 2AGXA 2I0RA 3PVWB 1MDAH 4J0XA 3UVKA 5EMLB 4A2LA 1ERJA 4ZN4A 4G56B 1MG3A 4Z8LA 4GGDA 5CXBB 1SQJA 4LGNA 4QQEA 4L9OA 4Y7RA 4CZVA 3ODTA 1JOFA 2H9NA 4A09B 4PSWB 3P4FA 4FA4D 5GSAA 1OLZA 4FHLA 2OJYA 3SCYA 3F3GA 1K8KC 4PBZA 5IT9g 4O45A 3IJ1A 2PM9A 1PI6A 2AGYA 4A0AB 4CI1A 1SHYB 3UVLA 3AL8B 3DXMC 2PBIB 3DWLC 1U2VC 3I8EA 4J81A 3BWSA 2OIZA 4X63B 3MKQA 4CY2A 5C2WB 5IJ7E 2I3TA 4J87A 2UZYB 1Q47A 3I7PA 2G99A 3EI1A 4A0BA 4JSVC 4JT5C 3EWEA 4ZOXA 1U4CA 2H9PA 4PSXB 4J86A 5IJ8E 2P9NC 3I7LA 5FXYA 4CI8A 4ERQA 3UVMA 3JB9L 4IA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDJ A;  3RSE C;  4A08 A;  3C5M A;  1JMZ B;  3AH8 B;  2YBA A;  4XYH A;  3FGB A;  3MKS B;  3C9C A;  4J77 A;  3SBP A;  5A2Q g;  2OK6 A;  3RMZ D;  2AGW A;  3I89 A;  3RRM C;  3SJL D;  3IIY A;  3AL9 A;  2CN3 A;  2Q7Q A;  1NEX B;  5K1C C;  4JSP C;  5IGQ A;  4N14 A;  4FWW A;  3PSC B;  5CXC A;  2P9L C;  4MK0 B;  2J57 G;  5AJA A;  4J78 A;  3JRO A;  2I3S A;  1PBY B;  4QL1 A;  3FM0 A;  4KFM B;  3I7O A;  3V9F A;  3GFC A;  4PNK B;  4O3T B;  4OZU A;  2H6N A;  3IKO A;  1R5M A;  2BCJ B;  2QC5 A;  5HE1 B;  3MMY A;  4GZ8 A;  4NSX A;  3F3P A;  3SBR A;  3VH0 A;  4CZY A;  1N6E A;  3F3F A;  1GP2 B;  2PM9 B;  5SXM A;  3ULE C;  2IAA A;  3B7F A;  1B9X A;  3UR4 A;  2YNO A;  4L3G D;  4AEZ A;  5HE2 B;  4A7J A;  1A0R B;  3EMH A;  4D0K A;  2UZX B;  2QXV A;  3RN1 D;  4J8B A;  5GMK n;  3EI1 B;  2OK4 A;  4A0B B;  2Z2N A;  4L1Q D;  2AQ5 A;  1GG2 B;  3V5W B;  2HKM A;  3RLM D;  1VYH C;  2H6Q A;  4JSX C;  4J79 A;  3N0E A;  5IC7 A;  3UVN A;  3I7H A;  4A08 B;  4UI9 R;  4ZOY A;  4CI2 A;  2H14 A;  4X60 B;  5HE0 B;  4O3U B;  1FWX A;  3C99 A;  2HES X;  3RFG A;  3SHF A;  5EAL A;  2GC4 A;  4E5Z A;  3JZN A;  4PXW A;  3SXT D;  4K3I D;  5FQD A;  5CXC B;  3DM0 A;  2B5M A;  3BG1 A;  2J55 H;  2H9L A;  3J80 g;  3OKT A;  1XKS A;  3UVO A;  5EAR A;  1QNI A;  3OTT A;  2AGL A;  3SLE D;  3RFH A;  2XL3 A;  3IIW A;  2EBS A;  1B9Y A;  2B5L A;  1S4U X;  2GC7 A;  5TF2 A;  5AFU 3;  2AGZ A;  3EI4 A;  4X3E A;  4CZX A;  2YB8 B;  2GNQ A;  2AH1 A;  4I79 A;  1N6D A;  5TEE A;  5EMJ B;  3J81 g;  4GM3 A;  3OL2 A;  4A2M A;  5FKT A;  3AFC A;  4H5I A;  4R7A B;  5CXB A;  4ES0 A;  3SBQ A;  4FA1 D;  4XYI A;  2OVP B;  4CY3 A;  2P9I C;  3CIK B;  4GGA A;  2HXC A;  5GXI A;  5FKR A;  4Y5R D;  4GM8 A;  4LG9 A;  5HYN B;  4U1E I;  4ESG A;  3W15 A;  4D6V A;  3NVQ A;  2HKR A;  3I2N A;  2XL2 A;  4PC0 A;  4H5J A;  3CFS B;  4E54 A;  3IJC A;  3K26 A;  3PXW D;  5EM2 A;  5H1M A;  1SQ9 A;  1YFQ A;  3PXS D;  1JMX B;  1K32 A;  3PVU B;  2HJ4 A;  4U7A A;  3RN0 D;  4E5Z B;  1OMW B;  3JZG A;  4FA9 D;  3JAM g;  3EU7 A;  5FKS A;  3C75 H;  4FB1 D;  4O9D A;  4CI3 A;  4OWR A;  3EI3 A;  3FRX A;  1JJU B;  2BBK H;  1N6F A;  2P9P C;  4YVD A;  3EI2 A;  2P9S C;  4A11 A;  4JT6 C;  5K19 A;  2AH0 A;  3CFV A;  3PE7 A;  3MXX A;  2I0T A;  5KDO B;  3E0C A;  4ERY A;  3U4Y A;  2H3X A;  5C9Z B;  5I5J A;  2XU7 A;  2IWF A;  2CE8 A;  4J84 A;  2IUP A;  3UKU C;  2B5N A;  5AMS A;  4CY5 A;  3SWS D;  2CN2 A;  3A0F A;  5I5M A;  2Z2O A;  3EI4 B;  3DSM A;  5I5I A;  3GRE A;  2YNN A;  3I7K A;  4LG8 A;  3OL2 B;  3HFQ A;  2MTA H;  2J56 H;  2OVR B;  3JZH A;  3ORV D;  4ERZ A;  1P22 A;  2CO0 A;  4J82 A;  5H14 A;  5HQG A;  2CNX A;  2OVQ B;  3MZK A;  2H6K A;  3JRP A;  5CYK A;  5EMM B;  5FA5 B;  4BH6 A;  4GQB B;  2HJB A;  3K27 A;  2H68 A;  4ZOZ A;  4GQ2 P;  2YMU A;  3MZL A;  4CY1 A;  4BL0 A;  1L0Q A;  2O9K A;  3OKY A;  4GMB A;  4FAV D;  3PXT D;  2IUQ A;  4E54 B;  1RI6 A;  5FLX g;  3VA6 A;  4JXM A;  2IWK A;  3KRX B;  5EM2 B;  2PM6 B;  2TRC B;  4FA5 D;  5H17 A;  4QRJ A;  4X61 B;  3OKW A;  3ZWL B;  3DXK C;  5EMK B;  3L4M D;  1TYQ C;  5C2V B;  2HYE A;  4BUJ C;  5IGO A;  4GM9 A;  3V7D B;  5TDH B;  4GGC A;  4A09 A;  3EI3 B;  2P9K C;  4QT8 A;  2H13 A;  1PGU A;  3EI2 B;  4A11 B;  2IUV A;  1TBG A;  5B4W A;  3I8C A;  4XEI C;  4A0A A;  3OW8 A;  4K3J B;  2IUR A;  3AL8 A;  4J73 A;  2G9A A;  1GXR A;  3VGZ A;  5TEF A;  1MG2 A;  5EAP A;  2CO0 C;  1NR0 A;  1GOT B;  2Z2P A;  3BG0 A;  4PBY A;  4CC9 A;  4AOW A;  4IMM A;  3EG6 A;  2PM7 B;  3NVX A;  3KRW B;  1XHM A;  2B4E A;  3N0D A;  4JSN C;  3I7N A;  2H47 A;  5GXH A;  3IJ0 A;  2CE9 A;  2H9M A;  2XYI A;  5CYK B;  4ZOV A;  2YNP A;  2P9U C;  3SVW D;  4J8G A;  3SFZ A;  3NVN A;  1PEV A;  5FKQ A;  4FAN D;  2W18 A;  5JWZ A;  3UKR C;  2I0S A;  3OKY B;  3JPX A;  3L4O D;  1XIP A;  3SMR A;  4L3H D;  3PSL A;  4JD2 C;  5HE3 B;  4J0W A;  4EWR A;  4TZ4 A;  4O1Q D;  3SN6 B;  5THA A;  5EAM A;  4GQ1 A;  2AGX A;  2I0R A;  3PVW B;  1MDA H;  4J0X A;  3UVK A;  5EML B;  4A2L A;  1ERJ A;  4ZN4 A;  4G56 B;  1MG3 A;  4Z8L A;  4GGD A;  5CXB B;  1SQJ A;  4LGN A;  4QQE A;  4L9O A;  4Y7R A;  4CZV A;  3ODT A;  1JOF A;  2H9N A;  4A09 B;  4PSW B;  3P4F A;  4FA4 D;  5GSA A;  1OLZ A;  4FHL A;  2OJY A;  3SCY A;  3F3G A;  1K8K C;  4PBZ A;  5IT9 g;  4O45 A;  3IJ1 A;  2PM9 A;  1PI6 A;  2AGY A;  4A0A B;  4CI1 A;  1SHY B;  3UVL A;  3AL8 B;  3DXM C;  2PBI B;  3DWL C;  1U2V C;  3I8E A;  4J81 A;  3BWS A;  2OIZ A;  4X63 B;  3MKQ A;  4CY2 A;  5C2W B;  5IJ7 E;  2I3T A;  4J87 A;  2UZY B;  1Q47 A;  3I7P A;  2G99 A;  3EI1 A;  4A0B A;  4JSV C;  4JT5 C;  3EWE A;  4ZOX A;  1U4C A;  2H9P A;  4PSX B;  4J86 A;  5IJ8 E;  2P9N C;  3I7L A;  5FXY A;  4CI8 A;  4ERQ A;  3UVM A;  3JB9 L;  4IA9 A; 
#chains in the Genus database with same CATH topology
 4HDJ A;  3EQ9 A;  3RSE C;  4BP9 A;  4A08 A;  3C5M A;  1JMZ B;  3AH8 B;  2YBA A;  1QFM A;  2QZP A;  4XYH A;  3FGB A;  3MKS B;  3MUN A;  3C9C A;  4J77 A;  3SBP A;  5A2Q g;  2OK6 A;  3RMZ D;  2AGW A;  3I89 A;  3RRM C;  4MMZ A;  1O6G A;  3SJL D;  3IIY A;  3AL9 A;  5HDB A;  2CN3 A;  2Q7Q A;  1NEX B;  1TYE A;  2VZ3 A;  5K1C C;  4JSP C;  5IGQ A;  4N14 A;  4FWW A;  3PSC B;  5CXC A;  5E6R A;  5C92 A;  2P9L C;  4L1M A;  4MK0 B;  2J57 G;  5AJA A;  1A12 A;  4J78 A;  1H2W A;  3JRO A;  2I3S A;  4WK4 A;  1PBY B;  3GD1 I;  4RE6 A;  4AN1 A;  4QL1 A;  1BPO A;  3FM0 A;  4KFM B;  3I7O A;  3IUR A;  4AMZ A;  1O6F A;  3V9F A;  1C9L A;  1H2Z A;  3GFC A;  4PNK B;  4O3T B;  5M5R A;  2XE4 A;  4OZU A;  2H6N A;  3IKO A;  1R5M A;  2BCJ B;  2QC5 A;  5HE1 B;  3MMY A;  4GZ8 A;  4NSX A;  3F3P A;  3SBR A;  3VH0 A;  4CZY A;  1N6E A;  3F3F A;  1GP2 B;  2PM9 B;  2HU7 A;  1E8M A;  1U8C A;  5SXM A;  3ZE1 A;  3ULE C;  2IAA A;  3B7F A;  5M5S A;  1B9X A;  3UR4 A;  2YNO A;  4L3G D;  4AEZ A;  5HE2 B;  4A7J A;  1A0R B;  3EMH A;  4D0K A;  2UZX B;  2QXV A;  1VZ3 A;  3RN1 D;  4J8B A;  5GMK n;  3EI1 B;  2OK4 A;  4A0B B;  2Z2N A;  1T2X A;  4BCB A;  4L1Q D;  2AQ5 A;  1GG2 B;  3V5W B;  4AX4 A;  3O4G A;  2HKM A;  3RLM D;  1VYH C;  2H6Q A;  4JSX C;  3T3P A;  4J79 A;  3O4J A;  1E5T A;  3N0E A;  5IC7 A;  3UVN A;  3I7H A;  1VZ2 A;  4IRZ A;  4A08 B;  4UI9 R;  4ZOY A;  4CI2 A;  2H14 A;  3K71 A;  1E8N A;  4X60 B;  2WQ8 A;  1H2X A;  5HE0 B;  4O3U B;  1FWX A;  3C99 A;  4AMY A;  2HES X;  3ZDX A;  2VDP A;  3RFG A;  3SHF A;  5EAL A;  2GC4 A;  4E5Z A;  3JZN A;  4PXW A;  3FCS A;  3SXT D;  4K3I D;  3NIF A;  5FQD A;  5CXC B;  3DM0 A;  2B5M A;  3NIG A;  3BG1 A;  3IUM A;  2J55 H;  2H9L A;  3J80 g;  3OKT A;  1XKS A;  3UVO A;  5EAR A;  3VI4 A;  1QNI A;  3OTT A;  2AGL A;  3SLE D;  3RFH A;  2XL3 A;  3IIW A;  4BCD A;  2EIC A;  2EBS A;  1B9Y A;  2B5L A;  3DDU A;  2VC2 A;  1S4U X;  2GC7 A;  5FFG A;  5TF2 A;  5AFU 3;  2AGZ A;  3EI4 A;  4X3E A;  4CZX A;  2YB8 B;  2GNQ A;  2VDL A;  2AH1 A;  4JHP C;  1UOQ A;  4NBM A;  4I79 A;  1N6D A;  5TEE A;  1VE6 A;  3O4I A;  5EMJ B;  4GM3 A;  3J81 g;  4UM8 A;  3OL2 A;  3ZDZ A;  4A2M A;  5FKT A;  3AFC A;  4H5I A;  4R7A B;  5CXB A;  4ES0 A;  3SBQ A;  4FA1 D;  4XYI A;  2OVP B;  3IUL A;  1QFS A;  4CY3 A;  2P9I C;  3CIK B;  3EQ8 A;  2EIE A;  4GGA A;  2HXC A;  5GXI A;  1I2M B;  5FKR A;  5M61 A;  3K6S A;  4Y5R D;  3EQ7 A;  4GM8 A;  4LG9 A;  4D9S A;  1JV2 A;  4U1E I;  4ESG A;  5HYN B;  3NID A;  3W15 A;  4D6V A;  4G55 A;  3NVQ A;  2HKR A;  3I2N A;  2XL2 A;  4PC0 A;  4H5J A;  3VI3 A;  3CFS B;  4E54 A;  3IJC A;  2VDO A;  3K26 A;  3PXW D;  5EM2 A;  5H1M A;  1C9I A;  1SQ9 A;  1YFQ A;  3PXS D;  1JMX B;  1K32 A;  3PVU B;  2HJ4 A;  4U7A A;  3RN0 D;  2EID A;  3GC3 B;  4E5Z B;  1OMW B;  3JZG A;  4FA9 D;  3JAM g;  5M5V A;  3EU7 A;  5FKS A;  3C75 H;  4FB1 D;  4O9D A;  5FFO A;  4CI3 A;  4OWR A;  3EI3 A;  3FRX A;  1JJU B;  2BBK H;  1N6F A;  2P9P C;  4YVD A;  3EI2 A;  2P9S C;  4A11 A;  4JT6 C;  5K19 A;  2AH0 A;  3CFV A;  3PE7 A;  3MXX A;  2I0T A;  5KDO B;  3E0C A;  4ERY A;  3U4Y A;  2VDN A;  2H3X A;  4Z7Q A;  5C9Z B;  5I5J A;  2XU7 A;  2IWF A;  2CE8 A;  2QR5 A;  3IVM A;  4J84 A;  2IUP A;  2EIB A;  3UKU C;  1UOO A;  2B5N A;  5AMS A;  4CY5 A;  3SWS D;  2CN2 A;  3A0F A;  5I5M A;  2VDQ A;  3FCU A;  2Z2O A;  3EI4 B;  4MMX A;  2XZG A;  3DSM A;  5I5I A;  3GRE A;  2YNN A;  1VE7 A;  3IUQ A;  3QHY B;  3I7K A;  4LG8 A;  4MMY A;  3OL2 B;  3HFQ A;  4JHN A;  2MTA H;  4UM9 A;  2J56 H;  2OVR B;  3IUJ A;  3JZH A;  3ORV D;  4ERZ A;  1P22 A;  2CO0 A;  4J82 A;  5H14 A;  5HQG A;  2CNX A;  2OVQ B;  3MZK A;  2H6K A;  4G1E A;  3JRP A;  3K72 A;  5CYK A;  3QI0 A;  5EMM B;  5FA5 B;  4BH6 A;  4GQB B;  2HJB A;  3K27 A;  2H68 A;  4ZOZ A;  4GQ2 P;  3V4V A;  2VDK A;  2YMU A;  3ZE0 A;  3MZL A;  4CY1 A;  4BL0 A;  1L0Q A;  4AN0 A;  2O9K A;  3ZDY A;  3OKY A;  4GMB A;  4FAV D;  3PXT D;  2IUQ A;  4E54 B;  4G1M A;  1RI6 A;  3OF7 A;  5FLX g;  3VA6 A;  4JXM A;  2IWK A;  3KRX B;  5EM2 B;  2PM6 B;  3T3M A;  2TRC B;  4FA5 D;  5H17 A;  4QRJ A;  4X61 B;  3OKW A;  3ZWL B;  3DXK C;  5EMK B;  3L4M D;  1TYQ C;  4O02 A;  5C2V B;  2HYE A;  4BUJ C;  5IGO A;  4GM9 A;  4NEN A;  3V7D B;  5TDH B;  4GGC A;  4A09 A;  3EI3 B;  2P9K C;  4QT8 A;  2H13 A;  1PGU A;  3V4P A;  3EI2 B;  4A11 B;  2IUV A;  5M5U A;  1TBG A;  5B4W A;  1GOF A;  3I8C A;  4XEI C;  4A0A A;  3OW8 A;  4K3J B;  2IUR A;  4NAA A;  3AL8 A;  4J73 A;  1GXR A;  2G9A A;  1GOG A;  3VGZ A;  5TEF A;  1MG2 A;  5EAP A;  2CO0 C;  1NR0 A;  1GOT B;  2Z2P A;  3BG0 A;  1GOH A;  4PBY A;  2HU5 A;  4CC9 A;  4AOW A;  4IMM A;  4RE5 A;  3EG6 A;  2PM7 B;  3NVX A;  2HU8 A;  4WJK A;  3KRW B;  3KCI A;  1YR2 A;  3IUN A;  1XHM A;  2B4E A;  4DNV A;  3N0D A;  4JSN C;  3I7N A;  4NC4 A;  2H47 A;  5GXH A;  3IJ0 A;  2CE9 A;  2H9M A;  2XYI A;  4DNU A;  4Z7O A;  5CYK B;  4ZOV A;  2YNP A;  2P9U C;  4WK0 A;  3SVW D;  4J8G A;  3MUO A;  3SFZ A;  3NVN A;  4Z7N A;  1PEV A;  5FKQ A;  5E6S A;  2W18 A;  4FAN D;  5JWZ A;  4BP8 A;  3UKR C;  2I0S A;  3OKY B;  3JPX A;  4QAM A;  3L4O D;  4DNW A;  1XIP A;  3SMR A;  4L3H D;  3PSL A;  4JD2 C;  5HE3 B;  4J0W A;  4EWR A;  4TZ4 A;  4O1Q D;  3SN6 B;  5THA A;  5EAM A;  4GQ1 A;  2AGX A;  2I0R A;  3PVW B;  1MDA H;  1K3I A;  4J0X A;  3UVK A;  2JKX A;  5M5T A;  5EML B;  4A2L A;  1ERJ A;  2XDW A;  5E6U A;  4ZN4 A;  4G56 B;  1MG3 A;  2VDR A;  4GGD A;  4Z8L A;  5CXB B;  1SQJ A;  4LGN A;  4QQE A;  4L9O A;  4Y7R A;  4CZV A;  1M1X A;  3ODT A;  1JOF A;  3O4H A;  2H9N A;  4A09 B;  4PSW B;  3P4F A;  1L5G A;  4FA4 D;  5GSA A;  1OLZ A;  4FHL A;  2OJY A;  3SCY A;  1H2Y A;  3F3G A;  1K8K C;  4PBZ A;  4WK2 A;  5IT9 g;  4O45 A;  3IJE A;  3ZE2 A;  3IJ1 A;  2PM9 A;  1PI6 A;  2AGY A;  4A0A B;  4CI1 A;  1SHY B;  3UVL A;  3AL8 B;  3DXM C;  4O2W A;  2PBI B;  3DWL C;  1U2V C;  3I8E A;  4J81 A;  3BWS A;  2OIZ A;  4X63 B;  3MKQ A;  4CY2 A;  5C2W B;  2BKL A;  4BCC A;  2I3T A;  5IJ7 E;  4J87 A;  2UZY B;  1Q47 A;  1UTC A;  3I7P A;  1UOP A;  2G99 A;  3EI1 A;  4A0B A;  2VZ1 A;  4JSV C;  4JT5 C;  3MVD K;  3EWE A;  2VDM A;  1U4C A;  4ZOX A;  5C86 A;  2H9P A;  4PSX B;  4J86 A;  5IJ8 E;  2P9N C;  3I7L A;  5FXY A;  4CI8 A;  4ERQ A;  3UVM A;  3JB9 L;  4IA9 A;  1JTD B; 
#chains in the Genus database with same CATH homology
 4HDJ A;  3RSE C;  4A08 A;  3C5M A;  1JMZ B;  3AH8 B;  2YBA A;  4XYH A;  3FGB A;  3MKS B;  3C9C A;  4J77 A;  3SBP A;  5A2Q g;  2OK6 A;  3RMZ D;  2AGW A;  3I89 A;  3RRM C;  3SJL D;  3IIY A;  3AL9 A;  2CN3 A;  2Q7Q A;  1NEX B;  5K1C C;  4JSP C;  5IGQ A;  4N14 A;  4FWW A;  3PSC B;  5CXC A;  2P9L C;  4MK0 B;  2J57 G;  5AJA A;  4J78 A;  3JRO A;  2I3S A;  1PBY B;  4QL1 A;  3FM0 A;  4KFM B;  3I7O A;  3V9F A;  3GFC A;  4PNK B;  4O3T B;  4OZU A;  2H6N A;  3IKO A;  1R5M A;  2BCJ B;  2QC5 A;  5HE1 B;  3MMY A;  4GZ8 A;  4NSX A;  3F3P A;  3SBR A;  3VH0 A;  4CZY A;  1N6E A;  3F3F A;  1GP2 B;  2PM9 B;  5SXM A;  3ULE C;  2IAA A;  3B7F A;  1B9X A;  3UR4 A;  2YNO A;  4L3G D;  4AEZ A;  5HE2 B;  4A7J A;  1A0R B;  3EMH A;  4D0K A;  2UZX B;  2QXV A;  3RN1 D;  4J8B A;  5GMK n;  3EI1 B;  2OK4 A;  4A0B B;  2Z2N A;  4L1Q D;  2AQ5 A;  1GG2 B;  3V5W B;  2HKM A;  3RLM D;  1VYH C;  2H6Q A;  4JSX C;  4J79 A;  3N0E A;  5IC7 A;  3UVN A;  3I7H A;  4A08 B;  4UI9 R;  4ZOY A;  4CI2 A;  2H14 A;  4X60 B;  5HE0 B;  4O3U B;  1FWX A;  3C99 A;  2HES X;  3RFG A;  3SHF A;  5EAL A;  2GC4 A;  4E5Z A;  3JZN A;  4PXW A;  3SXT D;  4K3I D;  5FQD A;  5CXC B;  3DM0 A;  2B5M A;  3BG1 A;  2J55 H;  2H9L A;  3J80 g;  3OKT A;  1XKS A;  3UVO A;  5EAR A;  1QNI A;  3OTT A;  2AGL A;  3SLE D;  3RFH A;  2XL3 A;  3IIW A;  2EBS A;  1B9Y A;  2B5L A;  1S4U X;  2GC7 A;  5TF2 A;  5AFU 3;  2AGZ A;  3EI4 A;  4X3E A;  4CZX A;  2YB8 B;  2GNQ A;  2AH1 A;  4I79 A;  1N6D A;  5TEE A;  5EMJ B;  3J81 g;  4GM3 A;  3OL2 A;  4A2M A;  5FKT A;  3AFC A;  4H5I A;  4R7A B;  5CXB A;  4ES0 A;  3SBQ A;  4FA1 D;  4XYI A;  2OVP B;  4CY3 A;  2P9I C;  3CIK B;  4GGA A;  2HXC A;  5GXI A;  5FKR A;  4Y5R D;  4GM8 A;  4LG9 A;  5HYN B;  4U1E I;  4ESG A;  3W15 A;  4D6V A;  3NVQ A;  2HKR A;  3I2N A;  2XL2 A;  4PC0 A;  4H5J A;  3CFS B;  4E54 A;  3IJC A;  3K26 A;  3PXW D;  5EM2 A;  5H1M A;  1SQ9 A;  1YFQ A;  3PXS D;  1JMX B;  1K32 A;  3PVU B;  2HJ4 A;  4U7A A;  3RN0 D;  4E5Z B;  1OMW B;  3JZG A;  4FA9 D;  3JAM g;  3EU7 A;  5FKS A;  3C75 H;  4FB1 D;  4O9D A;  4CI3 A;  4OWR A;  3EI3 A;  3FRX A;  1JJU B;  2BBK H;  1N6F A;  2P9P C;  4YVD A;  3EI2 A;  2P9S C;  4A11 A;  4JT6 C;  5K19 A;  2AH0 A;  3CFV A;  3PE7 A;  3MXX A;  2I0T A;  5KDO B;  3E0C A;  4ERY A;  3U4Y A;  2H3X A;  5C9Z B;  5I5J A;  2XU7 A;  2IWF A;  2CE8 A;  4J84 A;  2IUP A;  3UKU C;  2B5N A;  5AMS A;  4CY5 A;  3SWS D;  2CN2 A;  3A0F A;  5I5M A;  2Z2O A;  3EI4 B;  3DSM A;  5I5I A;  3GRE A;  2YNN A;  3I7K A;  4LG8 A;  3OL2 B;  3HFQ A;  2MTA H;  2J56 H;  2OVR B;  3JZH A;  3ORV D;  4ERZ A;  1P22 A;  2CO0 A;  4J82 A;  5H14 A;  5HQG A;  2CNX A;  2OVQ B;  3MZK A;  2H6K A;  3JRP A;  5CYK A;  5EMM B;  5FA5 B;  4BH6 A;  4GQB B;  2HJB A;  3K27 A;  2H68 A;  4ZOZ A;  4GQ2 P;  2YMU A;  3MZL A;  4CY1 A;  4BL0 A;  1L0Q A;  2O9K A;  3OKY A;  4GMB A;  4FAV D;  3PXT D;  2IUQ A;  4E54 B;  1RI6 A;  5FLX g;  3VA6 A;  4JXM A;  2IWK A;  3KRX B;  5EM2 B;  2PM6 B;  2TRC B;  4FA5 D;  5H17 A;  4QRJ A;  4X61 B;  3OKW A;  3ZWL B;  3DXK C;  5EMK B;  3L4M D;  1TYQ C;  5C2V B;  2HYE A;  4BUJ C;  5IGO A;  4GM9 A;  3V7D B;  5TDH B;  4GGC A;  4A09 A;  3EI3 B;  2P9K C;  4QT8 A;  2H13 A;  1PGU A;  3EI2 B;  4A11 B;  2IUV A;  1TBG A;  5B4W A;  3I8C A;  4XEI C;  4A0A A;  3OW8 A;  4K3J B;  2IUR A;  3AL8 A;  4J73 A;  2G9A A;  1GXR A;  3VGZ A;  5TEF A;  1MG2 A;  5EAP A;  2CO0 C;  1NR0 A;  1GOT B;  2Z2P A;  3BG0 A;  4PBY A;  4CC9 A;  4AOW A;  4IMM A;  3EG6 A;  2PM7 B;  3NVX A;  3KRW B;  1XHM A;  2B4E A;  3N0D A;  4JSN C;  3I7N A;  2H47 A;  5GXH A;  3IJ0 A;  2CE9 A;  2H9M A;  2XYI A;  5CYK B;  4ZOV A;  2YNP A;  2P9U C;  3SVW D;  4J8G A;  3SFZ A;  3NVN A;  1PEV A;  5FKQ A;  4FAN D;  2W18 A;  5JWZ A;  3UKR C;  2I0S A;  3OKY B;  3JPX A;  3L4O D;  1XIP A;  3SMR A;  4L3H D;  3PSL A;  4JD2 C;  5HE3 B;  4J0W A;  4EWR A;  4TZ4 A;  4O1Q D;  3SN6 B;  5THA A;  5EAM A;  4GQ1 A;  2AGX A;  2I0R A;  3PVW B;  1MDA H;  4J0X A;  3UVK A;  5EML B;  4A2L A;  1ERJ A;  4ZN4 A;  4G56 B;  1MG3 A;  4Z8L A;  4GGD A;  5CXB B;  1SQJ A;  4LGN A;  4QQE A;  4L9O A;  4Y7R A;  4CZV A;  3ODT A;  1JOF A;  2H9N A;  4A09 B;  4PSW B;  3P4F A;  4FA4 D;  5GSA A;  1OLZ A;  4FHL A;  2OJY A;  3SCY A;  3F3G A;  1K8K C;  4PBZ A;  5IT9 g;  4O45 A;  3IJ1 A;  2PM9 A;  1PI6 A;  2AGY A;  4A0A B;  4CI1 A;  1SHY B;  3UVL A;  3AL8 B;  3DXM C;  2PBI B;  3DWL C;  1U2V C;  3I8E A;  4J81 A;  3BWS A;  2OIZ A;  4X63 B;  3MKQ A;  4CY2 A;  5C2W B;  5IJ7 E;  2I3T A;  4J87 A;  2UZY B;  1Q47 A;  3I7P A;  2G99 A;  3EI1 A;  4A0B A;  4JSV C;  4JT5 C;  3EWE A;  4ZOX A;  1U4C A;  2H9P A;  4PSX B;  4J86 A;  5IJ8 E;  2P9N C;  3I7L A;  5FXY A;  4CI8 A;  4ERQ A;  3UVM A;  3JB9 L;  4IA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...