5IGOA

Wd40 domain of arabidopsis thaliana e3 ubiquitin ligase cop1 in complex with peptide from trib1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
321
structure length
321
Chain Sequence
SRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/peptide
molecule keywords E3 ubiquitin-protein ligase COP1
publication title Structural Basis for Substrate Selectivity of the E3 Ligase COP1.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 82
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5igoA00
2Z2OA 3UVKA 4O1QD 3SN6B 4CI8A 3BG1A 5H1MA 4L1QD 4JSXC 3L4OD 4CZXA 4GM8A 3F3GA 2XL2A 2G99A 4FHLA 5EALA 3AL8B 4OZUA 4GGDA 3KRXB 3FRXA 4CZYA 3RSEC 3K27A 4XEIC 5I5MA 3PXWD 1MG3A 3MZKA 5GMKn 5EARA 3SJLD 2CE9A 1SHYB 4GM9A 2OK6A 4K3JB 4ESGA 2UZYB 3SBQA 4BL0A 3OKYB 3RFGA 4HDJA 2P9PC 4Y7RA 4ZOZA 4AOWA 4JD2C 3UVLA 3JAMg 1JMXB 1NEXB 3ZWLB 5IGQA 3OL2A 1MDAH 2H3XA 4ZN4A 3F3FA 1PBYB 2TRCB 4AEZA 3EMHA 2H6QA 5CXCB 5EM2B 4E5ZA 4U1EI 3EG6A 1GXRA 1GOTB 2XYIA 3UKUC 3CIKB 1GP2B 4O45A 5AJAA 5EMKB 3V5WB 4A2LA 5KDOB 3VH0A 4JXMA 2YNPA 5IJ8E 5GXHA 3I2NA 4J79A 2Q7QA 4E54A 2HKMA 2AGXA 3IJ0A 3JZHA 4J87A 3C99A 4L3GD 4JSVC 2P9NC 4J78A 3VGZA 4N14A 2G9AA 3SFZA 4QT8A 3I8EA 4D6VA 3EI1A 3UVNA 4FWWA 3PSLA 4CC9A 4CY5A 3DWLC 1YFQA 3J80g 2GNQA 2IURA 3EI3B 4OWRA 4FA1D 4JSNC 5H17A 5THAA 2B4EA 3RN1D 4I79A 1NR0A 1PEVA 3IIYA 4J84A 4TZ4A 4A09A 3OKTA 2YNNA 4QRJA 4PSWB 5FA5B 2O9KA 5CYKA 3C5MA 3FGBA 3IIWA 4A0AB 2J55H 2CN3A 2YMUA 4LG9A 5TF2A 3E0CA 2B5NA 4J82A 2H13A 2OVQB 1XHMA 4A08A 2I3TA 4A11B 2Z2NA 2B5MA 1N6EA 2IUQA 5CXBB 3C9CA 5I5IA 2H6NA 5AFU3 2CO0A 3MZLA 4A0BB 3BWSA 4PBZA 3HFQA 2PBIB 3PXTD 5B4WA 5TEFA 3SXTD 1U2VC 4GQ1A 5CYKB 3MXXA 3OW8A 1P22A 4O9DA 4PXWA 4X60B 3UVMA 4D0KA 4L3HD 5HE1B 3B7FA 4X3EA 3UR4A 2EBSA 3SMRA 3GREA 1VYHC 2H47A 2MTAH 3KRWB 3RMZD 1L0QA 4PNKB 1K8KC 3W15A 3SHFA 1R5MA 5IGOA 2AH1A 3EWEA 3RLMD 2YNOA 4QL1A 3EI2B 2PM9A 3V9FA 2HJ4A 2I3SA 4EWRA 4GMBA 5HE3B 4FA9D 3L4MD 4ES0A 5C2VB 2AH0A 2IAAA 2OVPB 4XYIA 3I7PA 2HJBA 4LG8A 4ERZA 4ZOYA 2XL3A 2AGZA 3JB9L 1OLZA 3J81g 2P9LC 4X63B 3BG0A 3PVUB 3I7LA 4GGAA 1SQ9A 2H9PA 3A0FA 2CNXA 3RRMC 3OL2B 3DM0A 4ZOXA 2H68A 1B9XA 3JROA 4GQBB 4H5IA 4E5ZB 3CFSB 2CE8A 3MMYA 2AGWA 5IC7A 2I0SA 4UI9R 2P9UC 1XIPA 3NVQA 4E54B 3PXSD 4O3UB 5JWZA 4GQ2P 4GGCA 2CO0C 1JMZB 5HE2B 5FKQA 2I0TA 3EI1B 4CY3A 4PSXB 4FAND 3SLED 4LGNA 2OJYA 3DSMA 4R7AB 5A2Qg 4CY2A 2XU7A 2HYEA 1Q47A 5C2WB 3F3PA 2IWFA 3ORVD 5FKSA 5FXYA 4X61B 3EI4A 4FAVD 4J0WA 4BH6A 3SVWD 4Y5RD 4A09B 5HQGA 4ZOVA 2HXCA 4J8GA 2IWKA 1FWXA 3P4FA 3I7NA 1A0RB 3IJ1A 4NSXA 5AMSA 1JOFA 3AL8A 2H9MA 5C9ZB 5GSAA 3SBRA 5EMJB 2Z2PA 2OVRB 4U7AA 4FA4D 2PM7B 4G56B 1N6DA 5H14A 5EAPA 4Z8LA 3JPXA 3MKQA 4J73A 4XYHA 4A08B 3JZGA 5FLXg 2AGLA 2BBKH 4KFMB 3OKYA 3N0DA 3ULEC 3RN0D 4J81A 3RFHA 4JSPC 4ERYA 4CZVA 5TDHB 2P9KC 4GM3A 3VA6A 4J86A 4CY1A 1GG2B 3IKOA 2P9IC 2OK4A 3U4YA 5IJ7E 5EM2A 5CXCA 3FM0A 2CN2A 2J56H 2AQ5A 3I7HA 2H6KA 3ODTA 1K32A 3JRPA 4GZ8A 3UVOA 4J8BA 3PSCB 1U4CA 1JJUB 2H9NA 3NVNA 4H5JA 2QC5A 4ERQA 2GC7A 1TYQC 3K26A 3SBPA 2PM9B 3OKWA 2H9LA 2I0RA 5FQDA 3I8CA 4K3ID 3C75H 1XKSA 2B5LA 2BCJB 2HESX 5EMMB 3DXMC 3AFCA 1OMWB 5HE0B 4CI1A 3EI3A 1MG2A 4IMMA 4J77A 4O3TB 4A7JA 5EMLB 5I5JA 4CI3A 2H14A 1SQJA 3GFCA 2YB8B 2AGYA 2HKRA 5FKTA 3SWSD 3EI2A 3OTTA 3AL9A 5GXIA 3EU7A 2YBAA 5EAMA 5IT9g 5SXMA 4PBYA 3UKRC 3IJCA 2UZXB 1QNIA 4CI2A 2GC4A 4A0AA 5FKRA 3I7KA 3AH8B 3MKSB 3PVWB 4A11A 2IUPA 1ERJA 5CXBA 1N6FA 3CFVA 5TEEA 5K1CC 1S4UX 2W18A 2OIZA 2PM6B 1RI6A 4FA5D 4A0BA 3JZNA 3I7OA 1TBGA 4IA9A 3PE7A 5HYNB 3V7DB 2QXVA 4FB1D 4PC0A 5K19A 3DXKC 3N0EA 4QQEA 1B9YA 1PI6A 2P9SC 4JT5C 4MK0B 4A2MA 4YVDA 3I89A 3NVXA 4J0XA 1PGUA 4L9OA 2J57G 4BUJC 4JT6C 2IUVA 3EI4B 3SCYA
chains in the Genus database with same CATH superfamily
2Z2OA 3UVKA 4O1QD 3SN6B 4CI8A 3BG1A 5H1MA 4L1QD 3L4OD 4JSXC 4BCBA 4CZXA 4GM8A 3F3GA 2XL2A 2G99A 4FHLA 5EALA 2VDRA 5FFGA 3AL8B 4OZUA 4GGDA 3KRXB 3FRXA 4CZYA 3RSEC 3K27A 1JV2A 4XEIC 5I5MA 3PXWD 1MG3A 3MZKA 4O02A 5GMKn 5EARA 3SJLD 2JKXA 2CE9A 1SHYB 4GM9A 2OK6A 4K3JB 4ESGA 2UZYB 3SBQA 4BL0A 3OKYB 3RFGA 4HDJA 2P9PC 4Y7RA 4ZOZA 4AOWA 4JD2C 3UVLA 3O4GA 3MUNA 3K71A 3JAMg 1JMXB 1NEXB 3ZWLB 5IGQA 1GOGA 4WJKA 1H2WA 2XDWA 3OL2A 1MDAH 2H3XA 4ZN4A 3F3FA 1PBYB 2TRCB 4AEZA 3EMHA 2H6QA 5CXCB 5EM2B 5M5TA 4E5ZA 4U1EI 1O6FA 3EG6A 1GXRA 1GOTB 2XYIA 4WK0A 3UKUC 3CIKB 4AN1A 1GP2B 4O45A 5AJAA 5EMKB 3V5WB 4A2LA 4IRZA 5KDOB 3NIDA 3VH0A 4JXMA 2YNPA 5IJ8E 5GXHA 3I2NA 4J79A 2Q7QA 4E54A 2HKMA 2AGXA 2VDQA 3IJ0A 3JZHA 4J87A 5HDBA 2VC2A 3EQ9A 3C99A 4L3GD 4JSVC 2P9NC 4J78A 3VGZA 4N14A 2G9AA 4AMYA 3SFZA 4QT8A 1A12A 3I8EA 4D6VA 3EI1A 3UVNA 1GOHA 4FWWA 2VZ1A 3PSLA 4CC9A 4CY5A 3IUJA 4DNWA 3DWLC 1YFQA 3J80g 2GNQA 1QFSA 2IURA 3EI3B 4OWRA 4Z7NA 4FA1D 4JSNC 5H17A 5THAA 2XE4A 2B4EA 4DNVA 3RN1D 5M5UA 4I79A 1NR0A 3ZDZA 1PEVA 3IIYA 4J84A 4TZ4A 4A09A 3OKTA 2YNNA 4G1EA 4QRJA 3T3PA 4PSWB 5FA5B 3O4IA 2O9KA 4WK2A 1M1XA 1VZ2A 5CYKA 1UOOA 4G1MA 3C5MA 3FGBA 3IIWA 4A0AB 2J55H 2CN3A 2YMUA 4UM8A 4D9SA 1QFMA 4LG9A 5TF2A 3E0CA 2B5NA 4J82A 2H13A 2XZGA 2OVQB 1XHMA 4A08A 2EIBA 2I3TA 4A11B 2Z2NA 2B5MA 1N6EA 2IUQA 5CXBB 3C9CA 5I5IA 2H6NA 3GC3B 3NIGA 5AFU3 2CO0A 2VDOA 3MZLA 4A0BB 3BWSA 4PBZA 3HFQA 4MMXA 2PBIB 3PXTD 5B4WA 1GOFA 5E6SA 5TEFA 3SXTD 1U2VC 4GQ1A 5CYKB 1BPOA 3MXXA 1P22A 3OW8A 2QZPA 4O9DA 4PXWA 4X60B 3UVMA 1C9IA 4D0KA 4L3HD 2HU8A 5HE1B 3B7FA 4X3EA 3UR4A 2EBSA 5M5SA 3SMRA 3GREA 1VYHC 3IVMA 2H47A 2MTAH 3KRWB 3RMZD 1L0QA 4O2WA 4PNKB 1K8KC 3W15A 3SHFA 1R5MA 5IGOA 2AH1A 3O4HA 3QHYB 3EWEA 5E6UA 3RLMD 2YNOA 4QL1A 5C92A 3EI2B 2PM9A 3V9FA 2HJ4A 2I3SA 4EWRA 4GMBA 5HE3B 4FA9D 3L4MD 3ZE1A 4ES0A 5C2VB 2AH0A 2IAAA 2OVPB 3MUOA 4XYIA 3I7PA 3V4PA 4QAMA 2HJBA 3VI3A 4LG8A 4ERZA 4ZOYA 2XL3A 2AGZA 3JB9L 3IJEA 1OLZA 3ZE0A 3J81g 2P9LC 4X63B 4DNUA 4AN0A 3BG0A 1UOQA 5FFOA 3PVUB 3I7LA 4BCDA 3NIFA 3QI0A 4GGAA 1SQ9A 2H9PA 3A0FA 4Z7OA 2CNXA 3FCSA 1TYEA 3RRMC 3OL2B 3DM0A 4ZOXA 2H68A 1B9XA 3JROA 3IUNA 4GQBB 4H5IA 4E5ZB 3EQ8A 4WK4A 3CFSB 3IULA 4MMYA 2CE8A 3MMYA 2AGWA 5IC7A 2I0SA 4UI9R 2P9UC 1XIPA 3IURA 3NVQA 4E54B 1O6GA 3PXSD 1YR2A 4NENA 2EIEA 4O3UB 5JWZA 3KCIA 4GQ2P 4GGCA 1JMZB 2CO0C 5HE2B 1VE6A 5FKQA 2I0TA 3EI1B 4CY3A 4PSXB 2BKLA 4FAND 5C86A 3SLED 4LGNA 2OJYA 3DSMA 4R7AB 5A2Qg 4CY2A 2XU7A 2HYEA 1Q47A 5C2WB 3EQ7A 3V4VA 3F3PA 2IWFA 3ORVD 4BCCA 5FKSA 4RE6A 1H2YA 5FXYA 1H2XA 4X61B 3EI4A 4FAVD 3FCUA 4J0WA 4BH6A 3SVWD 4Y5RD 4A09B 5HQGA 4ZOVA 2HXCA 2IWKA 3P4FA 1FWXA 4J8GA 3I7NA 3O4JA 1A0RB 3IJ1A 4NSXA 5AMSA 1JOFA 3AL8A 2H9MA 5C9ZB 5GSAA 3SBRA 5EMJB 2Z2PA 2OVRB 4U7AA 4FA4D 2PM7B 1JTDB 1N6DA 4G56B 4G55A 4RE5A 5H14A 5EAPA 4Z8LA 3JPXA 3MKQA 3ZE2A 4J73A 4XYHA 4NBMA 4A08B 1T2XA 3JZGA 5FLXg 2AGLA 3IUQA 3T3MA 1VE7A 3OF7A 2BBKH 4KFMB 3OKYA 3N0DA 3ULEC 3RN0D 4J81A 3RFHA 4AMZA 4JSPC 4ERYA 4CZVA 5TDHB 2P9KC 4GM3A 3VA6A 4J86A 5E6RA 4CY1A 1GG2B 3IKOA 2P9IC 2WQ8A 2OK4A 3U4YA 5IJ7E 5EM2A 5CXCA 3FM0A 2EICA 2CN2A 2J56H 2AQ5A 2EIDA 3I7HA 2H6KA 3ZDYA 3ODTA 1K32A 3JRPA 4GZ8A 1C9LA 3UVOA 4J8BA 3PSCB 1UOPA 2VDMA 5M5RA 1U4CA 1JJUB 2H9NA 3NVNA 4H5JA 2QC5A 4BP9A 4ERQA 2GC7A 1TYQC 1E8NA 3K26A 3SBPA 5M61A 2PM9B 3OKWA 2H9LA 2I0RA 5FQDA 3I8CA 4K3ID 2QR5A 3C75H 1XKSA 2B5LA 2BCJB 2HESX 4NC4A 5EMMB 3DXMC 3AFCA 3VI4A 1OMWB 5HE0B 4CI1A 3EI3A 1MG2A 4IMMA 4J77A 5M5VA 4O3TB 4A7JA 5EMLB 5I5JA 4CI3A 1I2MB 2H14A 1SQJA 4Z7QA 3GFCA 2YB8B 1E8MA 2AGYA 2HKRA 2VZ3A 5FKTA 3SWSD 3K6SA 3OTTA 3EI2A 3AL9A 5GXIA 3EU7A 2YBAA 5EAMA 5IT9g 5SXMA 4PBYA 3UKRC 3IJCA 2UZXB 3ZDXA 1QNIA 4CI2A 2HU7A 2GC4A 4A0AA 1VZ3A 3IUMA 5FKRA 3MVDK 3I7KA 1K3IA 4NAAA 3AH8B 3MKSB 3PVWB 4A11A 2IUPA 1ERJA 5CXBA 1N6FA 3CFVA 5TEEA 5K1CC 1S4UX 2VDPA 2W18A 2OIZA 1U8CA 2PM6B 1RI6A 2HU5A 4FA5D 4A0BA 3JZNA 3I7OA 1TBGA 4IA9A 3PE7A 5HYNB 3V7DB 4AX4A 2QXVA 4MMZA 4FB1D 1L5GA 2VDNA 4PC0A 5K19A 2VDLA 3DXKC 1H2ZA 3K72A 3N0EA 4QQEA 1B9YA 4BP8A 1PI6A 2P9SC 1UTCA 4JT5C 1E5TA 4MK0B 4UM9A 4A2MA 4YVDA 4JHNA 2VDKA 3I89A 3NVXA 4JHPC 3GD1I 4J0XA 1PGUA 4L9OA 3DDUA 4L1MA 2J57G 4BUJC 4JT6C 2IUVA 3EI4B 3SCYA
chains in the Genus database with same CATH topology
2Z2OA 3UVKA 4O1QD 3SN6B 4CI8A 3BG1A 5H1MA 4L1QD 4JSXC 3L4OD 4CZXA 4GM8A 3F3GA 2XL2A 2G99A 4FHLA 5EALA 3AL8B 4OZUA 4GGDA 3KRXB 3FRXA 4CZYA 3RSEC 3K27A 4XEIC 5I5MA 3PXWD 1MG3A 3MZKA 5GMKn 5EARA 3SJLD 2CE9A 1SHYB 4GM9A 2OK6A 4K3JB 4ESGA 2UZYB 3SBQA 4BL0A 3OKYB 3RFGA 4HDJA 2P9PC 4Y7RA 4ZOZA 4AOWA 4JD2C 3UVLA 3JAMg 1JMXB 1NEXB 3ZWLB 5IGQA 3OL2A 1MDAH 2H3XA 4ZN4A 3F3FA 1PBYB 2TRCB 4AEZA 3EMHA 2H6QA 5CXCB 5EM2B 4E5ZA 4U1EI 3EG6A 1GXRA 1GOTB 2XYIA 3UKUC 3CIKB 1GP2B 4O45A 5AJAA 5EMKB 3V5WB 4A2LA 5KDOB 3VH0A 4JXMA 2YNPA 5IJ8E 5GXHA 3I2NA 4J79A 2Q7QA 4E54A 2HKMA 2AGXA 3IJ0A 3JZHA 4J87A 3C99A 4L3GD 4JSVC 2P9NC 4J78A 3VGZA 4N14A 2G9AA 3SFZA 4QT8A 3I8EA 4D6VA 3EI1A 3UVNA 4FWWA 3PSLA 4CC9A 4CY5A 3DWLC 1YFQA 3J80g 2GNQA 2IURA 3EI3B 4OWRA 4FA1D 4JSNC 5H17A 5THAA 2B4EA 3RN1D 4I79A 1NR0A 1PEVA 3IIYA 4J84A 4TZ4A 4A09A 3OKTA 2YNNA 4QRJA 4PSWB 5FA5B 2O9KA 5CYKA 3C5MA 3FGBA 3IIWA 4A0AB 2J55H 2CN3A 2YMUA 4LG9A 5TF2A 3E0CA 2B5NA 4J82A 2H13A 2OVQB 1XHMA 4A08A 2I3TA 4A11B 2Z2NA 2B5MA 1N6EA 2IUQA 5CXBB 3C9CA 5I5IA 2H6NA 5AFU3 2CO0A 3MZLA 4A0BB 3BWSA 4PBZA 3HFQA 2PBIB 3PXTD 5B4WA 5TEFA 3SXTD 1U2VC 4GQ1A 5CYKB 3MXXA 3OW8A 1P22A 4O9DA 4PXWA 4X60B 3UVMA 4D0KA 4L3HD 5HE1B 3B7FA 4X3EA 3UR4A 2EBSA 3SMRA 3GREA 1VYHC 2H47A 2MTAH 3KRWB 3RMZD 1L0QA 4PNKB 1K8KC 3W15A 3SHFA 1R5MA 5IGOA 2AH1A 3EWEA 3RLMD 2YNOA 4QL1A 3EI2B 2PM9A 3V9FA 2HJ4A 2I3SA 4EWRA 4GMBA 5HE3B 4FA9D 3L4MD 4ES0A 5C2VB 2AH0A 2IAAA 2OVPB 4XYIA 3I7PA 2HJBA 4LG8A 4ERZA 4ZOYA 2XL3A 2AGZA 3JB9L 1OLZA 3J81g 2P9LC 4X63B 3BG0A 3PVUB 3I7LA 4GGAA 1SQ9A 2H9PA 3A0FA 2CNXA 3RRMC 3OL2B 3DM0A 4ZOXA 2H68A 1B9XA 3JROA 4GQBB 4H5IA 4E5ZB 3CFSB 2CE8A 3MMYA 2AGWA 5IC7A 2I0SA 4UI9R 2P9UC 1XIPA 3NVQA 4E54B 3PXSD 4O3UB 5JWZA 4GQ2P 4GGCA 2CO0C 1JMZB 5HE2B 5FKQA 2I0TA 3EI1B 4CY3A 4PSXB 4FAND 3SLED 4LGNA 2OJYA 3DSMA 4R7AB 5A2Qg 4CY2A 2XU7A 2HYEA 1Q47A 5C2WB 3F3PA 2IWFA 3ORVD 5FKSA 5FXYA 4X61B 3EI4A 4FAVD 4J0WA 4BH6A 3SVWD 4Y5RD 4A09B 5HQGA 4ZOVA 2HXCA 4J8GA 2IWKA 1FWXA 3P4FA 3I7NA 1A0RB 3IJ1A 4NSXA 5AMSA 1JOFA 3AL8A 2H9MA 5C9ZB 5GSAA 3SBRA 5EMJB 2Z2PA 2OVRB 4U7AA 4FA4D 2PM7B 4G56B 1N6DA 5H14A 5EAPA 4Z8LA 3JPXA 3MKQA 4J73A 4XYHA 4A08B 3JZGA 5FLXg 2AGLA 2BBKH 4KFMB 3OKYA 3N0DA 3ULEC 3RN0D 4J81A 3RFHA 4JSPC 4ERYA 4CZVA 5TDHB 2P9KC 4GM3A 3VA6A 4J86A 4CY1A 1GG2B 3IKOA 2P9IC 2OK4A 3U4YA 5IJ7E 5EM2A 5CXCA 3FM0A 2CN2A 2J56H 2AQ5A 3I7HA 2H6KA 3ODTA 1K32A 3JRPA 4GZ8A 3UVOA 4J8BA 3PSCB 1U4CA 1JJUB 2H9NA 3NVNA 4H5JA 2QC5A 4ERQA 2GC7A 1TYQC 3K26A 3SBPA 2PM9B 3OKWA 2H9LA 2I0RA 5FQDA 3I8CA 4K3ID 3C75H 1XKSA 2B5LA 2BCJB 2HESX 5EMMB 3DXMC 3AFCA 1OMWB 5HE0B 4CI1A 3EI3A 1MG2A 4IMMA 4J77A 4O3TB 4A7JA 5EMLB 5I5JA 4CI3A 2H14A 1SQJA 3GFCA 2YB8B 2AGYA 2HKRA 5FKTA 3SWSD 3EI2A 3OTTA 3AL9A 5GXIA 3EU7A 2YBAA 5EAMA 5IT9g 5SXMA 4PBYA 3UKRC 3IJCA 2UZXB 1QNIA 4CI2A 2GC4A 4A0AA 5FKRA 3I7KA 3AH8B 3MKSB 3PVWB 4A11A 2IUPA 1ERJA 5CXBA 1N6FA 3CFVA 5TEEA 5K1CC 1S4UX 2W18A 2OIZA 2PM6B 1RI6A 4FA5D 4A0BA 3JZNA 3I7OA 1TBGA 4IA9A 3PE7A 5HYNB 3V7DB 2QXVA 4FB1D 4PC0A 5K19A 3DXKC 3N0EA 4QQEA 1B9YA 1PI6A 2P9SC 4JT5C 4MK0B 4A2MA 4YVDA 3I89A 3NVXA 4J0XA 1PGUA 4L9OA 2J57G 4BUJC 4JT6C 2IUVA 3EI4B 3SCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z2O A;  3UVK A;  4O1Q D;  3SN6 B;  4CI8 A;  3BG1 A;  5H1M A;  4L1Q D;  4JSX C;  3L4O D;  4CZX A;  4GM8 A;  3F3G A;  2XL2 A;  2G99 A;  4FHL A;  5EAL A;  3AL8 B;  4OZU A;  4GGD A;  3KRX B;  3FRX A;  4CZY A;  3RSE C;  3K27 A;  4XEI C;  5I5M A;  3PXW D;  1MG3 A;  3MZK A;  5GMK n;  5EAR A;  3SJL D;  2CE9 A;  1SHY B;  4GM9 A;  2OK6 A;  4K3J B;  4ESG A;  2UZY B;  3SBQ A;  4BL0 A;  3OKY B;  3RFG A;  4HDJ A;  2P9P C;  4Y7R A;  4ZOZ A;  4AOW A;  4JD2 C;  3UVL A;  3JAM g;  1JMX B;  1NEX B;  3ZWL B;  5IGQ A;  3OL2 A;  1MDA H;  2H3X A;  4ZN4 A;  3F3F A;  1PBY B;  2TRC B;  4AEZ A;  3EMH A;  2H6Q A;  5CXC B;  5EM2 B;  4E5Z A;  4U1E I;  3EG6 A;  1GXR A;  1GOT B;  2XYI A;  3UKU C;  3CIK B;  1GP2 B;  4O45 A;  5AJA A;  5EMK B;  3V5W B;  4A2L A;  5KDO B;  3VH0 A;  4JXM A;  2YNP A;  5IJ8 E;  5GXH A;  3I2N A;  4J79 A;  2Q7Q A;  4E54 A;  2HKM A;  2AGX A;  3IJ0 A;  3JZH A;  4J87 A;  3C99 A;  4L3G D;  4JSV C;  2P9N C;  4J78 A;  3VGZ A;  4N14 A;  2G9A A;  3SFZ A;  4QT8 A;  3I8E A;  4D6V A;  3EI1 A;  3UVN A;  4FWW A;  3PSL A;  4CC9 A;  4CY5 A;  3DWL C;  1YFQ A;  3J80 g;  2GNQ A;  2IUR A;  3EI3 B;  4OWR A;  4FA1 D;  4JSN C;  5H17 A;  5THA A;  2B4E A;  3RN1 D;  4I79 A;  1NR0 A;  1PEV A;  3IIY A;  4J84 A;  4TZ4 A;  4A09 A;  3OKT A;  2YNN A;  4QRJ A;  4PSW B;  5FA5 B;  2O9K A;  5CYK A;  3C5M A;  3FGB A;  3IIW A;  4A0A B;  2J55 H;  2CN3 A;  2YMU A;  4LG9 A;  5TF2 A;  3E0C A;  2B5N A;  4J82 A;  2H13 A;  2OVQ B;  1XHM A;  4A08 A;  2I3T A;  4A11 B;  2Z2N A;  2B5M A;  1N6E A;  2IUQ A;  5CXB B;  3C9C A;  5I5I A;  2H6N A;  5AFU 3;  2CO0 A;  3MZL A;  4A0B B;  3BWS A;  4PBZ A;  3HFQ A;  2PBI B;  3PXT D;  5B4W A;  5TEF A;  3SXT D;  1U2V C;  4GQ1 A;  5CYK B;  3MXX A;  3OW8 A;  1P22 A;  4O9D A;  4PXW A;  4X60 B;  3UVM A;  4D0K A;  4L3H D;  5HE1 B;  3B7F A;  4X3E A;  3UR4 A;  2EBS A;  3SMR A;  3GRE A;  1VYH C;  2H47 A;  2MTA H;  3KRW B;  3RMZ D;  1L0Q A;  4PNK B;  1K8K C;  3W15 A;  3SHF A;  1R5M A;  5IGO A;  2AH1 A;  3EWE A;  3RLM D;  2YNO A;  4QL1 A;  3EI2 B;  2PM9 A;  3V9F A;  2HJ4 A;  2I3S A;  4EWR A;  4GMB A;  5HE3 B;  4FA9 D;  3L4M D;  4ES0 A;  5C2V B;  2AH0 A;  2IAA A;  2OVP B;  4XYI A;  3I7P A;  2HJB A;  4LG8 A;  4ERZ A;  4ZOY A;  2XL3 A;  2AGZ A;  3JB9 L;  1OLZ A;  3J81 g;  2P9L C;  4X63 B;  3BG0 A;  3PVU B;  3I7L A;  4GGA A;  1SQ9 A;  2H9P A;  3A0F A;  2CNX A;  3RRM C;  3OL2 B;  3DM0 A;  4ZOX A;  2H68 A;  1B9X A;  3JRO A;  4GQB B;  4H5I A;  4E5Z B;  3CFS B;  2CE8 A;  3MMY A;  2AGW A;  5IC7 A;  2I0S A;  4UI9 R;  2P9U C;  1XIP A;  3NVQ A;  4E54 B;  3PXS D;  4O3U B;  5JWZ A;  4GQ2 P;  4GGC A;  2CO0 C;  1JMZ B;  5HE2 B;  5FKQ A;  2I0T A;  3EI1 B;  4CY3 A;  4PSX B;  4FAN D;  3SLE D;  4LGN A;  2OJY A;  3DSM A;  4R7A B;  5A2Q g;  4CY2 A;  2XU7 A;  2HYE A;  1Q47 A;  5C2W B;  3F3P A;  2IWF A;  3ORV D;  5FKS A;  5FXY A;  4X61 B;  3EI4 A;  4FAV D;  4J0W A;  4BH6 A;  3SVW D;  4Y5R D;  4A09 B;  5HQG A;  4ZOV A;  2HXC A;  4J8G A;  2IWK A;  1FWX A;  3P4F A;  3I7N A;  1A0R B;  3IJ1 A;  4NSX A;  5AMS A;  1JOF A;  3AL8 A;  2H9M A;  5C9Z B;  5GSA A;  3SBR A;  5EMJ B;  2Z2P A;  2OVR B;  4U7A A;  4FA4 D;  2PM7 B;  4G56 B;  1N6D A;  5H14 A;  5EAP A;  4Z8L A;  3JPX A;  3MKQ A;  4J73 A;  4XYH A;  4A08 B;  3JZG A;  5FLX g;  2AGL A;  2BBK H;  4KFM B;  3OKY A;  3N0D A;  3ULE C;  3RN0 D;  4J81 A;  3RFH A;  4JSP C;  4ERY A;  4CZV A;  5TDH B;  2P9K C;  4GM3 A;  3VA6 A;  4J86 A;  4CY1 A;  1GG2 B;  3IKO A;  2P9I C;  2OK4 A;  3U4Y A;  5IJ7 E;  5EM2 A;  5CXC A;  3FM0 A;  2CN2 A;  2J56 H;  2AQ5 A;  3I7H A;  2H6K A;  3ODT A;  1K32 A;  3JRP A;  4GZ8 A;  3UVO A;  4J8B A;  3PSC B;  1U4C A;  1JJU B;  2H9N A;  3NVN A;  4H5J A;  2QC5 A;  4ERQ A;  2GC7 A;  1TYQ C;  3K26 A;  3SBP A;  2PM9 B;  3OKW A;  2H9L A;  2I0R A;  5FQD A;  3I8C A;  4K3I D;  3C75 H;  1XKS A;  2B5L A;  2BCJ B;  2HES X;  5EMM B;  3DXM C;  3AFC A;  1OMW B;  5HE0 B;  4CI1 A;  3EI3 A;  1MG2 A;  4IMM A;  4J77 A;  4O3T B;  4A7J A;  5EML B;  5I5J A;  4CI3 A;  2H14 A;  1SQJ A;  3GFC A;  2YB8 B;  2AGY A;  2HKR A;  5FKT A;  3SWS D;  3EI2 A;  3OTT A;  3AL9 A;  5GXI A;  3EU7 A;  2YBA A;  5EAM A;  5IT9 g;  5SXM A;  4PBY A;  3UKR C;  3IJC A;  2UZX B;  1QNI A;  4CI2 A;  2GC4 A;  4A0A A;  5FKR A;  3I7K A;  3AH8 B;  3MKS B;  3PVW B;  4A11 A;  2IUP A;  1ERJ A;  5CXB A;  1N6F A;  3CFV A;  5TEE A;  5K1C C;  1S4U X;  2W18 A;  2OIZ A;  2PM6 B;  1RI6 A;  4FA5 D;  4A0B A;  3JZN A;  3I7O A;  1TBG A;  4IA9 A;  3PE7 A;  5HYN B;  3V7D B;  2QXV A;  4FB1 D;  4PC0 A;  5K19 A;  3DXK C;  3N0E A;  4QQE A;  1B9Y A;  1PI6 A;  2P9S C;  4JT5 C;  4MK0 B;  4A2M A;  4YVD A;  3I89 A;  3NVX A;  4J0X A;  1PGU A;  4L9O A;  2J57 G;  4BUJ C;  4JT6 C;  2IUV A;  3EI4 B;  3SCY A; 
#chains in the Genus database with same CATH topology
 2Z2O A;  3UVK A;  4O1Q D;  3SN6 B;  4CI8 A;  3BG1 A;  5H1M A;  4L1Q D;  3L4O D;  4JSX C;  4BCB A;  4CZX A;  4GM8 A;  3F3G A;  2XL2 A;  2G99 A;  4FHL A;  5EAL A;  2VDR A;  5FFG A;  3AL8 B;  4OZU A;  4GGD A;  3KRX B;  3FRX A;  4CZY A;  3RSE C;  3K27 A;  1JV2 A;  4XEI C;  5I5M A;  3PXW D;  1MG3 A;  3MZK A;  4O02 A;  5GMK n;  5EAR A;  3SJL D;  2JKX A;  2CE9 A;  1SHY B;  4GM9 A;  2OK6 A;  4K3J B;  4ESG A;  2UZY B;  3SBQ A;  4BL0 A;  3OKY B;  3RFG A;  4HDJ A;  2P9P C;  4Y7R A;  4ZOZ A;  4AOW A;  4JD2 C;  3UVL A;  3O4G A;  3MUN A;  3K71 A;  3JAM g;  1JMX B;  1NEX B;  3ZWL B;  5IGQ A;  1GOG A;  4WJK A;  1H2W A;  2XDW A;  3OL2 A;  1MDA H;  2H3X A;  4ZN4 A;  3F3F A;  1PBY B;  2TRC B;  4AEZ A;  3EMH A;  2H6Q A;  5CXC B;  5EM2 B;  5M5T A;  4E5Z A;  4U1E I;  1O6F A;  3EG6 A;  1GXR A;  1GOT B;  2XYI A;  4WK0 A;  3UKU C;  3CIK B;  4AN1 A;  1GP2 B;  4O45 A;  5AJA A;  5EMK B;  3V5W B;  4A2L A;  4IRZ A;  5KDO B;  3NID A;  3VH0 A;  4JXM A;  2YNP A;  5IJ8 E;  5GXH A;  3I2N A;  4J79 A;  2Q7Q A;  4E54 A;  2HKM A;  2AGX A;  2VDQ A;  3IJ0 A;  3JZH A;  4J87 A;  5HDB A;  2VC2 A;  3EQ9 A;  3C99 A;  4L3G D;  4JSV C;  2P9N C;  4J78 A;  3VGZ A;  4N14 A;  2G9A A;  4AMY A;  3SFZ A;  4QT8 A;  1A12 A;  3I8E A;  4D6V A;  3EI1 A;  3UVN A;  1GOH A;  4FWW A;  2VZ1 A;  3PSL A;  4CC9 A;  4CY5 A;  3IUJ A;  4DNW A;  3DWL C;  1YFQ A;  3J80 g;  2GNQ A;  1QFS A;  2IUR A;  3EI3 B;  4OWR A;  4Z7N A;  4FA1 D;  4JSN C;  5H17 A;  5THA A;  2XE4 A;  2B4E A;  4DNV A;  3RN1 D;  5M5U A;  4I79 A;  1NR0 A;  3ZDZ A;  1PEV A;  3IIY A;  4J84 A;  4TZ4 A;  4A09 A;  3OKT A;  2YNN A;  4G1E A;  4QRJ A;  3T3P A;  4PSW B;  5FA5 B;  3O4I A;  2O9K A;  4WK2 A;  1M1X A;  1VZ2 A;  5CYK A;  1UOO A;  4G1M A;  3C5M A;  3FGB A;  3IIW A;  4A0A B;  2J55 H;  2CN3 A;  2YMU A;  4UM8 A;  4D9S A;  1QFM A;  4LG9 A;  5TF2 A;  3E0C A;  2B5N A;  4J82 A;  2H13 A;  2XZG A;  2OVQ B;  1XHM A;  4A08 A;  2EIB A;  2I3T A;  4A11 B;  2Z2N A;  2B5M A;  1N6E A;  2IUQ A;  5CXB B;  3C9C A;  5I5I A;  2H6N A;  3GC3 B;  3NIG A;  5AFU 3;  2CO0 A;  2VDO A;  3MZL A;  4A0B B;  3BWS A;  4PBZ A;  3HFQ A;  4MMX A;  2PBI B;  3PXT D;  5B4W A;  1GOF A;  5E6S A;  5TEF A;  3SXT D;  1U2V C;  4GQ1 A;  5CYK B;  1BPO A;  3MXX A;  1P22 A;  3OW8 A;  2QZP A;  4O9D A;  4PXW A;  4X60 B;  3UVM A;  1C9I A;  4D0K A;  4L3H D;  2HU8 A;  5HE1 B;  3B7F A;  4X3E A;  3UR4 A;  2EBS A;  5M5S A;  3SMR A;  3GRE A;  1VYH C;  3IVM A;  2H47 A;  2MTA H;  3KRW B;  3RMZ D;  1L0Q A;  4O2W A;  4PNK B;  1K8K C;  3W15 A;  3SHF A;  1R5M A;  5IGO A;  2AH1 A;  3O4H A;  3QHY B;  3EWE A;  5E6U A;  3RLM D;  2YNO A;  4QL1 A;  5C92 A;  3EI2 B;  2PM9 A;  3V9F A;  2HJ4 A;  2I3S A;  4EWR A;  4GMB A;  5HE3 B;  4FA9 D;  3L4M D;  3ZE1 A;  4ES0 A;  5C2V B;  2AH0 A;  2IAA A;  2OVP B;  3MUO A;  4XYI A;  3I7P A;  3V4P A;  4QAM A;  2HJB A;  3VI3 A;  4LG8 A;  4ERZ A;  4ZOY A;  2XL3 A;  2AGZ A;  3JB9 L;  3IJE A;  1OLZ A;  3ZE0 A;  3J81 g;  2P9L C;  4X63 B;  4DNU A;  4AN0 A;  3BG0 A;  1UOQ A;  5FFO A;  3PVU B;  3I7L A;  4BCD A;  3NIF A;  3QI0 A;  4GGA A;  1SQ9 A;  2H9P A;  3A0F A;  4Z7O A;  2CNX A;  3FCS A;  1TYE A;  3RRM C;  3OL2 B;  3DM0 A;  4ZOX A;  2H68 A;  1B9X A;  3JRO A;  3IUN A;  4GQB B;  4H5I A;  4E5Z B;  3EQ8 A;  4WK4 A;  3CFS B;  3IUL A;  4MMY A;  2CE8 A;  3MMY A;  2AGW A;  5IC7 A;  2I0S A;  4UI9 R;  2P9U C;  1XIP A;  3IUR A;  3NVQ A;  4E54 B;  1O6G A;  3PXS D;  1YR2 A;  4NEN A;  2EIE A;  4O3U B;  5JWZ A;  3KCI A;  4GQ2 P;  4GGC A;  1JMZ B;  2CO0 C;  5HE2 B;  1VE6 A;  5FKQ A;  2I0T A;  3EI1 B;  4CY3 A;  4PSX B;  2BKL A;  4FAN D;  5C86 A;  3SLE D;  4LGN A;  2OJY A;  3DSM A;  4R7A B;  5A2Q g;  4CY2 A;  2XU7 A;  2HYE A;  1Q47 A;  5C2W B;  3EQ7 A;  3V4V A;  3F3P A;  2IWF A;  3ORV D;  4BCC A;  5FKS A;  4RE6 A;  1H2Y A;  5FXY A;  1H2X A;  4X61 B;  3EI4 A;  4FAV D;  3FCU A;  4J0W A;  4BH6 A;  3SVW D;  4Y5R D;  4A09 B;  5HQG A;  4ZOV A;  2HXC A;  2IWK A;  3P4F A;  1FWX A;  4J8G A;  3I7N A;  3O4J A;  1A0R B;  3IJ1 A;  4NSX A;  5AMS A;  1JOF A;  3AL8 A;  2H9M A;  5C9Z B;  5GSA A;  3SBR A;  5EMJ B;  2Z2P A;  2OVR B;  4U7A A;  4FA4 D;  2PM7 B;  1JTD B;  1N6D A;  4G56 B;  4G55 A;  4RE5 A;  5H14 A;  5EAP A;  4Z8L A;  3JPX A;  3MKQ A;  3ZE2 A;  4J73 A;  4XYH A;  4NBM A;  4A08 B;  1T2X A;  3JZG A;  5FLX g;  2AGL A;  3IUQ A;  3T3M A;  1VE7 A;  3OF7 A;  2BBK H;  4KFM B;  3OKY A;  3N0D A;  3ULE C;  3RN0 D;  4J81 A;  3RFH A;  4AMZ A;  4JSP C;  4ERY A;  4CZV A;  5TDH B;  2P9K C;  4GM3 A;  3VA6 A;  4J86 A;  5E6R A;  4CY1 A;  1GG2 B;  3IKO A;  2P9I C;  2WQ8 A;  2OK4 A;  3U4Y A;  5IJ7 E;  5EM2 A;  5CXC A;  3FM0 A;  2EIC A;  2CN2 A;  2J56 H;  2AQ5 A;  2EID A;  3I7H A;  2H6K A;  3ZDY A;  3ODT A;  1K32 A;  3JRP A;  4GZ8 A;  1C9L A;  3UVO A;  4J8B A;  3PSC B;  1UOP A;  2VDM A;  5M5R A;  1U4C A;  1JJU B;  2H9N A;  3NVN A;  4H5J A;  2QC5 A;  4BP9 A;  4ERQ A;  2GC7 A;  1TYQ C;  1E8N A;  3K26 A;  3SBP A;  5M61 A;  2PM9 B;  3OKW A;  2H9L A;  2I0R A;  5FQD A;  3I8C A;  4K3I D;  2QR5 A;  3C75 H;  1XKS A;  2B5L A;  2BCJ B;  2HES X;  4NC4 A;  5EMM B;  3DXM C;  3AFC A;  3VI4 A;  1OMW B;  5HE0 B;  4CI1 A;  3EI3 A;  1MG2 A;  4IMM A;  4J77 A;  5M5V A;  4O3T B;  4A7J A;  5EML B;  5I5J A;  4CI3 A;  1I2M B;  2H14 A;  1SQJ A;  4Z7Q A;  3GFC A;  2YB8 B;  1E8M A;  2AGY A;  2HKR A;  2VZ3 A;  5FKT A;  3SWS D;  3K6S A;  3OTT A;  3EI2 A;  3AL9 A;  5GXI A;  3EU7 A;  2YBA A;  5EAM A;  5IT9 g;  5SXM A;  4PBY A;  3UKR C;  3IJC A;  2UZX B;  3ZDX A;  1QNI A;  4CI2 A;  2HU7 A;  2GC4 A;  4A0A A;  1VZ3 A;  3IUM A;  5FKR A;  3MVD K;  3I7K A;  1K3I A;  4NAA A;  3AH8 B;  3MKS B;  3PVW B;  4A11 A;  2IUP A;  1ERJ A;  5CXB A;  1N6F A;  3CFV A;  5TEE A;  5K1C C;  1S4U X;  2VDP A;  2W18 A;  2OIZ A;  1U8C A;  2PM6 B;  1RI6 A;  2HU5 A;  4FA5 D;  4A0B A;  3JZN A;  3I7O A;  1TBG A;  4IA9 A;  3PE7 A;  5HYN B;  3V7D B;  4AX4 A;  2QXV A;  4MMZ A;  4FB1 D;  1L5G A;  2VDN A;  4PC0 A;  5K19 A;  2VDL A;  3DXK C;  1H2Z A;  3K72 A;  3N0E A;  4QQE A;  1B9Y A;  4BP8 A;  1PI6 A;  2P9S C;  1UTC A;  4JT5 C;  1E5T A;  4MK0 B;  4UM9 A;  4A2M A;  4YVD A;  4JHN A;  2VDK A;  3I89 A;  3NVX A;  4JHP C;  3GD1 I;  4J0X A;  1PGU A;  4L9O A;  3DDU A;  4L1M A;  2J57 G;  4BUJ C;  4JT6 C;  2IUV A;  3EI4 B;  3SCY A; 
#chains in the Genus database with same CATH homology
 2Z2O A;  3UVK A;  4O1Q D;  3SN6 B;  4CI8 A;  3BG1 A;  5H1M A;  4L1Q D;  4JSX C;  3L4O D;  4CZX A;  4GM8 A;  3F3G A;  2XL2 A;  2G99 A;  4FHL A;  5EAL A;  3AL8 B;  4OZU A;  4GGD A;  3KRX B;  3FRX A;  4CZY A;  3RSE C;  3K27 A;  4XEI C;  5I5M A;  3PXW D;  1MG3 A;  3MZK A;  5GMK n;  5EAR A;  3SJL D;  2CE9 A;  1SHY B;  4GM9 A;  2OK6 A;  4K3J B;  4ESG A;  2UZY B;  3SBQ A;  4BL0 A;  3OKY B;  3RFG A;  4HDJ A;  2P9P C;  4Y7R A;  4ZOZ A;  4AOW A;  4JD2 C;  3UVL A;  3JAM g;  1JMX B;  1NEX B;  3ZWL B;  5IGQ A;  3OL2 A;  1MDA H;  2H3X A;  4ZN4 A;  3F3F A;  1PBY B;  2TRC B;  4AEZ A;  3EMH A;  2H6Q A;  5CXC B;  5EM2 B;  4E5Z A;  4U1E I;  3EG6 A;  1GXR A;  1GOT B;  2XYI A;  3UKU C;  3CIK B;  1GP2 B;  4O45 A;  5AJA A;  5EMK B;  3V5W B;  4A2L A;  5KDO B;  3VH0 A;  4JXM A;  2YNP A;  5IJ8 E;  5GXH A;  3I2N A;  4J79 A;  2Q7Q A;  4E54 A;  2HKM A;  2AGX A;  3IJ0 A;  3JZH A;  4J87 A;  3C99 A;  4L3G D;  4JSV C;  2P9N C;  4J78 A;  3VGZ A;  4N14 A;  2G9A A;  3SFZ A;  4QT8 A;  3I8E A;  4D6V A;  3EI1 A;  3UVN A;  4FWW A;  3PSL A;  4CC9 A;  4CY5 A;  3DWL C;  1YFQ A;  3J80 g;  2GNQ A;  2IUR A;  3EI3 B;  4OWR A;  4FA1 D;  4JSN C;  5H17 A;  5THA A;  2B4E A;  3RN1 D;  4I79 A;  1NR0 A;  1PEV A;  3IIY A;  4J84 A;  4TZ4 A;  4A09 A;  3OKT A;  2YNN A;  4QRJ A;  4PSW B;  5FA5 B;  2O9K A;  5CYK A;  3C5M A;  3FGB A;  3IIW A;  4A0A B;  2J55 H;  2CN3 A;  2YMU A;  4LG9 A;  5TF2 A;  3E0C A;  2B5N A;  4J82 A;  2H13 A;  2OVQ B;  1XHM A;  4A08 A;  2I3T A;  4A11 B;  2Z2N A;  2B5M A;  1N6E A;  2IUQ A;  5CXB B;  3C9C A;  5I5I A;  2H6N A;  5AFU 3;  2CO0 A;  3MZL A;  4A0B B;  3BWS A;  4PBZ A;  3HFQ A;  2PBI B;  3PXT D;  5B4W A;  5TEF A;  3SXT D;  1U2V C;  4GQ1 A;  5CYK B;  3MXX A;  3OW8 A;  1P22 A;  4O9D A;  4PXW A;  4X60 B;  3UVM A;  4D0K A;  4L3H D;  5HE1 B;  3B7F A;  4X3E A;  3UR4 A;  2EBS A;  3SMR A;  3GRE A;  1VYH C;  2H47 A;  2MTA H;  3KRW B;  3RMZ D;  1L0Q A;  4PNK B;  1K8K C;  3W15 A;  3SHF A;  1R5M A;  5IGO A;  2AH1 A;  3EWE A;  3RLM D;  2YNO A;  4QL1 A;  3EI2 B;  2PM9 A;  3V9F A;  2HJ4 A;  2I3S A;  4EWR A;  4GMB A;  5HE3 B;  4FA9 D;  3L4M D;  4ES0 A;  5C2V B;  2AH0 A;  2IAA A;  2OVP B;  4XYI A;  3I7P A;  2HJB A;  4LG8 A;  4ERZ A;  4ZOY A;  2XL3 A;  2AGZ A;  3JB9 L;  1OLZ A;  3J81 g;  2P9L C;  4X63 B;  3BG0 A;  3PVU B;  3I7L A;  4GGA A;  1SQ9 A;  2H9P A;  3A0F A;  2CNX A;  3RRM C;  3OL2 B;  3DM0 A;  4ZOX A;  2H68 A;  1B9X A;  3JRO A;  4GQB B;  4H5I A;  4E5Z B;  3CFS B;  2CE8 A;  3MMY A;  2AGW A;  5IC7 A;  2I0S A;  4UI9 R;  2P9U C;  1XIP A;  3NVQ A;  4E54 B;  3PXS D;  4O3U B;  5JWZ A;  4GQ2 P;  4GGC A;  2CO0 C;  1JMZ B;  5HE2 B;  5FKQ A;  2I0T A;  3EI1 B;  4CY3 A;  4PSX B;  4FAN D;  3SLE D;  4LGN A;  2OJY A;  3DSM A;  4R7A B;  5A2Q g;  4CY2 A;  2XU7 A;  2HYE A;  1Q47 A;  5C2W B;  3F3P A;  2IWF A;  3ORV D;  5FKS A;  5FXY A;  4X61 B;  3EI4 A;  4FAV D;  4J0W A;  4BH6 A;  3SVW D;  4Y5R D;  4A09 B;  5HQG A;  4ZOV A;  2HXC A;  4J8G A;  2IWK A;  1FWX A;  3P4F A;  3I7N A;  1A0R B;  3IJ1 A;  4NSX A;  5AMS A;  1JOF A;  3AL8 A;  2H9M A;  5C9Z B;  5GSA A;  3SBR A;  5EMJ B;  2Z2P A;  2OVR B;  4U7A A;  4FA4 D;  2PM7 B;  4G56 B;  1N6D A;  5H14 A;  5EAP A;  4Z8L A;  3JPX A;  3MKQ A;  4J73 A;  4XYH A;  4A08 B;  3JZG A;  5FLX g;  2AGL A;  2BBK H;  4KFM B;  3OKY A;  3N0D A;  3ULE C;  3RN0 D;  4J81 A;  3RFH A;  4JSP C;  4ERY A;  4CZV A;  5TDH B;  2P9K C;  4GM3 A;  3VA6 A;  4J86 A;  4CY1 A;  1GG2 B;  3IKO A;  2P9I C;  2OK4 A;  3U4Y A;  5IJ7 E;  5EM2 A;  5CXC A;  3FM0 A;  2CN2 A;  2J56 H;  2AQ5 A;  3I7H A;  2H6K A;  3ODT A;  1K32 A;  3JRP A;  4GZ8 A;  3UVO A;  4J8B A;  3PSC B;  1U4C A;  1JJU B;  2H9N A;  3NVN A;  4H5J A;  2QC5 A;  4ERQ A;  2GC7 A;  1TYQ C;  3K26 A;  3SBP A;  2PM9 B;  3OKW A;  2H9L A;  2I0R A;  5FQD A;  3I8C A;  4K3I D;  3C75 H;  1XKS A;  2B5L A;  2BCJ B;  2HES X;  5EMM B;  3DXM C;  3AFC A;  1OMW B;  5HE0 B;  4CI1 A;  3EI3 A;  1MG2 A;  4IMM A;  4J77 A;  4O3T B;  4A7J A;  5EML B;  5I5J A;  4CI3 A;  2H14 A;  1SQJ A;  3GFC A;  2YB8 B;  2AGY A;  2HKR A;  5FKT A;  3SWS D;  3EI2 A;  3OTT A;  3AL9 A;  5GXI A;  3EU7 A;  2YBA A;  5EAM A;  5IT9 g;  5SXM A;  4PBY A;  3UKR C;  3IJC A;  2UZX B;  1QNI A;  4CI2 A;  2GC4 A;  4A0A A;  5FKR A;  3I7K A;  3AH8 B;  3MKS B;  3PVW B;  4A11 A;  2IUP A;  1ERJ A;  5CXB A;  1N6F A;  3CFV A;  5TEE A;  5K1C C;  1S4U X;  2W18 A;  2OIZ A;  2PM6 B;  1RI6 A;  4FA5 D;  4A0B A;  3JZN A;  3I7O A;  1TBG A;  4IA9 A;  3PE7 A;  5HYN B;  3V7D B;  2QXV A;  4FB1 D;  4PC0 A;  5K19 A;  3DXK C;  3N0E A;  4QQE A;  1B9Y A;  1PI6 A;  2P9S C;  4JT5 C;  4MK0 B;  4A2M A;  4YVD A;  3I89 A;  3NVX A;  4J0X A;  1PGU A;  4L9O A;  2J57 G;  4BUJ C;  4JT6 C;  2IUV A;  3EI4 B;  3SCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...