3N0DA

Crystal structure of wdr5 mutant (w330f)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
GGQQMGRGSEFVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLFKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title The Effect of Asp-His-Ser/Thr-Trp Tetrad on the Thermostability of WD40-Repeat Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 101
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3n0dA00
4FA5D 5IJ7E 1K8KC 2GNQA 3UVLA 3DXMC 4CI2A 4QT8A 4CY2A 3RRMC 4O9DA 3C99A 3NVXA 4JD2C 3AH8B 4KFMB 2QC5A 3F3PA 4TZ4A 2HKMA 3JRPA 3EI3B 2I3TA 2YNOA 2Z2PA 2OIZA 4CY5A 5IC7A 3I7NA 3JB9L 3PXSD 3K26A 4ERQA 2G99A 4IMMA 5SXMA 4CY1A 3CFSB 5A2Qg 4A08A 4GM9A 4PSWB 3SFZA 2I3SA 3SMRA 3RSEC 4PBYA 2Q7QA 2H9MA 5I5JA 3FM0A 3EI1B 4OZUA 3SBPA 3ODTA 2OK4A 4BL0A 1N6EA 5IGQA 4JSPC 2H6QA 1A0RB 3V7DB 2GC4A 3GFCA 2AQ5A 2OK6A 2CN2A 1NR0A 1U2VC 3RLMD 2MTAH 2PM9B 3EG6A 3DWLC 4PC0A 4CZYA 3CFVA 5K1CC 2H13A 5IJ8E 4H5JA 4CC9A 2GC7A 3UVNA 4ES0A 1QNIA 4I79A 3V5WB 5I5MA 3FGBA 4EWRA 1PBYB 2IUVA 2H3XA 1XKSA 4ZN4A 3I89A 1N6DA 2PBIB 4FB1D 5GMKn 2IUPA 3U4YA 5EAPA 2Z2NA 3JPXA 2XYIA 3MMYA 3C5MA 4AEZA 4A0AB 2CE8A 4CI8A 3VA6A 4IA9A 4A7JA 3OKTA 3BG1A 3I8CA 4GGAA 2AH1A 1OMWB 4JXMA 1NEXB 3EI2A 4GM8A 2W18A 3OL2B 1TBGA 2QXVA 4BUJC 4FWWA 2AGZA 3P4FA 4GMBA 2BCJB 3N0DA 2H68A 4J8BA 3RN1D 1JJUB 3EI4B 4J81A 5CXCB 1GP2B 4Y7RA 2J55H 3OTTA 5EMJB 4J78A 2OVRB 4J79A 1SQ9A 3J81g 3C75H 2B4EA 4ERYA 4CI1A 1P22A 3EI4A 3SBRA 3AL8A 1ERJA 5CXBB 4LGNA 4D6VA 3AFCA 2IWKA 4H5IA 2HXCA 4A11B 1K32A 3DXKC 4N14A 2UZXB 3I7LA 3SHFA 3IJ0A 4A0BB 3VH0A 3MZKA 4J77A 4XYIA 3PE7A 3PVWB 4O45A 3BWSA 3IJ1A 3EU7A 4A09B 1VYHC 4FAVD 3SBQA 2P9NC 1L0QA 3EI3A 2XU7A 3PXTD 4JSVC 4JSNC 1N6FA 4FA1D 4MK0B 4ZOZA 5HE0B 4AOWA 4FHLA 2P9UC 3JROA 1MG2A 3UVKA 5C9ZB 3KRXB 2IURA 3FRXA 5TDHB 2H47A 4J84A 5I5IA 3MKQA 5K19A 2YBAA 4HDJA 4QRJA 4CI3A 4GQBB 5JWZA 3DM0A 3MXXA 3RFHA 3EI1A 3SCYA 5TEFA 4A2LA 5HQGA 2BBKH 3EWEA 3K27A 3IIWA 4QL1A 5C2VB 1GG2B 2CE9A 4X3EA 2J57G 4J8GA 5FXYA 5GXHA 3I8EA 2OVPB 2PM9A 1SHYB 1B9YA 2IAAA 4E54B 3SN6B 2CO0C 4J0XA 2P9SC 5KDOB 3B7FA 3OKYB 3L4OD 3HFQA 4CZXA 2AGLA 4J82A 3GREA 2H14A 4J73A 2CNXA 4XYHA 3IJCA 5H14A 2YB8B 4E5ZB 3CIKB 1YFQA 5FKRA 2I0RA 5CYKB 3I7PA 3N0EA 3OW8A 5EMMB 3VGZA 4X60B 5IT9g 3ZWLB 3I7HA 2HJBA 5FA5B 5HE3B 2CN3A 3PSCB 5GXIA 2HESX 1S4UX 4ZOXA 4Z8LA 5AJAA 1JMZB 2AGYA 1Q47A 3OKWA 4A0AA 1R5MA 3JZGA 1JOFA 2I0TA 5FKQA 5THAA 4L1QD 2TRCB 4O1QD 2XL2A 4J86A 2YMUA 3JZHA 2P9KC 5EM2B 3OL2A 3F3GA 3W15A 1PI6A 4GGCA 2AGXA 3I7OA 2I0SA 4ESGA 4ERZA 4L9OA 4FA9D 4JSXC 3E0CA 4FAND 1XIPA 5H1MA 5GSAA 3F3FA 2B5MA 5CXCA 4L3GD 2AGWA 3ORVD 4X61B 2H6KA 3C9CA 4PSXB 4YVDA 1MG3A 3UVMA 5AMSA 2XL3A 1GOTB 2HJ4A 5H17A 3RMZD 4UI9R 1MDAH 4X63B 4O3UB 4CZVA 3DSMA 4A08B 4ZOVA 5CXBA 3NVNA 4OWRA 2HKRA 4A11A 2YNPA 4L3HD 3AL9A 4A0BA 1JMXB 3RN0D 3RFGA 3UKUC 5TEEA 4XEIC 3UKRC 2OVQB 3MZLA 4A09A 5C2WB 4LG8A 2P9IC 4QQEA 1B9XA 2O9KA 2OJYA 5HE2B 1RI6A 3PSLA 3IKOA 4JT5C 2EBSA 3EMHA 4NSXA 4J87A 4U1EI 3SLED 2YNNA 5EMLB 2P9PC 5FKSA 3I7KA 1XHMA 5HE1B 4O3TB 1GXRA 1TYQC 4GM3A 3SWSD 3A0FA 5HYNB 2Z2OA 1PEVA 4LG9A 4GQ1A 3SXTD 5EMKB 5EARA 2CO0A 4PBZA 4PNKB 3SVWD 4E54A 4Y5RD 2PM6B 1OLZA 5TF2A 2P9LC 3OKYA 4ZOYA 5FKTA 4FA4D 2H9LA 3KRWB 3EI2B 4E5ZA 3PXWD 5FLXg 3PVUB 3MKSB 4PXWA 2J56H 5CYKA 2AH0A 2H9NA 4D0KA 5EALA 4GZ8A 4U7AA 2PM7B 2IWFA 4K3ID 1U4CA 4K3JB 3V9FA 3BG0A 2IUQA 1PGUA 3J80g 3UVOA 3JAMg 4J0WA 4BH6A 1SQJA 4R7AB 3ULEC 4A2MA 2UZYB 5AFU3 3UR4A 3JZNA 5FQDA 3IIYA 5B4WA 2H6NA 3NVQA 4GQ2P 2HYEA 4GGDA 3L4MD 1FWXA 2G9AA 4CY3A 2B5NA 2B5LA 4G56B 3I2NA 5EAMA 5EM2A 3AL8B 3SJLD 2H9PA 5IGOA 4JT6C
chains in the Genus database with same CATH superfamily
1K3IA 4FA5D 5IJ7E 3K6SA 1K8KC 2GNQA 3UVLA 3DXMC 4CI2A 4QT8A 4CY2A 3RRMC 4O9DA 3C99A 1E8MA 3NVXA 4JD2C 4AN1A 3AH8B 2VDQA 4KFMB 2QC5A 3F3PA 4TZ4A 2HKMA 3JRPA 3EI3B 4RE5A 2I3TA 4BP9A 4AN0A 2YNOA 2Z2PA 2OIZA 3IURA 4CY5A 5IC7A 3I7NA 2VDPA 3JB9L 3PXSD 3K26A 3ZE2A 3IUNA 5M5RA 4ERQA 2G99A 4DNVA 4IMMA 1A12A 5SXMA 3CFSB 4CY1A 5A2Qg 4A08A 1O6FA 4GM9A 4PSWB 3SFZA 2I3SA 3SMRA 1H2YA 2XDWA 4PBYA 3RSEC 2Q7QA 4O2WA 2H9MA 5I5JA 5E6RA 1QFSA 3FM0A 3EI1B 1BPOA 4OZUA 3SBPA 3ODTA 2OK4A 4BL0A 3QHYB 1N6EA 3IUJA 5IGQA 4JSPC 2H6QA 1GOGA 1A0RB 3V7DB 2GC4A 3GFCA 2EIDA 2AQ5A 2OK6A 2CN2A 1NR0A 2VDKA 3IUQA 1U2VC 3RLMD 2MTAH 2PM9B 3EG6A 3DWLC 4PC0A 4CZYA 3CFVA 5K1CC 2H13A 5IJ8E 4H5JA 4AMYA 4CC9A 2GC7A 3UVNA 5E6UA 4ES0A 1QNIA 4I79A 3V5WB 5I5MA 3FGBA 4EWRA 1PBYB 2IUVA 1H2WA 2H3XA 1XKSA 4ZN4A 3I89A 4IRZA 1N6DA 4MMZA 5E6SA 2PBIB 4FB1D 3EQ8A 5GMKn 2IUPA 3U4YA 5EAPA 2Z2NA 4BCDA 4MMXA 3ZE1A 3EQ9A 4G55A 3MUOA 5M5VA 3JPXA 2XYIA 3MMYA 3C5MA 4AEZA 5M61A 4A0AB 2CE8A 4CI8A 3VA6A 4IA9A 4A7JA 3MVDK 3OKTA 3BG1A 3I8CA 2JKXA 2AH1A 4GGAA 1OMWB 3K72A 4JXMA 1NEXB 4Z7OA 3EI2A 1L5GA 4DNWA 2VDNA 2QR5A 2W18A 4GM8A 3OL2B 1TBGA 2QXVA 4BUJC 4FWWA 2AGZA 3P4FA 3IUMA 4NAAA 4GMBA 2BCJB 3N0DA 2H68A 2XZGA 4J8BA 3RN1D 4O02A 1JJUB 1O6GA 4DNUA 1C9LA 3EI4B 4J81A 5CXCB 1GP2B 4Y7RA 2J55H 3OTTA 5EMJB 3ZDXA 4J78A 2OVRB 4NBMA 4J79A 3DDUA 1SQ9A 3J81g 3C75H 2B4EA 4ERYA 4CI1A 1P22A 3EI4A 3SBRA 3AL8A 1ERJA 5CXBB 4LGNA 2VDOA 4D6VA 3O4GA 3AFCA 2IWKA 4H5IA 2HXCA 4A11B 1K32A 3DXKC 1QFMA 4N14A 2UZXB 3I7LA 3SHFA 3IJ0A 4A0BB 1UTCA 3VH0A 3MZKA 4J77A 4XYIA 3T3PA 3PE7A 3PVWB 4O45A 3BWSA 3IJ1A 3EU7A 5M5TA 4A09B 1H2ZA 1VYHC 4FAVD 3SBQA 2P9NC 1L0QA 3EI3A 5FFOA 2XU7A 3PXTD 4JSVC 4JSNC 1N6FA 4FA1D 4MK0B 4ZOZA 5HE0B 4AOWA 3ZDZA 4FHLA 2P9UC 3JROA 1MG2A 3UVKA 5C9ZB 3KRXB 2IURA 3O4JA 3FRXA 5TDHB 2H47A 4J84A 5I5IA 3MKQA 4JHNA 2YBAA 4HDJA 4QRJA 4CI3A 4GQBB 5K19A 5JWZA 3DM0A 1UOOA 1VZ3A 3MXXA 3RFHA 3EI1A 3SCYA 4Z7QA 4WK2A 5TEFA 4A2LA 5HQGA 2BBKH 3EWEA 3K27A 3IIWA 3ZE0A 4QL1A 5C2VB 1GG2B 2CE9A 4G1EA 4X3EA 2J57G 4J8GA 5FXYA 5GXHA 1JTDB 1U8CA 3I8EA 2OVPB 2PM9A 3IULA 1SHYB 1B9YA 2IAAA 3VI4A 4E54B 3SN6B 2CO0C 4J0XA 2P9SC 1C9IA 5KDOB 3B7FA 3OKYB 3KCIA 3L4OD 3HFQA 1VE6A 3O4IA 4CZXA 2AGLA 4J82A 3GREA 2H14A 4J73A 2CNXA 4XYHA 3IJCA 4WJKA 5H14A 2YB8B 4E5ZB 3CIKB 1YFQA 1E5TA 2XE4A 5FKRA 2I0RA 5CYKB 3FCSA 3I7PA 3N0EA 3OW8A 5EMMB 1VZ2A 2VC2A 3VGZA 4X60B 3IJEA 5IT9g 3ZWLB 4MMYA 3I7HA 2HJBA 5FA5B 5HE3B 4AX4A 2CN3A 5C92A 3PSCB 5GXIA 2HESX 1S4UX 4ZOXA 4Z8LA 5AJAA 1JMZB 2AGYA 1Q47A 3OKWA 4A0AA 5M5UA 2WQ8A 1UOPA 1R5MA 3JZGA 3IVMA 1JOFA 2I0TA 5FKQA 5THAA 4L1QD 2TRCB 4O1QD 2XL2A 2VDRA 3FCUA 2YMUA 4J86A 3JZHA 2P9KC 5EM2B 3OL2A 5C86A 3F3GA 3VI3A 3W15A 1PI6A 4GGCA 2AGXA 3I7OA 2I0SA 1GOFA 2BKLA 4ESGA 4ERZA 4L9OA 4FA9D 4JSXC 3E0CA 4FAND 3GC3B 2EIEA 1XIPA 5H1MA 2VZ3A 5GSAA 3F3FA 2B5MA 5CXCA 2VZ1A 4L3GD 4UM9A 2AGWA 3O4HA 3ORVD 4X61B 5M5SA 2H6KA 3C9CA 4PSXB 4YVDA 1MG3A 4WK0A 3UVMA 5AMSA 2XL3A 1GOTB 2HJ4A 5H17A 4RE6A 3RMZD 4UI9R 1MDAH 4X63B 4O3UB 5FFGA 4CZVA 3DSMA 4A08B 4ZOVA 5HDBA 5CXBA 4UM8A 3NVNA 4OWRA 2QZPA 2HKRA 4A11A 3ZDYA 2YNPA 4L3HD 3AL9A 4A0BA 1JMXB 4Z7NA 3RN0D 3RFGA 3UKUC 5TEEA 4XEIC 3UKRC 2OVQB 3MZLA 4A09A 2EICA 5C2WB 4LG8A 4BCBA 2P9IC 3K71A 4QQEA 1YR2A 1B9XA 1GOHA 2HU5A 3NIGA 2O9KA 1TYEA 2OJYA 5HE2B 1RI6A 4NC4A 3PSLA 3IKOA 4BP8A 4JT5C 2EBSA 2HU7A 3EMHA 4NSXA 4J87A 4U1EI 3QI0A 3SLED 4D9SA 2YNNA 4JHPC 5EMLB 2P9PC 5FKSA 4NENA 3I7KA 1XHMA 5HE1B 4O3TB 1I2MB 1GXRA 3GD1I 1TYQC 4GM3A 3SWSD 1H2XA 2VDLA 3A0FA 5HYNB 4QAMA 1M1XA 3NIFA 2Z2OA 1PEVA 4LG9A 4GQ1A 4WK4A 3SXTD 5EMKB 3V4PA 5EARA 2CO0A 1T2XA 4PBZA 4PNKB 3SVWD 4E54A 4Y5RD 2PM6B 1OLZA 5TF2A 2P9LC 3OKYA 1JV2A 5FKTA 4ZOYA 4BCCA 4FA4D 2H9LA 3NIDA 4L1MA 3KRWB 3EI2B 4E5ZA 3PXWD 5FLXg 1UOQA 3PVUB 3MKSB 4PXWA 2J56H 5CYKA 2AH0A 2H9NA 4D0KA 5EALA 4GZ8A 1E8NA 4U7AA 2PM7B 2IWFA 4K3ID 1U4CA 4K3JB 3EQ7A 3BG0A 3V9FA 2IUQA 3OF7A 1PGUA 4AMZA 3J80g 3UVOA 2HU8A 3JAMg 4J0WA 3MUNA 4BH6A 1SQJA 3T3MA 4R7AB 3ULEC 4A2MA 2UZYB 5AFU3 3UR4A 3JZNA 5FQDA 3IIYA 5B4WA 3V4VA 2H6NA 3NVQA 4GQ2P 1VE7A 2HYEA 4G1MA 4GGDA 3L4MD 1FWXA 2G9AA 4CY3A 2B5NA 2B5LA 2VDMA 4G56B 3I2NA 5EAMA 5EM2A 3AL8B 3SJLD 2H9PA 5IGOA 4JT6C 2EIBA
chains in the Genus database with same CATH topology
4FA5D 5IJ7E 1K8KC 2GNQA 3UVLA 3DXMC 4CI2A 4QT8A 4CY2A 3RRMC 4O9DA 3C99A 3NVXA 4JD2C 3AH8B 4KFMB 2QC5A 3F3PA 4TZ4A 2HKMA 3JRPA 3EI3B 2I3TA 2YNOA 2Z2PA 2OIZA 4CY5A 5IC7A 3I7NA 3JB9L 3PXSD 3K26A 4ERQA 2G99A 4IMMA 5SXMA 4CY1A 3CFSB 5A2Qg 4A08A 4GM9A 4PSWB 3SFZA 2I3SA 3SMRA 3RSEC 4PBYA 2Q7QA 2H9MA 5I5JA 3FM0A 3EI1B 4OZUA 3SBPA 3ODTA 2OK4A 4BL0A 1N6EA 5IGQA 4JSPC 2H6QA 1A0RB 3V7DB 2GC4A 3GFCA 2AQ5A 2OK6A 2CN2A 1NR0A 1U2VC 3RLMD 2MTAH 2PM9B 3EG6A 3DWLC 4PC0A 4CZYA 3CFVA 5K1CC 2H13A 5IJ8E 4H5JA 4CC9A 2GC7A 3UVNA 4ES0A 1QNIA 4I79A 3V5WB 5I5MA 3FGBA 4EWRA 1PBYB 2IUVA 2H3XA 1XKSA 4ZN4A 3I89A 1N6DA 2PBIB 4FB1D 5GMKn 2IUPA 3U4YA 5EAPA 2Z2NA 3JPXA 2XYIA 3MMYA 3C5MA 4AEZA 4A0AB 2CE8A 4CI8A 3VA6A 4IA9A 4A7JA 3OKTA 3BG1A 3I8CA 4GGAA 2AH1A 1OMWB 4JXMA 1NEXB 3EI2A 4GM8A 2W18A 3OL2B 1TBGA 2QXVA 4BUJC 4FWWA 2AGZA 3P4FA 4GMBA 2BCJB 3N0DA 2H68A 4J8BA 3RN1D 1JJUB 3EI4B 4J81A 5CXCB 1GP2B 4Y7RA 2J55H 3OTTA 5EMJB 4J78A 2OVRB 4J79A 1SQ9A 3J81g 3C75H 2B4EA 4ERYA 4CI1A 1P22A 3EI4A 3SBRA 3AL8A 1ERJA 5CXBB 4LGNA 4D6VA 3AFCA 2IWKA 4H5IA 2HXCA 4A11B 1K32A 3DXKC 4N14A 2UZXB 3I7LA 3SHFA 3IJ0A 4A0BB 3VH0A 3MZKA 4J77A 4XYIA 3PE7A 3PVWB 4O45A 3BWSA 3IJ1A 3EU7A 4A09B 1VYHC 4FAVD 3SBQA 2P9NC 1L0QA 3EI3A 2XU7A 3PXTD 4JSVC 4JSNC 1N6FA 4FA1D 4MK0B 4ZOZA 5HE0B 4AOWA 4FHLA 2P9UC 3JROA 1MG2A 3UVKA 5C9ZB 3KRXB 2IURA 3FRXA 5TDHB 2H47A 4J84A 5I5IA 3MKQA 5K19A 2YBAA 4HDJA 4QRJA 4CI3A 4GQBB 5JWZA 3DM0A 3MXXA 3RFHA 3EI1A 3SCYA 5TEFA 4A2LA 5HQGA 2BBKH 3EWEA 3K27A 3IIWA 4QL1A 5C2VB 1GG2B 2CE9A 4X3EA 2J57G 4J8GA 5FXYA 5GXHA 3I8EA 2OVPB 2PM9A 1SHYB 1B9YA 2IAAA 4E54B 3SN6B 2CO0C 4J0XA 2P9SC 5KDOB 3B7FA 3OKYB 3L4OD 3HFQA 4CZXA 2AGLA 4J82A 3GREA 2H14A 4J73A 2CNXA 4XYHA 3IJCA 5H14A 2YB8B 4E5ZB 3CIKB 1YFQA 5FKRA 2I0RA 5CYKB 3I7PA 3N0EA 3OW8A 5EMMB 3VGZA 4X60B 5IT9g 3ZWLB 3I7HA 2HJBA 5FA5B 5HE3B 2CN3A 3PSCB 5GXIA 2HESX 1S4UX 4ZOXA 4Z8LA 5AJAA 1JMZB 2AGYA 1Q47A 3OKWA 4A0AA 1R5MA 3JZGA 1JOFA 2I0TA 5FKQA 5THAA 4L1QD 2TRCB 4O1QD 2XL2A 4J86A 2YMUA 3JZHA 2P9KC 5EM2B 3OL2A 3F3GA 3W15A 1PI6A 4GGCA 2AGXA 3I7OA 2I0SA 4ESGA 4ERZA 4L9OA 4FA9D 4JSXC 3E0CA 4FAND 1XIPA 5H1MA 5GSAA 3F3FA 2B5MA 5CXCA 4L3GD 2AGWA 3ORVD 4X61B 2H6KA 3C9CA 4PSXB 4YVDA 1MG3A 3UVMA 5AMSA 2XL3A 1GOTB 2HJ4A 5H17A 3RMZD 4UI9R 1MDAH 4X63B 4O3UB 4CZVA 3DSMA 4A08B 4ZOVA 5CXBA 3NVNA 4OWRA 2HKRA 4A11A 2YNPA 4L3HD 3AL9A 4A0BA 1JMXB 3RN0D 3RFGA 3UKUC 5TEEA 4XEIC 3UKRC 2OVQB 3MZLA 4A09A 5C2WB 4LG8A 2P9IC 4QQEA 1B9XA 2O9KA 2OJYA 5HE2B 1RI6A 3PSLA 3IKOA 4JT5C 2EBSA 3EMHA 4NSXA 4J87A 4U1EI 3SLED 2YNNA 5EMLB 2P9PC 5FKSA 3I7KA 1XHMA 5HE1B 4O3TB 1GXRA 1TYQC 4GM3A 3SWSD 3A0FA 5HYNB 2Z2OA 1PEVA 4LG9A 4GQ1A 3SXTD 5EMKB 5EARA 2CO0A 4PBZA 4PNKB 3SVWD 4E54A 4Y5RD 2PM6B 1OLZA 5TF2A 2P9LC 3OKYA 4ZOYA 5FKTA 4FA4D 2H9LA 3KRWB 3EI2B 4E5ZA 3PXWD 5FLXg 3PVUB 3MKSB 4PXWA 2J56H 5CYKA 2AH0A 2H9NA 4D0KA 5EALA 4GZ8A 4U7AA 2PM7B 2IWFA 4K3ID 1U4CA 4K3JB 3V9FA 3BG0A 2IUQA 1PGUA 3J80g 3UVOA 3JAMg 4J0WA 4BH6A 1SQJA 4R7AB 3ULEC 4A2MA 2UZYB 5AFU3 3UR4A 3JZNA 5FQDA 3IIYA 5B4WA 2H6NA 3NVQA 4GQ2P 2HYEA 4GGDA 3L4MD 1FWXA 2G9AA 4CY3A 2B5NA 2B5LA 4G56B 3I2NA 5EAMA 5EM2A 3AL8B 3SJLD 2H9PA 5IGOA 4JT6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA5 D;  5IJ7 E;  1K8K C;  2GNQ A;  3UVL A;  3DXM C;  4CI2 A;  4QT8 A;  4CY2 A;  3RRM C;  4O9D A;  3C99 A;  3NVX A;  4JD2 C;  3AH8 B;  4KFM B;  2QC5 A;  3F3P A;  4TZ4 A;  2HKM A;  3JRP A;  3EI3 B;  2I3T A;  2YNO A;  2Z2P A;  2OIZ A;  4CY5 A;  5IC7 A;  3I7N A;  3JB9 L;  3PXS D;  3K26 A;  4ERQ A;  2G99 A;  4IMM A;  5SXM A;  4CY1 A;  3CFS B;  5A2Q g;  4A08 A;  4GM9 A;  4PSW B;  3SFZ A;  2I3S A;  3SMR A;  3RSE C;  4PBY A;  2Q7Q A;  2H9M A;  5I5J A;  3FM0 A;  3EI1 B;  4OZU A;  3SBP A;  3ODT A;  2OK4 A;  4BL0 A;  1N6E A;  5IGQ A;  4JSP C;  2H6Q A;  1A0R B;  3V7D B;  2GC4 A;  3GFC A;  2AQ5 A;  2OK6 A;  2CN2 A;  1NR0 A;  1U2V C;  3RLM D;  2MTA H;  2PM9 B;  3EG6 A;  3DWL C;  4PC0 A;  4CZY A;  3CFV A;  5K1C C;  2H13 A;  5IJ8 E;  4H5J A;  4CC9 A;  2GC7 A;  3UVN A;  4ES0 A;  1QNI A;  4I79 A;  3V5W B;  5I5M A;  3FGB A;  4EWR A;  1PBY B;  2IUV A;  2H3X A;  1XKS A;  4ZN4 A;  3I89 A;  1N6D A;  2PBI B;  4FB1 D;  5GMK n;  2IUP A;  3U4Y A;  5EAP A;  2Z2N A;  3JPX A;  2XYI A;  3MMY A;  3C5M A;  4AEZ A;  4A0A B;  2CE8 A;  4CI8 A;  3VA6 A;  4IA9 A;  4A7J A;  3OKT A;  3BG1 A;  3I8C A;  4GGA A;  2AH1 A;  1OMW B;  4JXM A;  1NEX B;  3EI2 A;  4GM8 A;  2W18 A;  3OL2 B;  1TBG A;  2QXV A;  4BUJ C;  4FWW A;  2AGZ A;  3P4F A;  4GMB A;  2BCJ B;  3N0D A;  2H68 A;  4J8B A;  3RN1 D;  1JJU B;  3EI4 B;  4J81 A;  5CXC B;  1GP2 B;  4Y7R A;  2J55 H;  3OTT A;  5EMJ B;  4J78 A;  2OVR B;  4J79 A;  1SQ9 A;  3J81 g;  3C75 H;  2B4E A;  4ERY A;  4CI1 A;  1P22 A;  3EI4 A;  3SBR A;  3AL8 A;  1ERJ A;  5CXB B;  4LGN A;  4D6V A;  3AFC A;  2IWK A;  4H5I A;  2HXC A;  4A11 B;  1K32 A;  3DXK C;  4N14 A;  2UZX B;  3I7L A;  3SHF A;  3IJ0 A;  4A0B B;  3VH0 A;  3MZK A;  4J77 A;  4XYI A;  3PE7 A;  3PVW B;  4O45 A;  3BWS A;  3IJ1 A;  3EU7 A;  4A09 B;  1VYH C;  4FAV D;  3SBQ A;  2P9N C;  1L0Q A;  3EI3 A;  2XU7 A;  3PXT D;  4JSV C;  4JSN C;  1N6F A;  4FA1 D;  4MK0 B;  4ZOZ A;  5HE0 B;  4AOW A;  4FHL A;  2P9U C;  3JRO A;  1MG2 A;  3UVK A;  5C9Z B;  3KRX B;  2IUR A;  3FRX A;  5TDH B;  2H47 A;  4J84 A;  5I5I A;  3MKQ A;  5K19 A;  2YBA A;  4HDJ A;  4QRJ A;  4CI3 A;  4GQB B;  5JWZ A;  3DM0 A;  3MXX A;  3RFH A;  3EI1 A;  3SCY A;  5TEF A;  4A2L A;  5HQG A;  2BBK H;  3EWE A;  3K27 A;  3IIW A;  4QL1 A;  5C2V B;  1GG2 B;  2CE9 A;  4X3E A;  2J57 G;  4J8G A;  5FXY A;  5GXH A;  3I8E A;  2OVP B;  2PM9 A;  1SHY B;  1B9Y A;  2IAA A;  4E54 B;  3SN6 B;  2CO0 C;  4J0X A;  2P9S C;  5KDO B;  3B7F A;  3OKY B;  3L4O D;  3HFQ A;  4CZX A;  2AGL A;  4J82 A;  3GRE A;  2H14 A;  4J73 A;  2CNX A;  4XYH A;  3IJC A;  5H14 A;  2YB8 B;  4E5Z B;  3CIK B;  1YFQ A;  5FKR A;  2I0R A;  5CYK B;  3I7P A;  3N0E A;  3OW8 A;  5EMM B;  3VGZ A;  4X60 B;  5IT9 g;  3ZWL B;  3I7H A;  2HJB A;  5FA5 B;  5HE3 B;  2CN3 A;  3PSC B;  5GXI A;  2HES X;  1S4U X;  4ZOX A;  4Z8L A;  5AJA A;  1JMZ B;  2AGY A;  1Q47 A;  3OKW A;  4A0A A;  1R5M A;  3JZG A;  1JOF A;  2I0T A;  5FKQ A;  5THA A;  4L1Q D;  2TRC B;  4O1Q D;  2XL2 A;  4J86 A;  2YMU A;  3JZH A;  2P9K C;  5EM2 B;  3OL2 A;  3F3G A;  3W15 A;  1PI6 A;  4GGC A;  2AGX A;  3I7O A;  2I0S A;  4ESG A;  4ERZ A;  4L9O A;  4FA9 D;  4JSX C;  3E0C A;  4FAN D;  1XIP A;  5H1M A;  5GSA A;  3F3F A;  2B5M A;  5CXC A;  4L3G D;  2AGW A;  3ORV D;  4X61 B;  2H6K A;  3C9C A;  4PSX B;  4YVD A;  1MG3 A;  3UVM A;  5AMS A;  2XL3 A;  1GOT B;  2HJ4 A;  5H17 A;  3RMZ D;  4UI9 R;  1MDA H;  4X63 B;  4O3U B;  4CZV A;  3DSM A;  4A08 B;  4ZOV A;  5CXB A;  3NVN A;  4OWR A;  2HKR A;  4A11 A;  2YNP A;  4L3H D;  3AL9 A;  4A0B A;  1JMX B;  3RN0 D;  3RFG A;  3UKU C;  5TEE A;  4XEI C;  3UKR C;  2OVQ B;  3MZL A;  4A09 A;  5C2W B;  4LG8 A;  2P9I C;  4QQE A;  1B9X A;  2O9K A;  2OJY A;  5HE2 B;  1RI6 A;  3PSL A;  3IKO A;  4JT5 C;  2EBS A;  3EMH A;  4NSX A;  4J87 A;  4U1E I;  3SLE D;  2YNN A;  5EML B;  2P9P C;  5FKS A;  3I7K A;  1XHM A;  5HE1 B;  4O3T B;  1GXR A;  1TYQ C;  4GM3 A;  3SWS D;  3A0F A;  5HYN B;  2Z2O A;  1PEV A;  4LG9 A;  4GQ1 A;  3SXT D;  5EMK B;  5EAR A;  2CO0 A;  4PBZ A;  4PNK B;  3SVW D;  4E54 A;  4Y5R D;  2PM6 B;  1OLZ A;  5TF2 A;  2P9L C;  3OKY A;  4ZOY A;  5FKT A;  4FA4 D;  2H9L A;  3KRW B;  3EI2 B;  4E5Z A;  3PXW D;  5FLX g;  3PVU B;  3MKS B;  4PXW A;  2J56 H;  5CYK A;  2AH0 A;  2H9N A;  4D0K A;  5EAL A;  4GZ8 A;  4U7A A;  2PM7 B;  2IWF A;  4K3I D;  1U4C A;  4K3J B;  3V9F A;  3BG0 A;  2IUQ A;  1PGU A;  3J80 g;  3UVO A;  3JAM g;  4J0W A;  4BH6 A;  1SQJ A;  4R7A B;  3ULE C;  4A2M A;  2UZY B;  5AFU 3;  3UR4 A;  3JZN A;  5FQD A;  3IIY A;  5B4W A;  2H6N A;  3NVQ A;  4GQ2 P;  2HYE A;  4GGD A;  3L4M D;  1FWX A;  2G9A A;  4CY3 A;  2B5N A;  2B5L A;  4G56 B;  3I2N A;  5EAM A;  5EM2 A;  3AL8 B;  3SJL D;  2H9P A;  5IGO A;  4JT6 C; 
#chains in the Genus database with same CATH topology
 1K3I A;  4FA5 D;  5IJ7 E;  3K6S A;  1K8K C;  2GNQ A;  3UVL A;  3DXM C;  4CI2 A;  4QT8 A;  4CY2 A;  3RRM C;  4O9D A;  3C99 A;  1E8M A;  3NVX A;  4JD2 C;  4AN1 A;  3AH8 B;  2VDQ A;  4KFM B;  2QC5 A;  3F3P A;  4TZ4 A;  2HKM A;  3JRP A;  3EI3 B;  4RE5 A;  2I3T A;  4BP9 A;  4AN0 A;  2YNO A;  2Z2P A;  2OIZ A;  3IUR A;  4CY5 A;  5IC7 A;  3I7N A;  2VDP A;  3JB9 L;  3PXS D;  3K26 A;  3ZE2 A;  3IUN A;  5M5R A;  4ERQ A;  2G99 A;  4DNV A;  4IMM A;  1A12 A;  5SXM A;  3CFS B;  4CY1 A;  5A2Q g;  4A08 A;  1O6F A;  4GM9 A;  4PSW B;  3SFZ A;  2I3S A;  3SMR A;  1H2Y A;  2XDW A;  4PBY A;  3RSE C;  2Q7Q A;  4O2W A;  2H9M A;  5I5J A;  5E6R A;  1QFS A;  3FM0 A;  3EI1 B;  1BPO A;  4OZU A;  3SBP A;  3ODT A;  2OK4 A;  4BL0 A;  3QHY B;  1N6E A;  3IUJ A;  5IGQ A;  4JSP C;  2H6Q A;  1GOG A;  1A0R B;  3V7D B;  2GC4 A;  3GFC A;  2EID A;  2AQ5 A;  2OK6 A;  2CN2 A;  1NR0 A;  2VDK A;  3IUQ A;  1U2V C;  3RLM D;  2MTA H;  2PM9 B;  3EG6 A;  3DWL C;  4PC0 A;  4CZY A;  3CFV A;  5K1C C;  2H13 A;  5IJ8 E;  4H5J A;  4AMY A;  4CC9 A;  2GC7 A;  3UVN A;  5E6U A;  4ES0 A;  1QNI A;  4I79 A;  3V5W B;  5I5M A;  3FGB A;  4EWR A;  1PBY B;  2IUV A;  1H2W A;  2H3X A;  1XKS A;  4ZN4 A;  3I89 A;  4IRZ A;  1N6D A;  4MMZ A;  5E6S A;  2PBI B;  4FB1 D;  3EQ8 A;  5GMK n;  2IUP A;  3U4Y A;  5EAP A;  2Z2N A;  4BCD A;  4MMX A;  3ZE1 A;  3EQ9 A;  4G55 A;  3MUO A;  5M5V A;  3JPX A;  2XYI A;  3MMY A;  3C5M A;  4AEZ A;  5M61 A;  4A0A B;  2CE8 A;  4CI8 A;  3VA6 A;  4IA9 A;  4A7J A;  3MVD K;  3OKT A;  3BG1 A;  3I8C A;  2JKX A;  2AH1 A;  4GGA A;  1OMW B;  3K72 A;  4JXM A;  1NEX B;  4Z7O A;  3EI2 A;  1L5G A;  4DNW A;  2VDN A;  2QR5 A;  2W18 A;  4GM8 A;  3OL2 B;  1TBG A;  2QXV A;  4BUJ C;  4FWW A;  2AGZ A;  3P4F A;  3IUM A;  4NAA A;  4GMB A;  2BCJ B;  3N0D A;  2H68 A;  2XZG A;  4J8B A;  3RN1 D;  4O02 A;  1JJU B;  1O6G A;  4DNU A;  1C9L A;  3EI4 B;  4J81 A;  5CXC B;  1GP2 B;  4Y7R A;  2J55 H;  3OTT A;  5EMJ B;  3ZDX A;  4J78 A;  2OVR B;  4NBM A;  4J79 A;  3DDU A;  1SQ9 A;  3J81 g;  3C75 H;  2B4E A;  4ERY A;  4CI1 A;  1P22 A;  3EI4 A;  3SBR A;  3AL8 A;  1ERJ A;  5CXB B;  4LGN A;  2VDO A;  4D6V A;  3O4G A;  3AFC A;  2IWK A;  4H5I A;  2HXC A;  4A11 B;  1K32 A;  3DXK C;  1QFM A;  4N14 A;  2UZX B;  3I7L A;  3SHF A;  3IJ0 A;  4A0B B;  1UTC A;  3VH0 A;  3MZK A;  4J77 A;  4XYI A;  3T3P A;  3PE7 A;  3PVW B;  4O45 A;  3BWS A;  3IJ1 A;  3EU7 A;  5M5T A;  4A09 B;  1H2Z A;  1VYH C;  4FAV D;  3SBQ A;  2P9N C;  1L0Q A;  3EI3 A;  5FFO A;  2XU7 A;  3PXT D;  4JSV C;  4JSN C;  1N6F A;  4FA1 D;  4MK0 B;  4ZOZ A;  5HE0 B;  4AOW A;  3ZDZ A;  4FHL A;  2P9U C;  3JRO A;  1MG2 A;  3UVK A;  5C9Z B;  3KRX B;  2IUR A;  3O4J A;  3FRX A;  5TDH B;  2H47 A;  4J84 A;  5I5I A;  3MKQ A;  4JHN A;  2YBA A;  4HDJ A;  4QRJ A;  4CI3 A;  4GQB B;  5K19 A;  5JWZ A;  3DM0 A;  1UOO A;  1VZ3 A;  3MXX A;  3RFH A;  3EI1 A;  3SCY A;  4Z7Q A;  4WK2 A;  5TEF A;  4A2L A;  5HQG A;  2BBK H;  3EWE A;  3K27 A;  3IIW A;  3ZE0 A;  4QL1 A;  5C2V B;  1GG2 B;  2CE9 A;  4G1E A;  4X3E A;  2J57 G;  4J8G A;  5FXY A;  5GXH A;  1JTD B;  1U8C A;  3I8E A;  2OVP B;  2PM9 A;  3IUL A;  1SHY B;  1B9Y A;  2IAA A;  3VI4 A;  4E54 B;  3SN6 B;  2CO0 C;  4J0X A;  2P9S C;  1C9I A;  5KDO B;  3B7F A;  3OKY B;  3KCI A;  3L4O D;  3HFQ A;  1VE6 A;  3O4I A;  4CZX A;  2AGL A;  4J82 A;  3GRE A;  2H14 A;  4J73 A;  2CNX A;  4XYH A;  3IJC A;  4WJK A;  5H14 A;  2YB8 B;  4E5Z B;  3CIK B;  1YFQ A;  1E5T A;  2XE4 A;  5FKR A;  2I0R A;  5CYK B;  3FCS A;  3I7P A;  3N0E A;  3OW8 A;  5EMM B;  1VZ2 A;  2VC2 A;  3VGZ A;  4X60 B;  3IJE A;  5IT9 g;  3ZWL B;  4MMY A;  3I7H A;  2HJB A;  5FA5 B;  5HE3 B;  4AX4 A;  2CN3 A;  5C92 A;  3PSC B;  5GXI A;  2HES X;  1S4U X;  4ZOX A;  4Z8L A;  5AJA A;  1JMZ B;  2AGY A;  1Q47 A;  3OKW A;  4A0A A;  5M5U A;  2WQ8 A;  1UOP A;  1R5M A;  3JZG A;  3IVM A;  1JOF A;  2I0T A;  5FKQ A;  5THA A;  4L1Q D;  2TRC B;  4O1Q D;  2XL2 A;  2VDR A;  3FCU A;  2YMU A;  4J86 A;  3JZH A;  2P9K C;  5EM2 B;  3OL2 A;  5C86 A;  3F3G A;  3VI3 A;  3W15 A;  1PI6 A;  4GGC A;  2AGX A;  3I7O A;  2I0S A;  1GOF A;  2BKL A;  4ESG A;  4ERZ A;  4L9O A;  4FA9 D;  4JSX C;  3E0C A;  4FAN D;  3GC3 B;  2EIE A;  1XIP A;  5H1M A;  2VZ3 A;  5GSA A;  3F3F A;  2B5M A;  5CXC A;  2VZ1 A;  4L3G D;  4UM9 A;  2AGW A;  3O4H A;  3ORV D;  4X61 B;  5M5S A;  2H6K A;  3C9C A;  4PSX B;  4YVD A;  1MG3 A;  4WK0 A;  3UVM A;  5AMS A;  2XL3 A;  1GOT B;  2HJ4 A;  5H17 A;  4RE6 A;  3RMZ D;  4UI9 R;  1MDA H;  4X63 B;  4O3U B;  5FFG A;  4CZV A;  3DSM A;  4A08 B;  4ZOV A;  5HDB A;  5CXB A;  4UM8 A;  3NVN A;  4OWR A;  2QZP A;  2HKR A;  4A11 A;  3ZDY A;  2YNP A;  4L3H D;  3AL9 A;  4A0B A;  1JMX B;  4Z7N A;  3RN0 D;  3RFG A;  3UKU C;  5TEE A;  4XEI C;  3UKR C;  2OVQ B;  3MZL A;  4A09 A;  2EIC A;  5C2W B;  4LG8 A;  4BCB A;  2P9I C;  3K71 A;  4QQE A;  1YR2 A;  1B9X A;  1GOH A;  2HU5 A;  3NIG A;  2O9K A;  1TYE A;  2OJY A;  5HE2 B;  1RI6 A;  4NC4 A;  3PSL A;  3IKO A;  4BP8 A;  4JT5 C;  2EBS A;  2HU7 A;  3EMH A;  4NSX A;  4J87 A;  4U1E I;  3QI0 A;  3SLE D;  4D9S A;  2YNN A;  4JHP C;  5EML B;  2P9P C;  5FKS A;  4NEN A;  3I7K A;  1XHM A;  5HE1 B;  4O3T B;  1I2M B;  1GXR A;  3GD1 I;  1TYQ C;  4GM3 A;  3SWS D;  1H2X A;  2VDL A;  3A0F A;  5HYN B;  4QAM A;  1M1X A;  3NIF A;  2Z2O A;  1PEV A;  4LG9 A;  4GQ1 A;  4WK4 A;  3SXT D;  5EMK B;  3V4P A;  5EAR A;  2CO0 A;  1T2X A;  4PBZ A;  4PNK B;  3SVW D;  4E54 A;  4Y5R D;  2PM6 B;  1OLZ A;  5TF2 A;  2P9L C;  3OKY A;  1JV2 A;  5FKT A;  4ZOY A;  4BCC A;  4FA4 D;  2H9L A;  3NID A;  4L1M A;  3KRW B;  3EI2 B;  4E5Z A;  3PXW D;  5FLX g;  1UOQ A;  3PVU B;  3MKS B;  4PXW A;  2J56 H;  5CYK A;  2AH0 A;  2H9N A;  4D0K A;  5EAL A;  4GZ8 A;  1E8N A;  4U7A A;  2PM7 B;  2IWF A;  4K3I D;  1U4C A;  4K3J B;  3EQ7 A;  3BG0 A;  3V9F A;  2IUQ A;  3OF7 A;  1PGU A;  4AMZ A;  3J80 g;  3UVO A;  2HU8 A;  3JAM g;  4J0W A;  3MUN A;  4BH6 A;  1SQJ A;  3T3M A;  4R7A B;  3ULE C;  4A2M A;  2UZY B;  5AFU 3;  3UR4 A;  3JZN A;  5FQD A;  3IIY A;  5B4W A;  3V4V A;  2H6N A;  3NVQ A;  4GQ2 P;  1VE7 A;  2HYE A;  4G1M A;  4GGD A;  3L4M D;  1FWX A;  2G9A A;  4CY3 A;  2B5N A;  2B5L A;  2VDM A;  4G56 B;  3I2N A;  5EAM A;  5EM2 A;  3AL8 B;  3SJL D;  2H9P A;  5IGO A;  4JT6 C;  2EIB A; 
#chains in the Genus database with same CATH homology
 4FA5 D;  5IJ7 E;  1K8K C;  2GNQ A;  3UVL A;  3DXM C;  4CI2 A;  4QT8 A;  4CY2 A;  3RRM C;  4O9D A;  3C99 A;  3NVX A;  4JD2 C;  3AH8 B;  4KFM B;  2QC5 A;  3F3P A;  4TZ4 A;  2HKM A;  3JRP A;  3EI3 B;  2I3T A;  2YNO A;  2Z2P A;  2OIZ A;  4CY5 A;  5IC7 A;  3I7N A;  3JB9 L;  3PXS D;  3K26 A;  4ERQ A;  2G99 A;  4IMM A;  5SXM A;  4CY1 A;  3CFS B;  5A2Q g;  4A08 A;  4GM9 A;  4PSW B;  3SFZ A;  2I3S A;  3SMR A;  3RSE C;  4PBY A;  2Q7Q A;  2H9M A;  5I5J A;  3FM0 A;  3EI1 B;  4OZU A;  3SBP A;  3ODT A;  2OK4 A;  4BL0 A;  1N6E A;  5IGQ A;  4JSP C;  2H6Q A;  1A0R B;  3V7D B;  2GC4 A;  3GFC A;  2AQ5 A;  2OK6 A;  2CN2 A;  1NR0 A;  1U2V C;  3RLM D;  2MTA H;  2PM9 B;  3EG6 A;  3DWL C;  4PC0 A;  4CZY A;  3CFV A;  5K1C C;  2H13 A;  5IJ8 E;  4H5J A;  4CC9 A;  2GC7 A;  3UVN A;  4ES0 A;  1QNI A;  4I79 A;  3V5W B;  5I5M A;  3FGB A;  4EWR A;  1PBY B;  2IUV A;  2H3X A;  1XKS A;  4ZN4 A;  3I89 A;  1N6D A;  2PBI B;  4FB1 D;  5GMK n;  2IUP A;  3U4Y A;  5EAP A;  2Z2N A;  3JPX A;  2XYI A;  3MMY A;  3C5M A;  4AEZ A;  4A0A B;  2CE8 A;  4CI8 A;  3VA6 A;  4IA9 A;  4A7J A;  3OKT A;  3BG1 A;  3I8C A;  4GGA A;  2AH1 A;  1OMW B;  4JXM A;  1NEX B;  3EI2 A;  4GM8 A;  2W18 A;  3OL2 B;  1TBG A;  2QXV A;  4BUJ C;  4FWW A;  2AGZ A;  3P4F A;  4GMB A;  2BCJ B;  3N0D A;  2H68 A;  4J8B A;  3RN1 D;  1JJU B;  3EI4 B;  4J81 A;  5CXC B;  1GP2 B;  4Y7R A;  2J55 H;  3OTT A;  5EMJ B;  4J78 A;  2OVR B;  4J79 A;  1SQ9 A;  3J81 g;  3C75 H;  2B4E A;  4ERY A;  4CI1 A;  1P22 A;  3EI4 A;  3SBR A;  3AL8 A;  1ERJ A;  5CXB B;  4LGN A;  4D6V A;  3AFC A;  2IWK A;  4H5I A;  2HXC A;  4A11 B;  1K32 A;  3DXK C;  4N14 A;  2UZX B;  3I7L A;  3SHF A;  3IJ0 A;  4A0B B;  3VH0 A;  3MZK A;  4J77 A;  4XYI A;  3PE7 A;  3PVW B;  4O45 A;  3BWS A;  3IJ1 A;  3EU7 A;  4A09 B;  1VYH C;  4FAV D;  3SBQ A;  2P9N C;  1L0Q A;  3EI3 A;  2XU7 A;  3PXT D;  4JSV C;  4JSN C;  1N6F A;  4FA1 D;  4MK0 B;  4ZOZ A;  5HE0 B;  4AOW A;  4FHL A;  2P9U C;  3JRO A;  1MG2 A;  3UVK A;  5C9Z B;  3KRX B;  2IUR A;  3FRX A;  5TDH B;  2H47 A;  4J84 A;  5I5I A;  3MKQ A;  5K19 A;  2YBA A;  4HDJ A;  4QRJ A;  4CI3 A;  4GQB B;  5JWZ A;  3DM0 A;  3MXX A;  3RFH A;  3EI1 A;  3SCY A;  5TEF A;  4A2L A;  5HQG A;  2BBK H;  3EWE A;  3K27 A;  3IIW A;  4QL1 A;  5C2V B;  1GG2 B;  2CE9 A;  4X3E A;  2J57 G;  4J8G A;  5FXY A;  5GXH A;  3I8E A;  2OVP B;  2PM9 A;  1SHY B;  1B9Y A;  2IAA A;  4E54 B;  3SN6 B;  2CO0 C;  4J0X A;  2P9S C;  5KDO B;  3B7F A;  3OKY B;  3L4O D;  3HFQ A;  4CZX A;  2AGL A;  4J82 A;  3GRE A;  2H14 A;  4J73 A;  2CNX A;  4XYH A;  3IJC A;  5H14 A;  2YB8 B;  4E5Z B;  3CIK B;  1YFQ A;  5FKR A;  2I0R A;  5CYK B;  3I7P A;  3N0E A;  3OW8 A;  5EMM B;  3VGZ A;  4X60 B;  5IT9 g;  3ZWL B;  3I7H A;  2HJB A;  5FA5 B;  5HE3 B;  2CN3 A;  3PSC B;  5GXI A;  2HES X;  1S4U X;  4ZOX A;  4Z8L A;  5AJA A;  1JMZ B;  2AGY A;  1Q47 A;  3OKW A;  4A0A A;  1R5M A;  3JZG A;  1JOF A;  2I0T A;  5FKQ A;  5THA A;  4L1Q D;  2TRC B;  4O1Q D;  2XL2 A;  4J86 A;  2YMU A;  3JZH A;  2P9K C;  5EM2 B;  3OL2 A;  3F3G A;  3W15 A;  1PI6 A;  4GGC A;  2AGX A;  3I7O A;  2I0S A;  4ESG A;  4ERZ A;  4L9O A;  4FA9 D;  4JSX C;  3E0C A;  4FAN D;  1XIP A;  5H1M A;  5GSA A;  3F3F A;  2B5M A;  5CXC A;  4L3G D;  2AGW A;  3ORV D;  4X61 B;  2H6K A;  3C9C A;  4PSX B;  4YVD A;  1MG3 A;  3UVM A;  5AMS A;  2XL3 A;  1GOT B;  2HJ4 A;  5H17 A;  3RMZ D;  4UI9 R;  1MDA H;  4X63 B;  4O3U B;  4CZV A;  3DSM A;  4A08 B;  4ZOV A;  5CXB A;  3NVN A;  4OWR A;  2HKR A;  4A11 A;  2YNP A;  4L3H D;  3AL9 A;  4A0B A;  1JMX B;  3RN0 D;  3RFG A;  3UKU C;  5TEE A;  4XEI C;  3UKR C;  2OVQ B;  3MZL A;  4A09 A;  5C2W B;  4LG8 A;  2P9I C;  4QQE A;  1B9X A;  2O9K A;  2OJY A;  5HE2 B;  1RI6 A;  3PSL A;  3IKO A;  4JT5 C;  2EBS A;  3EMH A;  4NSX A;  4J87 A;  4U1E I;  3SLE D;  2YNN A;  5EML B;  2P9P C;  5FKS A;  3I7K A;  1XHM A;  5HE1 B;  4O3T B;  1GXR A;  1TYQ C;  4GM3 A;  3SWS D;  3A0F A;  5HYN B;  2Z2O A;  1PEV A;  4LG9 A;  4GQ1 A;  3SXT D;  5EMK B;  5EAR A;  2CO0 A;  4PBZ A;  4PNK B;  3SVW D;  4E54 A;  4Y5R D;  2PM6 B;  1OLZ A;  5TF2 A;  2P9L C;  3OKY A;  4ZOY A;  5FKT A;  4FA4 D;  2H9L A;  3KRW B;  3EI2 B;  4E5Z A;  3PXW D;  5FLX g;  3PVU B;  3MKS B;  4PXW A;  2J56 H;  5CYK A;  2AH0 A;  2H9N A;  4D0K A;  5EAL A;  4GZ8 A;  4U7A A;  2PM7 B;  2IWF A;  4K3I D;  1U4C A;  4K3J B;  3V9F A;  3BG0 A;  2IUQ A;  1PGU A;  3J80 g;  3UVO A;  3JAM g;  4J0W A;  4BH6 A;  1SQJ A;  4R7A B;  3ULE C;  4A2M A;  2UZY B;  5AFU 3;  3UR4 A;  3JZN A;  5FQD A;  3IIY A;  5B4W A;  2H6N A;  3NVQ A;  4GQ2 P;  2HYE A;  4GGD A;  3L4M D;  1FWX A;  2G9A A;  4CY3 A;  2B5N A;  2B5L A;  4G56 B;  3I2N A;  5EAM A;  5EM2 A;  3AL8 B;  3SJL D;  2H9P A;  5IGO A;  4JT6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...