2Q7QA

Crystal structure of alcaligenes faecalis aadh in complex with p-chlorobenzylamine.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
356
structure length
356
Chain Sequence
VLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords Aralkylamine dehydrogenase light chain
total genus 94
structure length 356
sequence length 356
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2q7qA01
2HKRA 2I0RA 2YB8B 2H9MA 3NVQA 5C2VB 4OZUA 1VYHC 4A7JA 3OKTA 5I5IA 2IURA 5FLXg 3OL2B 3NVXA 3IJCA 1MG3A 4J77A 2P9PC 4CY5A 4ZOYA 4A08B 3V7DB 2OK4A 3UVMA 1OLZA 4IMMA 2YNOA 3OW8A 5CXBA 1SHYB 2P9IC 4D0KA 2B5LA 4JSNC 4XEIC 4J0WA 3AL8B 3N0EA 3JZHA 4O9DA 3RFGA 1OMWB 2BBKH 5GMKn 4GGCA 4PSXB 2J55H 3MZLA 3I89A 4J87A 3SBRA 4A0AB 3EI3A 3VA6A 3L4OD 1MG2A 2Q7QA 4PNKB 3MKQA 5B4WA 1Q47A 1K32A 4J79A 2B5MA 3MXXA 1GG2B 2YNNA 3I7PA 4UI9R 4J78A 3AFCA 4GQ2P 3PE7A 4FHLA 4A09A 4GQ1A 5CXCB 5C9ZB 5FKQA 2AGYA 5IGQA 4E54B 5A2Qg 4PC0A 3V5WB 3GREA 4X60B 4CZXA 3SN6B 2HXCA 2XU7A 3C9CA 5IJ8E 4QL1A 4JD2C 4O3TB 3N0DA 4O1QD 3I7OA 5EAMA 4XYIA 4A2MA 1N6FA 2I0SA 3SLED 5EALA 3J81g 4J8GA 4GM8A 3ZWLB 3FRXA 3MZKA 3PXWD 4O3UB 4Z8LA 3DSMA 1PEVA 4ZOXA 4FA4D 4JSXC 3IIYA 2PBIB 4D6VA 1U4CA 5HE3B 1K8KC 1U2VC 3A0FA 3SHFA 5HQGA 3RMZD 4JSPC 4CZVA 2AGZA 4U7AA 2H6NA 5K19A 3KRWB 5TDHB 5K1CC 2BCJB 4JT6C 2CN2A 5FKTA 4PBYA 1SQ9A 3RSEC 4IA9A 4GGDA 4BUJC 1GOTB 3JZNA 3F3PA 5H17A 4EWRA 3FM0A 3SCYA 4ZOZA 2G99A 3PVUB 3PVWB 2G9AA 1JMXB 5EMKB 3FGBA 3CIKB 3PXSD 4XYHA 3SMRA 3SVWD 1XHMA 4GZ8A 2UZYB 2UZXB 3F3FA 1PBYB 4I79A 3NVNA 5EM2B 3UR4A 2YBAA 4X61B 1FWXA 3EI2B 5GXHA 3AL8A 4X63B 3PXTD 5EM2A 4FWWA 2OVPB 3EG6A 5EMLB 4Y7RA 2PM7B 2QC5A 1NEXB 5HE0B 4R7AB 4AOWA 1L0QA 3CFVA 4ERZA 5TEEA 2OK6A 2B4EA 4X3EA 3JROA 4LG9A 3RN1D 4OWRA 3EI3B 4E54A 4FA9D 3F3GA 4CY3A 4O45A 5H1MA 4FA1D 3I7LA 5I5JA 4ZN4A 2CE9A 1RI6A 1GP2B 3IKOA 4PBZA 2PM9B 3OKYB 4FA5D 1TBGA 2AH0A 1QNIA 3UKUC 5EMMB 2PM6B 3CFSB 4GQBB 3SJLD 1NR0A 3DM0A 4Y5RD 3DXKC 2B5NA 2HKMA 5CXBB 2IUQA 3V9FA 2CNXA 3I8CA 4GM9A 4LG8A 2H14A 4J86A 1P22A 5C2WB 2H9NA 3KRXB 4CZYA 2H6QA 3EI4A 2XYIA 3RFHA 3SBQA 2J57G 5CXCA 5IJ7E 3EI1A 2Z2OA 2PM9A 1PI6A 3ODTA 3ORVD 4GM3A 2OVQB 2OVRB 1XIPA 3HFQA 3UKRC 3JAMg 1MDAH 4ERYA 4CI1A 3DWLC 5EAPA 5GSAA 2IAAA 4L1QD 2P9LC 3UVNA 2J56H 2H9PA 2I0TA 4J81A 2I3SA 4CY2A 4A11A 3UVLA 2AH1A 1B9YA 4K3JB 3EU7A 4ZOVA 4QQEA 5GXIA 3ULEC 3BG0A 3J80g 5IC7A 2W18A 2HYEA 5SXMA 5AJAA 5AMSA 2XL3A 4H5JA 3SFZA 2H13A 1A0RB 4JSVC 1SQJA 2IUPA 4J82A 2CE8A 2P9UC 4NSXA 2P9NC 3EMHA 3E0CA 3PSLA 1XKSA 2XL2A 2AGWA 4U1EI 4K3ID 2GC4A 2H6KA 4AEZA 2GC7A 3EI1B 4CI8A 2HJ4A 4TZ4A 4YVDA 5THAA 2YNPA 5FKRA 3JRPA 4JXMA 4CC9A 3JZGA 4E5ZA 3EI4B 4PXWA 1ERJA 4A2LA 1S4UX 2CO0C 3RLMD 4A0BA 5H14A 3UVOA 1GXRA 5CYKA 3DXMC 5FA5B 2I3TA 5FKSA 4HDJA 5TEFA 5HE2B 3C75H 4E5ZB 2AGLA 3OTTA 4A0BB 4FAND 4CY1A 2OIZA 3EWEA 2QXVA 4L3GD 2IWFA 3I7HA 3L4MD 5EMJB 1R5MA 4A08A 1JJUB 4N14A 3SBPA 1TYQC 1JOFA 4QT8A 1JMZB 2H68A 4A09B 1N6DA 3RN0D 4ES0A 3OKWA 5KDOB 3W15A 2P9KC 5EARA 2O9KA 4GGAA 3IIWA 3BWSA 2CO0A 4QRJA 3AH8B 5HE1B 3RRMC 3SXTD 4GMBA 3K27A 5I5MA 4ESGA 3EI2A 3C5MA 2IUVA 2H3XA 3OKYA 4FB1D 5IGOA 4CI2A 3MMYA 3P4FA 2YMUA 4J73A 5TF2A 4BL0A 5CYKB 2EBSA 3AL9A 3BG1A 4L3HD 4J84A 3MKSB 2IWKA 3I7KA 2TRCB 3U4YA 3VH0A 1YFQA 3I7NA 5FQDA 4PSWB 5JWZA 3JB9L 3GFCA 3B7FA 1PGUA 3I8EA 2HESX 3IJ0A 3K26A 2P9SC 4A0AA 4L9OA 3JPXA 4A11B 5FXYA 4KFMB 1N6EA 2Z2NA 4J8BA 3C99A 3VGZA 4G56B 5AFU3 4J0XA 3UVKA 4ERQA 2AQ5A 2HJBA 2H47A 1B9XA 4JT5C 2OJYA 3SWSD 3I2NA 3OL2A 3IJ1A 5IT9g 4BH6A 4FAVD 2H9LA 2AGXA 2Z2PA 2CN3A 2MTAH 3PSCB 4CI3A 5HYNB 4MK0B 2GNQA 4LGNA 4H5IA
chains in the Genus database with same CATH superfamily
2HKRA 2I0RA 2YB8B 2H9MA 3NVQA 5C2VB 4OZUA 5FFOA 4AMZA 2EIBA 1VYHC 4A7JA 3OKTA 5I5IA 2IURA 5FLXg 4NC4A 3OL2B 3NVXA 3IJCA 4DNWA 1MG3A 4J77A 2P9PC 4CY5A 4ZOYA 2VDMA 3GC3B 4A08B 4MMXA 4AX4A 3T3PA 3V7DB 1H2XA 5E6UA 4H5IA 2OK4A 3UVMA 1OLZA 4AN0A 4AN1A 4IMMA 1VZ3A 2YNOA 1JV2A 2EICA 3OW8A 5CXBA 1E8NA 2VDRA 1SHYB 2P9IC 4D0KA 2B5LA 4JSNC 2HU8A 4XEIC 4J0WA 2VDNA 3AL8B 3N0EA 3JZHA 4O9DA 3RFGA 5M61A 1OMWB 2QZPA 2BBKH 5GMKn 4GGCA 4PSXB 2VZ3A 4DNVA 2J55H 3IJEA 3MZLA 2JKXA 3I89A 4J87A 3SBRA 4A0AB 3GD1I 3EI3A 3VA6A 4IRZA 3L4OD 1MG2A 2Q7QA 4PNKB 4G1EA 3MKQA 5B4WA 1K3IA 1Q47A 1K32A 4RE6A 4J79A 2B5MA 3MXXA 1GG2B 2YNNA 3VI3A 3I7PA 4UI9R 4J78A 3QI0A 3AFCA 3V4PA 3IVMA 4GQ2P 3O4GA 3PE7A 4FHLA 2BKLA 4A09A 4GQ1A 5CXCB 3QHYB 5C9ZB 5FKQA 2AGYA 5IGQA 4E54B 5A2Qg 4BP8A 4PC0A 1UOPA 3V5WB 5E6RA 3GREA 4X60B 4CZXA 3SN6B 2HXCA 2XU7A 3C9CA 5IJ8E 4QL1A 1I2MB 4JD2C 4O3TB 2WQ8A 3N0DA 4O1QD 3I7OA 5EAMA 4XYIA 1C9IA 3VI4A 4A2MA 1N6FA 3IULA 2I0SA 3SLED 5EALA 2EIDA 3J81g 4J8GA 4GM8A 3ZWLB 2HU5A 3FRXA 5HDBA 3MZKA 3PXWD 4O3UB 4Z8LA 3DSMA 1PEVA 4ZOXA 4FA4D 2VDLA 4JSXC 4BCCA 2VC2A 3IIYA 2PBIB 4D6VA 1U4CA 5HE3B 1K8KC 3KCIA 1U2VC 3A0FA 1O6FA 3SHFA 5HQGA 3RMZD 4JSPC 4CZVA 2AGZA 4U7AA 2H6NA 5K19A 3KRWB 5TDHB 5K1CC 2BCJB 4JT6C 2CN2A 5FKTA 4PBYA 1SQ9A 3RSEC 4IA9A 1QFMA 4GGDA 4BUJC 5E6SA 1GOTB 3JZNA 3F3PA 4UM9A 5H17A 4EWRA 3FM0A 3SCYA 4ZOZA 3MVDK 2G99A 3PVUB 3PVWB 2G9AA 1JMXB 5EMKB 3FGBA 3CIKB 3PXSD 4XYHA 3SMRA 3SVWD 1XHMA 4GZ8A 2UZYB 2UZXB 5M5UA 4BCDA 4G1MA 3F3FA 1PBYB 4I79A 3ZDXA 3NVNA 5EM2B 3UR4A 2YBAA 1TYEA 1GOGA 4X61B 1FWXA 4JHPC 3EI2B 3AL8A 5GXHA 4X63B 3PXTD 5EM2A 4FWWA 2OVPB 3EG6A 5EMLB 1O6GA 1L5GA 2PM7B 2QC5A 4Y7RA 1NEXB 5HE0B 4R7AB 4QAMA 4AOWA 1L0QA 3CFVA 4ERZA 5TEEA 2OK6A 1UTCA 2B4EA 4X3EA 3JROA 1VZ2A 4LG9A 2VDKA 3MUOA 3RN1D 4OWRA 3ZDYA 2XE4A 3EI3B 4E54A 4FA9D 3F3GA 4CY3A 3O4JA 4O45A 5H1MA 4FA1D 3I7LA 3EQ9A 3IURA 4Z7QA 5I5JA 4O2WA 4ZN4A 2CE9A 1RI6A 1GP2B 3IKOA 4PBZA 3NIGA 2PM9B 5FFGA 3OKYB 3K71A 4FA5D 1TBGA 2AH0A 1QNIA 3UKUC 5EMMB 2PM6B 3CFSB 4GQBB 3T3MA 1BPOA 3SJLD 1NR0A 1GOFA 3DM0A 3DXKC 4Y5RD 1E8MA 2B5NA 2EIEA 2HKMA 5CXBB 2IUQA 3V9FA 2CNXA 3I8CA 4GM9A 4LG8A 2H14A 4J86A 1P22A 5C2WB 2H9NA 4MMYA 3KRXB 2HU7A 4CZYA 2H6QA 3EI4A 2XYIA 3RFHA 4D9SA 3SBQA 2J57G 5CXCA 5IJ7E 3EI1A 2Z2OA 2PM9A 2XZGA 5C92A 1PI6A 3ODTA 3ORVD 1A12A 4GM3A 2OVQB 2OVRB 1XIPA 3HFQA 3UKRC 3JAMg 4O02A 1MDAH 2QR5A 4ERYA 1VE6A 3DWLC 4CI1A 5EAPA 5GSAA 1GOHA 5M5RA 2IAAA 4L1QD 2P9LC 3UVNA 2J56H 3EQ7A 2H9PA 2I0TA 5M5VA 4J81A 2I3SA 4CY2A 4A11A 3UVLA 2AH1A 1T2XA 4WJKA 4AMYA 1B9YA 4K3JB 1UOOA 3EU7A 4ZOVA 4QQEA 5GXIA 3FCSA 3ULEC 3BG0A 3J80g 5IC7A 2W18A 2HYEA 3IUJA 4WK2A 5AJAA 5AMSA 5SXMA 2XL3A 4H5JA 3SFZA 2H13A 1A0RB 1SQJA 4JSVC 2IUPA 2P9UC 2CE8A 4J82A 4NSXA 2P9NC 3EMHA 1YR2A 3PSLA 3E0CA 1XKSA 2XL2A 2AGWA 4U1EI 4K3ID 3O4HA 4BP9A 2GC4A 2H6KA 4AEZA 2GC7A 3EI1B 4CI8A 2HJ4A 4TZ4A 4YVDA 4L1MA 5THAA 2YNPA 5FKRA 3JRPA 4JXMA 4CC9A 3V4VA 3JZGA 4E5ZA 3EI4B 4PXWA 1ERJA 4A2LA 5M5TA 1S4UX 2CO0C 3K72A 3RLMD 3IUQA 4A0BA 5H14A 3UVOA 1GXRA 4NENA 5CYKA 3DXMC 5FA5B 2I3TA 3NIFA 5FKSA 4HDJA 5TEFA 5HE2B 4NBMA 3C75H 4E5ZB 4G55A 2AGLA 3DDUA 1JTDB 3OTTA 4NAAA 4Z7NA 1H2YA 3NIDA 4A0BB 4WK4A 3OF7A 4FAND 4CY1A 2OIZA 3EWEA 2QXVA 4L3GD 3ZDZA 2IWFA 1VE7A 3K6SA 1C9LA 3I7HA 3L4MD 5EMJB 1R5MA 4A08A 1JJUB 3ZE1A 3FCUA 4N14A 3SBPA 1TYQC 1JOFA 4QT8A 1JMZB 2H68A 4MMZA 4A09B 1N6DA 3RN0D 4ES0A 4RE5A 3OKWA 5KDOB 3W15A 4BCBA 2P9KC 5EARA 2O9KA 4GGAA 3IIWA 3BWSA 2CO0A 4QRJA 3AH8B 5HE1B 3RRMC 3SXTD 2VDOA 3IUNA 4GMBA 3K27A 5I5MA 4ESGA 3EI2A 3IUMA 3C5MA 2IUVA 2XDWA 2H3XA 1UOQA 3OKYA 4FB1D 5M5SA 5IGOA 1E5TA 4CI2A 3MMYA 3P4FA 2YMUA 1H2ZA 4J73A 5TF2A 4BL0A 5CYKB 2EBSA 3AL9A 3BG1A 4L3HD 4J84A 3MKSB 4Z7OA 3ZE2A 2IWKA 3I7KA 2TRCB 4DNUA 3U4YA 3VH0A 1YFQA 3I7NA 5FQDA 4PSWB 5JWZA 3JB9L 3GFCA 3B7FA 1PGUA 3I8EA 2HESX 2VZ1A 3IJ0A 1M1XA 2VDPA 3K26A 3O4IA 2P9SC 4A0AA 4L9OA 3JPXA 2VDQA 4A11B 5FXYA 4KFMB 1QFSA 1U8CA 3ZE0A 1N6EA 2Z2NA 4J8BA 3C99A 3VGZA 4G56B 5AFU3 4J0XA 3UVKA 4ERQA 2AQ5A 2HJBA 2H47A 1B9XA 4JT5C 2OJYA 4UM8A 3SWSD 3I2NA 3OL2A 3MUNA 1H2WA 3IJ1A 5IT9g 4BH6A 4FAVD 2H9LA 2AGXA 2Z2PA 5C86A 2CN3A 2MTAH 4JHNA 3PSCB 4CI3A 4WK0A 5HYNB 4MK0B 2GNQA 4LGNA 3EQ8A
chains in the Genus database with same CATH topology
2HKRA 2I0RA 2YB8B 2H9MA 3NVQA 5C2VB 4OZUA 1VYHC 4A7JA 3OKTA 5I5IA 2IURA 5FLXg 3OL2B 3NVXA 3IJCA 1MG3A 4J77A 2P9PC 4CY5A 4ZOYA 4A08B 3V7DB 2OK4A 3UVMA 1OLZA 4IMMA 2YNOA 3OW8A 5CXBA 1SHYB 2P9IC 4D0KA 2B5LA 4JSNC 4XEIC 4J0WA 3AL8B 3N0EA 3JZHA 4O9DA 3RFGA 1OMWB 2BBKH 5GMKn 4GGCA 4PSXB 2J55H 3MZLA 3I89A 4J87A 3SBRA 4A0AB 3EI3A 3VA6A 3L4OD 1MG2A 2Q7QA 4PNKB 3MKQA 5B4WA 1Q47A 1K32A 4J79A 2B5MA 3MXXA 1GG2B 2YNNA 3I7PA 4UI9R 4J78A 3AFCA 4GQ2P 3PE7A 4FHLA 4A09A 4GQ1A 5CXCB 5C9ZB 5FKQA 2AGYA 5IGQA 4E54B 5A2Qg 4PC0A 3V5WB 3GREA 4X60B 4CZXA 3SN6B 2HXCA 2XU7A 3C9CA 5IJ8E 4QL1A 4JD2C 4O3TB 3N0DA 4O1QD 3I7OA 5EAMA 4XYIA 4A2MA 1N6FA 2I0SA 3SLED 5EALA 3J81g 4J8GA 4GM8A 3ZWLB 3FRXA 3MZKA 3PXWD 4O3UB 4Z8LA 3DSMA 1PEVA 4ZOXA 4FA4D 4JSXC 3IIYA 2PBIB 4D6VA 1U4CA 5HE3B 1K8KC 1U2VC 3A0FA 3SHFA 5HQGA 3RMZD 4JSPC 4CZVA 2AGZA 4U7AA 2H6NA 5K19A 3KRWB 5TDHB 5K1CC 2BCJB 4JT6C 2CN2A 5FKTA 4PBYA 1SQ9A 3RSEC 4IA9A 4GGDA 4BUJC 1GOTB 3JZNA 3F3PA 5H17A 4EWRA 3FM0A 3SCYA 4ZOZA 2G99A 3PVUB 3PVWB 2G9AA 1JMXB 5EMKB 3FGBA 3CIKB 3PXSD 4XYHA 3SMRA 3SVWD 1XHMA 4GZ8A 2UZYB 2UZXB 3F3FA 1PBYB 4I79A 3NVNA 5EM2B 3UR4A 2YBAA 4X61B 1FWXA 3EI2B 5GXHA 3AL8A 4X63B 3PXTD 5EM2A 4FWWA 2OVPB 3EG6A 5EMLB 4Y7RA 2PM7B 2QC5A 1NEXB 5HE0B 4R7AB 4AOWA 1L0QA 3CFVA 4ERZA 5TEEA 2OK6A 2B4EA 4X3EA 3JROA 4LG9A 3RN1D 4OWRA 3EI3B 4E54A 4FA9D 3F3GA 4CY3A 4O45A 5H1MA 4FA1D 3I7LA 5I5JA 4ZN4A 2CE9A 1RI6A 1GP2B 3IKOA 4PBZA 2PM9B 3OKYB 4FA5D 1TBGA 2AH0A 1QNIA 3UKUC 5EMMB 2PM6B 3CFSB 4GQBB 3SJLD 1NR0A 3DM0A 4Y5RD 3DXKC 2B5NA 2HKMA 5CXBB 2IUQA 3V9FA 2CNXA 3I8CA 4GM9A 4LG8A 2H14A 4J86A 1P22A 5C2WB 2H9NA 3KRXB 4CZYA 2H6QA 3EI4A 2XYIA 3RFHA 3SBQA 2J57G 5CXCA 5IJ7E 3EI1A 2Z2OA 2PM9A 1PI6A 3ODTA 3ORVD 4GM3A 2OVQB 2OVRB 1XIPA 3HFQA 3UKRC 3JAMg 1MDAH 4ERYA 4CI1A 3DWLC 5EAPA 5GSAA 2IAAA 4L1QD 2P9LC 3UVNA 2J56H 2H9PA 2I0TA 4J81A 2I3SA 4CY2A 4A11A 3UVLA 2AH1A 1B9YA 4K3JB 3EU7A 4ZOVA 4QQEA 5GXIA 3ULEC 3BG0A 3J80g 5IC7A 2W18A 2HYEA 5SXMA 5AJAA 5AMSA 2XL3A 4H5JA 3SFZA 2H13A 1A0RB 4JSVC 1SQJA 2IUPA 4J82A 2CE8A 2P9UC 4NSXA 2P9NC 3EMHA 3E0CA 3PSLA 1XKSA 2XL2A 2AGWA 4U1EI 4K3ID 2GC4A 2H6KA 4AEZA 2GC7A 3EI1B 4CI8A 2HJ4A 4TZ4A 4YVDA 5THAA 2YNPA 5FKRA 3JRPA 4JXMA 4CC9A 3JZGA 4E5ZA 3EI4B 4PXWA 1ERJA 4A2LA 1S4UX 2CO0C 3RLMD 4A0BA 5H14A 3UVOA 1GXRA 5CYKA 3DXMC 5FA5B 2I3TA 5FKSA 4HDJA 5TEFA 5HE2B 3C75H 4E5ZB 2AGLA 3OTTA 4A0BB 4FAND 4CY1A 2OIZA 3EWEA 2QXVA 4L3GD 2IWFA 3I7HA 3L4MD 5EMJB 1R5MA 4A08A 1JJUB 4N14A 3SBPA 1TYQC 1JOFA 4QT8A 1JMZB 2H68A 4A09B 1N6DA 3RN0D 4ES0A 3OKWA 5KDOB 3W15A 2P9KC 5EARA 2O9KA 4GGAA 3IIWA 3BWSA 2CO0A 4QRJA 3AH8B 5HE1B 3RRMC 3SXTD 4GMBA 3K27A 5I5MA 4ESGA 3EI2A 3C5MA 2IUVA 2H3XA 3OKYA 4FB1D 5IGOA 4CI2A 3MMYA 3P4FA 2YMUA 4J73A 5TF2A 4BL0A 5CYKB 2EBSA 3AL9A 3BG1A 4L3HD 4J84A 3MKSB 2IWKA 3I7KA 2TRCB 3U4YA 3VH0A 1YFQA 3I7NA 5FQDA 4PSWB 5JWZA 3JB9L 3GFCA 3B7FA 1PGUA 3I8EA 2HESX 3IJ0A 3K26A 2P9SC 4A0AA 4L9OA 3JPXA 4A11B 5FXYA 4KFMB 1N6EA 2Z2NA 4J8BA 3C99A 3VGZA 4G56B 5AFU3 4J0XA 3UVKA 4ERQA 2AQ5A 2HJBA 2H47A 1B9XA 4JT5C 2OJYA 3SWSD 3I2NA 3OL2A 3IJ1A 5IT9g 4BH6A 4FAVD 2H9LA 2AGXA 2Z2PA 2CN3A 2MTAH 3PSCB 4CI3A 5HYNB 4MK0B 2GNQA 4LGNA 4H5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKR A;  2I0R A;  2YB8 B;  2H9M A;  3NVQ A;  5C2V B;  4OZU A;  1VYH C;  4A7J A;  3OKT A;  5I5I A;  2IUR A;  5FLX g;  3OL2 B;  3NVX A;  3IJC A;  1MG3 A;  4J77 A;  2P9P C;  4CY5 A;  4ZOY A;  4A08 B;  3V7D B;  2OK4 A;  3UVM A;  1OLZ A;  4IMM A;  2YNO A;  3OW8 A;  5CXB A;  1SHY B;  2P9I C;  4D0K A;  2B5L A;  4JSN C;  4XEI C;  4J0W A;  3AL8 B;  3N0E A;  3JZH A;  4O9D A;  3RFG A;  1OMW B;  2BBK H;  5GMK n;  4GGC A;  4PSX B;  2J55 H;  3MZL A;  3I89 A;  4J87 A;  3SBR A;  4A0A B;  3EI3 A;  3VA6 A;  3L4O D;  1MG2 A;  2Q7Q A;  4PNK B;  3MKQ A;  5B4W A;  1Q47 A;  1K32 A;  4J79 A;  2B5M A;  3MXX A;  1GG2 B;  2YNN A;  3I7P A;  4UI9 R;  4J78 A;  3AFC A;  4GQ2 P;  3PE7 A;  4FHL A;  4A09 A;  4GQ1 A;  5CXC B;  5C9Z B;  5FKQ A;  2AGY A;  5IGQ A;  4E54 B;  5A2Q g;  4PC0 A;  3V5W B;  3GRE A;  4X60 B;  4CZX A;  3SN6 B;  2HXC A;  2XU7 A;  3C9C A;  5IJ8 E;  4QL1 A;  4JD2 C;  4O3T B;  3N0D A;  4O1Q D;  3I7O A;  5EAM A;  4XYI A;  4A2M A;  1N6F A;  2I0S A;  3SLE D;  5EAL A;  3J81 g;  4J8G A;  4GM8 A;  3ZWL B;  3FRX A;  3MZK A;  3PXW D;  4O3U B;  4Z8L A;  3DSM A;  1PEV A;  4ZOX A;  4FA4 D;  4JSX C;  3IIY A;  2PBI B;  4D6V A;  1U4C A;  5HE3 B;  1K8K C;  1U2V C;  3A0F A;  3SHF A;  5HQG A;  3RMZ D;  4JSP C;  4CZV A;  2AGZ A;  4U7A A;  2H6N A;  5K19 A;  3KRW B;  5TDH B;  5K1C C;  2BCJ B;  4JT6 C;  2CN2 A;  5FKT A;  4PBY A;  1SQ9 A;  3RSE C;  4IA9 A;  4GGD A;  4BUJ C;  1GOT B;  3JZN A;  3F3P A;  5H17 A;  4EWR A;  3FM0 A;  3SCY A;  4ZOZ A;  2G99 A;  3PVU B;  3PVW B;  2G9A A;  1JMX B;  5EMK B;  3FGB A;  3CIK B;  3PXS D;  4XYH A;  3SMR A;  3SVW D;  1XHM A;  4GZ8 A;  2UZY B;  2UZX B;  3F3F A;  1PBY B;  4I79 A;  3NVN A;  5EM2 B;  3UR4 A;  2YBA A;  4X61 B;  1FWX A;  3EI2 B;  5GXH A;  3AL8 A;  4X63 B;  3PXT D;  5EM2 A;  4FWW A;  2OVP B;  3EG6 A;  5EML B;  4Y7R A;  2PM7 B;  2QC5 A;  1NEX B;  5HE0 B;  4R7A B;  4AOW A;  1L0Q A;  3CFV A;  4ERZ A;  5TEE A;  2OK6 A;  2B4E A;  4X3E A;  3JRO A;  4LG9 A;  3RN1 D;  4OWR A;  3EI3 B;  4E54 A;  4FA9 D;  3F3G A;  4CY3 A;  4O45 A;  5H1M A;  4FA1 D;  3I7L A;  5I5J A;  4ZN4 A;  2CE9 A;  1RI6 A;  1GP2 B;  3IKO A;  4PBZ A;  2PM9 B;  3OKY B;  4FA5 D;  1TBG A;  2AH0 A;  1QNI A;  3UKU C;  5EMM B;  2PM6 B;  3CFS B;  4GQB B;  3SJL D;  1NR0 A;  3DM0 A;  4Y5R D;  3DXK C;  2B5N A;  2HKM A;  5CXB B;  2IUQ A;  3V9F A;  2CNX A;  3I8C A;  4GM9 A;  4LG8 A;  2H14 A;  4J86 A;  1P22 A;  5C2W B;  2H9N A;  3KRX B;  4CZY A;  2H6Q A;  3EI4 A;  2XYI A;  3RFH A;  3SBQ A;  2J57 G;  5CXC A;  5IJ7 E;  3EI1 A;  2Z2O A;  2PM9 A;  1PI6 A;  3ODT A;  3ORV D;  4GM3 A;  2OVQ B;  2OVR B;  1XIP A;  3HFQ A;  3UKR C;  3JAM g;  1MDA H;  4ERY A;  4CI1 A;  3DWL C;  5EAP A;  5GSA A;  2IAA A;  4L1Q D;  2P9L C;  3UVN A;  2J56 H;  2H9P A;  2I0T A;  4J81 A;  2I3S A;  4CY2 A;  4A11 A;  3UVL A;  2AH1 A;  1B9Y A;  4K3J B;  3EU7 A;  4ZOV A;  4QQE A;  5GXI A;  3ULE C;  3BG0 A;  3J80 g;  5IC7 A;  2W18 A;  2HYE A;  5SXM A;  5AJA A;  5AMS A;  2XL3 A;  4H5J A;  3SFZ A;  2H13 A;  1A0R B;  4JSV C;  1SQJ A;  2IUP A;  4J82 A;  2CE8 A;  2P9U C;  4NSX A;  2P9N C;  3EMH A;  3E0C A;  3PSL A;  1XKS A;  2XL2 A;  2AGW A;  4U1E I;  4K3I D;  2GC4 A;  2H6K A;  4AEZ A;  2GC7 A;  3EI1 B;  4CI8 A;  2HJ4 A;  4TZ4 A;  4YVD A;  5THA A;  2YNP A;  5FKR A;  3JRP A;  4JXM A;  4CC9 A;  3JZG A;  4E5Z A;  3EI4 B;  4PXW A;  1ERJ A;  4A2L A;  1S4U X;  2CO0 C;  3RLM D;  4A0B A;  5H14 A;  3UVO A;  1GXR A;  5CYK A;  3DXM C;  5FA5 B;  2I3T A;  5FKS A;  4HDJ A;  5TEF A;  5HE2 B;  3C75 H;  4E5Z B;  2AGL A;  3OTT A;  4A0B B;  4FAN D;  4CY1 A;  2OIZ A;  3EWE A;  2QXV A;  4L3G D;  2IWF A;  3I7H A;  3L4M D;  5EMJ B;  1R5M A;  4A08 A;  1JJU B;  4N14 A;  3SBP A;  1TYQ C;  1JOF A;  4QT8 A;  1JMZ B;  2H68 A;  4A09 B;  1N6D A;  3RN0 D;  4ES0 A;  3OKW A;  5KDO B;  3W15 A;  2P9K C;  5EAR A;  2O9K A;  4GGA A;  3IIW A;  3BWS A;  2CO0 A;  4QRJ A;  3AH8 B;  5HE1 B;  3RRM C;  3SXT D;  4GMB A;  3K27 A;  5I5M A;  4ESG A;  3EI2 A;  3C5M A;  2IUV A;  2H3X A;  3OKY A;  4FB1 D;  5IGO A;  4CI2 A;  3MMY A;  3P4F A;  2YMU A;  4J73 A;  5TF2 A;  4BL0 A;  5CYK B;  2EBS A;  3AL9 A;  3BG1 A;  4L3H D;  4J84 A;  3MKS B;  2IWK A;  3I7K A;  2TRC B;  3U4Y A;  3VH0 A;  1YFQ A;  3I7N A;  5FQD A;  4PSW B;  5JWZ A;  3JB9 L;  3GFC A;  3B7F A;  1PGU A;  3I8E A;  2HES X;  3IJ0 A;  3K26 A;  2P9S C;  4A0A A;  4L9O A;  3JPX A;  4A11 B;  5FXY A;  4KFM B;  1N6E A;  2Z2N A;  4J8B A;  3C99 A;  3VGZ A;  4G56 B;  5AFU 3;  4J0X A;  3UVK A;  4ERQ A;  2AQ5 A;  2HJB A;  2H47 A;  1B9X A;  4JT5 C;  2OJY A;  3SWS D;  3I2N A;  3OL2 A;  3IJ1 A;  5IT9 g;  4BH6 A;  4FAV D;  2H9L A;  2AGX A;  2Z2P A;  2CN3 A;  2MTA H;  3PSC B;  4CI3 A;  5HYN B;  4MK0 B;  2GNQ A;  4LGN A;  4H5I A; 
#chains in the Genus database with same CATH topology
 2HKR A;  2I0R A;  2YB8 B;  2H9M A;  3NVQ A;  5C2V B;  4OZU A;  5FFO A;  4AMZ A;  2EIB A;  1VYH C;  4A7J A;  3OKT A;  5I5I A;  2IUR A;  5FLX g;  4NC4 A;  3OL2 B;  3NVX A;  3IJC A;  4DNW A;  1MG3 A;  4J77 A;  2P9P C;  4CY5 A;  4ZOY A;  2VDM A;  3GC3 B;  4A08 B;  4MMX A;  4AX4 A;  3T3P A;  3V7D B;  1H2X A;  5E6U A;  4H5I A;  2OK4 A;  3UVM A;  1OLZ A;  4AN0 A;  4AN1 A;  4IMM A;  1VZ3 A;  2YNO A;  1JV2 A;  2EIC A;  3OW8 A;  5CXB A;  1E8N A;  2VDR A;  1SHY B;  2P9I C;  4D0K A;  2B5L A;  4JSN C;  2HU8 A;  4XEI C;  4J0W A;  2VDN A;  3AL8 B;  3N0E A;  3JZH A;  4O9D A;  3RFG A;  5M61 A;  1OMW B;  2QZP A;  2BBK H;  5GMK n;  4GGC A;  4PSX B;  2VZ3 A;  4DNV A;  2J55 H;  3IJE A;  3MZL A;  2JKX A;  3I89 A;  4J87 A;  3SBR A;  4A0A B;  3GD1 I;  3EI3 A;  3VA6 A;  4IRZ A;  3L4O D;  1MG2 A;  2Q7Q A;  4PNK B;  4G1E A;  3MKQ A;  5B4W A;  1K3I A;  1Q47 A;  1K32 A;  4RE6 A;  4J79 A;  2B5M A;  3MXX A;  1GG2 B;  2YNN A;  3VI3 A;  3I7P A;  4UI9 R;  4J78 A;  3QI0 A;  3AFC A;  3V4P A;  3IVM A;  4GQ2 P;  3O4G A;  3PE7 A;  4FHL A;  2BKL A;  4A09 A;  4GQ1 A;  5CXC B;  3QHY B;  5C9Z B;  5FKQ A;  2AGY A;  5IGQ A;  4E54 B;  5A2Q g;  4BP8 A;  4PC0 A;  1UOP A;  3V5W B;  5E6R A;  3GRE A;  4X60 B;  4CZX A;  3SN6 B;  2HXC A;  2XU7 A;  3C9C A;  5IJ8 E;  4QL1 A;  1I2M B;  4JD2 C;  4O3T B;  2WQ8 A;  3N0D A;  4O1Q D;  3I7O A;  5EAM A;  4XYI A;  1C9I A;  3VI4 A;  4A2M A;  1N6F A;  3IUL A;  2I0S A;  3SLE D;  5EAL A;  2EID A;  3J81 g;  4J8G A;  4GM8 A;  3ZWL B;  2HU5 A;  3FRX A;  5HDB A;  3MZK A;  3PXW D;  4O3U B;  4Z8L A;  3DSM A;  1PEV A;  4ZOX A;  4FA4 D;  2VDL A;  4JSX C;  4BCC A;  2VC2 A;  3IIY A;  2PBI B;  4D6V A;  1U4C A;  5HE3 B;  1K8K C;  3KCI A;  1U2V C;  3A0F A;  1O6F A;  3SHF A;  5HQG A;  3RMZ D;  4JSP C;  4CZV A;  2AGZ A;  4U7A A;  2H6N A;  5K19 A;  3KRW B;  5TDH B;  5K1C C;  2BCJ B;  4JT6 C;  2CN2 A;  5FKT A;  4PBY A;  1SQ9 A;  3RSE C;  4IA9 A;  1QFM A;  4GGD A;  4BUJ C;  5E6S A;  1GOT B;  3JZN A;  3F3P A;  4UM9 A;  5H17 A;  4EWR A;  3FM0 A;  3SCY A;  4ZOZ A;  3MVD K;  2G99 A;  3PVU B;  3PVW B;  2G9A A;  1JMX B;  5EMK B;  3FGB A;  3CIK B;  3PXS D;  4XYH A;  3SMR A;  3SVW D;  1XHM A;  4GZ8 A;  2UZY B;  2UZX B;  5M5U A;  4BCD A;  4G1M A;  3F3F A;  1PBY B;  4I79 A;  3ZDX A;  3NVN A;  5EM2 B;  3UR4 A;  2YBA A;  1TYE A;  1GOG A;  4X61 B;  1FWX A;  4JHP C;  3EI2 B;  3AL8 A;  5GXH A;  4X63 B;  3PXT D;  5EM2 A;  4FWW A;  2OVP B;  3EG6 A;  5EML B;  1O6G A;  1L5G A;  2PM7 B;  2QC5 A;  4Y7R A;  1NEX B;  5HE0 B;  4R7A B;  4QAM A;  4AOW A;  1L0Q A;  3CFV A;  4ERZ A;  5TEE A;  2OK6 A;  1UTC A;  2B4E A;  4X3E A;  3JRO A;  1VZ2 A;  4LG9 A;  2VDK A;  3MUO A;  3RN1 D;  4OWR A;  3ZDY A;  2XE4 A;  3EI3 B;  4E54 A;  4FA9 D;  3F3G A;  4CY3 A;  3O4J A;  4O45 A;  5H1M A;  4FA1 D;  3I7L A;  3EQ9 A;  3IUR A;  4Z7Q A;  5I5J A;  4O2W A;  4ZN4 A;  2CE9 A;  1RI6 A;  1GP2 B;  3IKO A;  4PBZ A;  3NIG A;  2PM9 B;  5FFG A;  3OKY B;  3K71 A;  4FA5 D;  1TBG A;  2AH0 A;  1QNI A;  3UKU C;  5EMM B;  2PM6 B;  3CFS B;  4GQB B;  3T3M A;  1BPO A;  3SJL D;  1NR0 A;  1GOF A;  3DM0 A;  3DXK C;  4Y5R D;  1E8M A;  2B5N A;  2EIE A;  2HKM A;  5CXB B;  2IUQ A;  3V9F A;  2CNX A;  3I8C A;  4GM9 A;  4LG8 A;  2H14 A;  4J86 A;  1P22 A;  5C2W B;  2H9N A;  4MMY A;  3KRX B;  2HU7 A;  4CZY A;  2H6Q A;  3EI4 A;  2XYI A;  3RFH A;  4D9S A;  3SBQ A;  2J57 G;  5CXC A;  5IJ7 E;  3EI1 A;  2Z2O A;  2PM9 A;  2XZG A;  5C92 A;  1PI6 A;  3ODT A;  3ORV D;  1A12 A;  4GM3 A;  2OVQ B;  2OVR B;  1XIP A;  3HFQ A;  3UKR C;  3JAM g;  4O02 A;  1MDA H;  2QR5 A;  4ERY A;  1VE6 A;  3DWL C;  4CI1 A;  5EAP A;  5GSA A;  1GOH A;  5M5R A;  2IAA A;  4L1Q D;  2P9L C;  3UVN A;  2J56 H;  3EQ7 A;  2H9P A;  2I0T A;  5M5V A;  4J81 A;  2I3S A;  4CY2 A;  4A11 A;  3UVL A;  2AH1 A;  1T2X A;  4WJK A;  4AMY A;  1B9Y A;  4K3J B;  1UOO A;  3EU7 A;  4ZOV A;  4QQE A;  5GXI A;  3FCS A;  3ULE C;  3BG0 A;  3J80 g;  5IC7 A;  2W18 A;  2HYE A;  3IUJ A;  4WK2 A;  5AJA A;  5AMS A;  5SXM A;  2XL3 A;  4H5J A;  3SFZ A;  2H13 A;  1A0R B;  1SQJ A;  4JSV C;  2IUP A;  2P9U C;  2CE8 A;  4J82 A;  4NSX A;  2P9N C;  3EMH A;  1YR2 A;  3PSL A;  3E0C A;  1XKS A;  2XL2 A;  2AGW A;  4U1E I;  4K3I D;  3O4H A;  4BP9 A;  2GC4 A;  2H6K A;  4AEZ A;  2GC7 A;  3EI1 B;  4CI8 A;  2HJ4 A;  4TZ4 A;  4YVD A;  4L1M A;  5THA A;  2YNP A;  5FKR A;  3JRP A;  4JXM A;  4CC9 A;  3V4V A;  3JZG A;  4E5Z A;  3EI4 B;  4PXW A;  1ERJ A;  4A2L A;  5M5T A;  1S4U X;  2CO0 C;  3K72 A;  3RLM D;  3IUQ A;  4A0B A;  5H14 A;  3UVO A;  1GXR A;  4NEN A;  5CYK A;  3DXM C;  5FA5 B;  2I3T A;  3NIF A;  5FKS A;  4HDJ A;  5TEF A;  5HE2 B;  4NBM A;  3C75 H;  4E5Z B;  4G55 A;  2AGL A;  3DDU A;  1JTD B;  3OTT A;  4NAA A;  4Z7N A;  1H2Y A;  3NID A;  4A0B B;  4WK4 A;  3OF7 A;  4FAN D;  4CY1 A;  2OIZ A;  3EWE A;  2QXV A;  4L3G D;  3ZDZ A;  2IWF A;  1VE7 A;  3K6S A;  1C9L A;  3I7H A;  3L4M D;  5EMJ B;  1R5M A;  4A08 A;  1JJU B;  3ZE1 A;  3FCU A;  4N14 A;  3SBP A;  1TYQ C;  1JOF A;  4QT8 A;  1JMZ B;  2H68 A;  4MMZ A;  4A09 B;  1N6D A;  3RN0 D;  4ES0 A;  4RE5 A;  3OKW A;  5KDO B;  3W15 A;  4BCB A;  2P9K C;  5EAR A;  2O9K A;  4GGA A;  3IIW A;  3BWS A;  2CO0 A;  4QRJ A;  3AH8 B;  5HE1 B;  3RRM C;  3SXT D;  2VDO A;  3IUN A;  4GMB A;  3K27 A;  5I5M A;  4ESG A;  3EI2 A;  3IUM A;  3C5M A;  2IUV A;  2XDW A;  2H3X A;  1UOQ A;  3OKY A;  4FB1 D;  5M5S A;  5IGO A;  1E5T A;  4CI2 A;  3MMY A;  3P4F A;  2YMU A;  1H2Z A;  4J73 A;  5TF2 A;  4BL0 A;  5CYK B;  2EBS A;  3AL9 A;  3BG1 A;  4L3H D;  4J84 A;  3MKS B;  4Z7O A;  3ZE2 A;  2IWK A;  3I7K A;  2TRC B;  4DNU A;  3U4Y A;  3VH0 A;  1YFQ A;  3I7N A;  5FQD A;  4PSW B;  5JWZ A;  3JB9 L;  3GFC A;  3B7F A;  1PGU A;  3I8E A;  2HES X;  2VZ1 A;  3IJ0 A;  1M1X A;  2VDP A;  3K26 A;  3O4I A;  2P9S C;  4A0A A;  4L9O A;  3JPX A;  2VDQ A;  4A11 B;  5FXY A;  4KFM B;  1QFS A;  1U8C A;  3ZE0 A;  1N6E A;  2Z2N A;  4J8B A;  3C99 A;  3VGZ A;  4G56 B;  5AFU 3;  4J0X A;  3UVK A;  4ERQ A;  2AQ5 A;  2HJB A;  2H47 A;  1B9X A;  4JT5 C;  2OJY A;  4UM8 A;  3SWS D;  3I2N A;  3OL2 A;  3MUN A;  1H2W A;  3IJ1 A;  5IT9 g;  4BH6 A;  4FAV D;  2H9L A;  2AGX A;  2Z2P A;  5C86 A;  2CN3 A;  2MTA H;  4JHN A;  3PSC B;  4CI3 A;  4WK0 A;  5HYN B;  4MK0 B;  2GNQ A;  4LGN A;  3EQ8 A; 
#chains in the Genus database with same CATH homology
 2HKR A;  2I0R A;  2YB8 B;  2H9M A;  3NVQ A;  5C2V B;  4OZU A;  1VYH C;  4A7J A;  3OKT A;  5I5I A;  2IUR A;  5FLX g;  3OL2 B;  3NVX A;  3IJC A;  1MG3 A;  4J77 A;  2P9P C;  4CY5 A;  4ZOY A;  4A08 B;  3V7D B;  2OK4 A;  3UVM A;  1OLZ A;  4IMM A;  2YNO A;  3OW8 A;  5CXB A;  1SHY B;  2P9I C;  4D0K A;  2B5L A;  4JSN C;  4XEI C;  4J0W A;  3AL8 B;  3N0E A;  3JZH A;  4O9D A;  3RFG A;  1OMW B;  2BBK H;  5GMK n;  4GGC A;  4PSX B;  2J55 H;  3MZL A;  3I89 A;  4J87 A;  3SBR A;  4A0A B;  3EI3 A;  3VA6 A;  3L4O D;  1MG2 A;  2Q7Q A;  4PNK B;  3MKQ A;  5B4W A;  1Q47 A;  1K32 A;  4J79 A;  2B5M A;  3MXX A;  1GG2 B;  2YNN A;  3I7P A;  4UI9 R;  4J78 A;  3AFC A;  4GQ2 P;  3PE7 A;  4FHL A;  4A09 A;  4GQ1 A;  5CXC B;  5C9Z B;  5FKQ A;  2AGY A;  5IGQ A;  4E54 B;  5A2Q g;  4PC0 A;  3V5W B;  3GRE A;  4X60 B;  4CZX A;  3SN6 B;  2HXC A;  2XU7 A;  3C9C A;  5IJ8 E;  4QL1 A;  4JD2 C;  4O3T B;  3N0D A;  4O1Q D;  3I7O A;  5EAM A;  4XYI A;  4A2M A;  1N6F A;  2I0S A;  3SLE D;  5EAL A;  3J81 g;  4J8G A;  4GM8 A;  3ZWL B;  3FRX A;  3MZK A;  3PXW D;  4O3U B;  4Z8L A;  3DSM A;  1PEV A;  4ZOX A;  4FA4 D;  4JSX C;  3IIY A;  2PBI B;  4D6V A;  1U4C A;  5HE3 B;  1K8K C;  1U2V C;  3A0F A;  3SHF A;  5HQG A;  3RMZ D;  4JSP C;  4CZV A;  2AGZ A;  4U7A A;  2H6N A;  5K19 A;  3KRW B;  5TDH B;  5K1C C;  2BCJ B;  4JT6 C;  2CN2 A;  5FKT A;  4PBY A;  1SQ9 A;  3RSE C;  4IA9 A;  4GGD A;  4BUJ C;  1GOT B;  3JZN A;  3F3P A;  5H17 A;  4EWR A;  3FM0 A;  3SCY A;  4ZOZ A;  2G99 A;  3PVU B;  3PVW B;  2G9A A;  1JMX B;  5EMK B;  3FGB A;  3CIK B;  3PXS D;  4XYH A;  3SMR A;  3SVW D;  1XHM A;  4GZ8 A;  2UZY B;  2UZX B;  3F3F A;  1PBY B;  4I79 A;  3NVN A;  5EM2 B;  3UR4 A;  2YBA A;  4X61 B;  1FWX A;  3EI2 B;  5GXH A;  3AL8 A;  4X63 B;  3PXT D;  5EM2 A;  4FWW A;  2OVP B;  3EG6 A;  5EML B;  4Y7R A;  2PM7 B;  2QC5 A;  1NEX B;  5HE0 B;  4R7A B;  4AOW A;  1L0Q A;  3CFV A;  4ERZ A;  5TEE A;  2OK6 A;  2B4E A;  4X3E A;  3JRO A;  4LG9 A;  3RN1 D;  4OWR A;  3EI3 B;  4E54 A;  4FA9 D;  3F3G A;  4CY3 A;  4O45 A;  5H1M A;  4FA1 D;  3I7L A;  5I5J A;  4ZN4 A;  2CE9 A;  1RI6 A;  1GP2 B;  3IKO A;  4PBZ A;  2PM9 B;  3OKY B;  4FA5 D;  1TBG A;  2AH0 A;  1QNI A;  3UKU C;  5EMM B;  2PM6 B;  3CFS B;  4GQB B;  3SJL D;  1NR0 A;  3DM0 A;  4Y5R D;  3DXK C;  2B5N A;  2HKM A;  5CXB B;  2IUQ A;  3V9F A;  2CNX A;  3I8C A;  4GM9 A;  4LG8 A;  2H14 A;  4J86 A;  1P22 A;  5C2W B;  2H9N A;  3KRX B;  4CZY A;  2H6Q A;  3EI4 A;  2XYI A;  3RFH A;  3SBQ A;  2J57 G;  5CXC A;  5IJ7 E;  3EI1 A;  2Z2O A;  2PM9 A;  1PI6 A;  3ODT A;  3ORV D;  4GM3 A;  2OVQ B;  2OVR B;  1XIP A;  3HFQ A;  3UKR C;  3JAM g;  1MDA H;  4ERY A;  4CI1 A;  3DWL C;  5EAP A;  5GSA A;  2IAA A;  4L1Q D;  2P9L C;  3UVN A;  2J56 H;  2H9P A;  2I0T A;  4J81 A;  2I3S A;  4CY2 A;  4A11 A;  3UVL A;  2AH1 A;  1B9Y A;  4K3J B;  3EU7 A;  4ZOV A;  4QQE A;  5GXI A;  3ULE C;  3BG0 A;  3J80 g;  5IC7 A;  2W18 A;  2HYE A;  5SXM A;  5AJA A;  5AMS A;  2XL3 A;  4H5J A;  3SFZ A;  2H13 A;  1A0R B;  4JSV C;  1SQJ A;  2IUP A;  4J82 A;  2CE8 A;  2P9U C;  4NSX A;  2P9N C;  3EMH A;  3E0C A;  3PSL A;  1XKS A;  2XL2 A;  2AGW A;  4U1E I;  4K3I D;  2GC4 A;  2H6K A;  4AEZ A;  2GC7 A;  3EI1 B;  4CI8 A;  2HJ4 A;  4TZ4 A;  4YVD A;  5THA A;  2YNP A;  5FKR A;  3JRP A;  4JXM A;  4CC9 A;  3JZG A;  4E5Z A;  3EI4 B;  4PXW A;  1ERJ A;  4A2L A;  1S4U X;  2CO0 C;  3RLM D;  4A0B A;  5H14 A;  3UVO A;  1GXR A;  5CYK A;  3DXM C;  5FA5 B;  2I3T A;  5FKS A;  4HDJ A;  5TEF A;  5HE2 B;  3C75 H;  4E5Z B;  2AGL A;  3OTT A;  4A0B B;  4FAN D;  4CY1 A;  2OIZ A;  3EWE A;  2QXV A;  4L3G D;  2IWF A;  3I7H A;  3L4M D;  5EMJ B;  1R5M A;  4A08 A;  1JJU B;  4N14 A;  3SBP A;  1TYQ C;  1JOF A;  4QT8 A;  1JMZ B;  2H68 A;  4A09 B;  1N6D A;  3RN0 D;  4ES0 A;  3OKW A;  5KDO B;  3W15 A;  2P9K C;  5EAR A;  2O9K A;  4GGA A;  3IIW A;  3BWS A;  2CO0 A;  4QRJ A;  3AH8 B;  5HE1 B;  3RRM C;  3SXT D;  4GMB A;  3K27 A;  5I5M A;  4ESG A;  3EI2 A;  3C5M A;  2IUV A;  2H3X A;  3OKY A;  4FB1 D;  5IGO A;  4CI2 A;  3MMY A;  3P4F A;  2YMU A;  4J73 A;  5TF2 A;  4BL0 A;  5CYK B;  2EBS A;  3AL9 A;  3BG1 A;  4L3H D;  4J84 A;  3MKS B;  2IWK A;  3I7K A;  2TRC B;  3U4Y A;  3VH0 A;  1YFQ A;  3I7N A;  5FQD A;  4PSW B;  5JWZ A;  3JB9 L;  3GFC A;  3B7F A;  1PGU A;  3I8E A;  2HES X;  3IJ0 A;  3K26 A;  2P9S C;  4A0A A;  4L9O A;  3JPX A;  4A11 B;  5FXY A;  4KFM B;  1N6E A;  2Z2N A;  4J8B A;  3C99 A;  3VGZ A;  4G56 B;  5AFU 3;  4J0X A;  3UVK A;  4ERQ A;  2AQ5 A;  2HJB A;  2H47 A;  1B9X A;  4JT5 C;  2OJY A;  3SWS D;  3I2N A;  3OL2 A;  3IJ1 A;  5IT9 g;  4BH6 A;  4FAV D;  2H9L A;  2AGX A;  2Z2P A;  2CN3 A;  2MTA H;  3PSC B;  4CI3 A;  5HYN B;  4MK0 B;  2GNQ A;  4LGN A;  4H5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...