4Z7QA

Integrin alphaiibbeta3 in complex with agdv-nh2 peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 102
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 4z7qA00
5E6RA 2VDQA 5FFOA 3ZE2A 3NIGA 3IJEA 4WK2A 2VDKA 4G1MA 3ZDYA 5E6UA 5FFGA 1JV2A 3VI4A 4WK0A 3NIDA 4UM9A 3ZE0A 3K72A 3NIFA 4MMZA 1M1XA 2VDRA 4MMYA 2VDPA 5HDBA 2VC2A 3FCUA 4G1EA 3ZE1A 4Z7NA 4Z7OA 4MMXA 3ZDXA 1U8CA 3V4VA 2VDOA 3K71A 1L5GA 3T3PA 4WK4A 3VI3A 1TYEA 3FCSA 4Z7QA 2VDNA 4O02A 3K6SA 5E6SA 4UM8A 3V4PA 4IRZA 4NENA 4WJKA 3T3MA 3ZDZA 2VDLA 2VDMA
chains in the Genus database with same CATH superfamily
4ZOVA 3ZE2A 5FXYA 3UVMA 5EMLB 4J0WA 3MKQA 3OL2A 4BCBA 4FA9D 3I8EA 1MDAH 4WK0A 2Z2PA 2TRCB 3I8CA 1VZ2A 4PC0A 2CE9A 1VYHC 2XU7A 4J78A 3EI1A 4AMYA 3IIYA 3JPXA 4QRJA 1S4UX 2J56H 4CZYA 5GXHA 1B9YA 1GG2B 4NAAA 5E6RA 5EMJB 1N6FA 3FGBA 3V7DB 4PBYA 4PBZA 4ZOYA 1K8KC 3PXSD 2XL3A 2H9NA 4O2WA 2VZ3A 5I5IA 1E8NA 2I3TA 4NSXA 4L9OA 5I5JA 1JMZB 2J55H 3I89A 4Z7OA 2YMUA 4EWRA 2G9AA 3I7NA 3EU7A 5EMMB 3K71A 1BPOA 4WK4A 3UR4A 4J8BA 4D6VA 1VE6A 2EBSA 3K27A 4BP8A 4GGDA 1C9LA 1UOPA 3EI4A 3IIWA 4A2LA 4L1MA 4FB1D 4FA4D 4MK0B 4E54A 2I0RA 2PM9B 2BKLA 3MZKA 3QHYB 3IURA 4L3GD 2I0TA 1L0QA 3F3FA 5IJ7E 1NEXB 3EWEA 2IUPA 2AGWA 3PSLA 4ESGA 4ES0A 2EIBA 5CXBB 2IWKA 2UZXB 5TDHB 1C9IA 4CY3A 3EQ8A 1UOQA 4QT8A 4CC9A 4IA9A 3OW8A 4QL1A 2VDKA 5K1CC 2YNPA 5GMKn 5KDOB 5M5UA 3RLMD 5IGQA 2HJBA 2XZGA 4FWWA 4A11B 5JWZA 1U8CA 1P22A 4J87A 3V4VA 5FKTA 3VI3A 4A7JA 3NVQA 3AFCA 2XYIA 5HE3B 2IUVA 4GM3A 3W15A 2P9IC 2CNXA 3F3GA 1TBGA 3KRWB 3PVUB 4O1QD 2PM6B 4TZ4A 4X60B 2OVPB 1FWXA 4R7AB 3UVLA 2XDWA 4E5ZB 1JV2A 3SFZA 4A09B 1O6FA 4JHPC 4O9DA 4DNWA 2AH0A 5C9ZB 3JB9L 3V5WB 2BBKH 4MMZA 5HDBA 5HYNB 4K3JB 1H2WA 4J79A 5FKSA 5FA5B 3VH0A 2OIZA 4XYIA 3ULEC 3EI2B 2B5NA 3OF7A 4O3TB 1GOTB 4XEIC 5H1MA 4H5IA 2P9LC 4OZUA 5M5VA 4ERZA 4U7AA 3IUQA 4GGAA 3PXWD 2PM9A 2IWFA 3GC3B 3IUMA 4AN1A 4J84A 4O45A 1RI6A 1GP2B 4IMMA 5CYKB 1JJUB 5EAMA 4BUJC 3SHFA 1Q47A 4BCCA 4CZVA 5HE1B 5CXBA 1O6GA 5GSAA 3OKWA 3QI0A 4YVDA 3FCSA 5AFU3 3EMHA 2PM7B 3I2NA 1PI6A 4JSXC 4KFMB 1SQ9A 5K19A 2JKXA 2OK4A 4L1QD 3O4HA 4FAVD 3L4OD 4J82A 4JSPC 3NVNA 3SVWD 2H6NA 4J73A 3F3PA 4JXMA 3RMZD 4JT6C 3KCIA 5IJ8E 3ZE0A 5TEFA 3EI3B 5B4WA 1XHMA 1JOFA 3MVDK 1I2MB 3SMRA 2AQ5A 2J57G 2VDOA 3HFQA 3IKOA 1H2YA 4PSWB 4PXWA 4X61B 2P9UC 3O4JA 1A12A 3I7HA 4A08B 3P4FA 4D0KA 4G56B 4BCDA 5M5SA 4A0AB 4A09A 4BP9A 3C5MA 4E5ZA 2H6KA 4AX4A 3ZDYA 5FFGA 3MZLA 2IURA 1YR2A 1UTCA 4O3UB 5EALA 3GFCA 3CFVA 2VC2A 1QFSA 4XYHA 2I0SA 1L5GA 4PSXB 3U4YA 3EI2A 3E0CA 4J8GA 4O02A 3IUNA 2O9KA 5EM2B 4UI9R 4AN0A 3T3MA 4FA5D 3OKTA 3MUOA 2B5MA 2B4EA 2H9MA 3KRXB 4D9SA 3PSCB 4WK2A 3SCYA 5FKQA 4BH6A 4J86A 4NC4A 4CY1A 3SBRA 5E6UA 5CYKA 4JSVC 1XIPA 4UM9A 3K72A 1M1XA 3SBPA 4CY5A 3SWSD 4DNVA 5GXIA 5EMKB 3SBQA 3EQ9A 4GZ8A 2P9SC 5HE2B 3RFHA 3OTTA 5TF2A 3RN1D 4J0XA 4Z7NA 5EAPA 4A2MA 2VDLA 2HU7A 2VDMA 4ZN4A 2VDQA 4GGCA 1PBYB 3IJEA 3SN6B 3SXTD 4J77A 4G1MA 1E5TA 3PE7A 4GM9A 2H9LA 1MG3A 3EI3A 4Z8LA 2GC4A 3IVMA 5C92A 2IUQA 1TYQC 1NR0A 4CI8A 2HJ4A 5H17A 5HQGA 4CZXA 4QQEA 2AGYA 3JAMg 3DM0A 4X3EA 2B5LA 1PEVA 2H14A 4ERQA 3CFSB 4A08A 4IRZA 4NENA 4A0AA 2HYEA 4PNKB 3UVNA 3K26A 3AH8B 3RRMC 2EIDA 3OKYB 2QR5A 2QC5A 3I7PA 4RE6A 2XE4A 5EARA 3FRXA 5H14A 3O4IA 1JTDB 1OMWB 5IT9g 4JSNC 5C86A 2I3SA 1GOGA 4GMBA 3GREA 2OK6A 4RE5A 2AGLA 3UVOA 2W18A 2HU5A 2VDRA 4MMYA 1N6DA 3MXXA 5HE0B 1U4CA 2QXVA 3EG6A 2G99A 3AL8B 3ORVD 3N0EA 5EM2A 3RSEC 2PBIB 2Z2NA 5E6SA 5FKRA 3A0FA 3IJ0A 2OVQB 3RN0D 3UKRC 3C9CA 2H3XA 4I79A 1XKSA 5IC7A 1B9XA 4CI2A 1MG2A 1SQJA 2OVRB 1YFQA 2UZYB 4LGNA 5M61A 2GC7A 4A0BB 2YBAA 5M5RA 1SHYB 4FHLA 2P9NC 2H47A 5SXMA 2H9PA 4A11A 5CXCB 3ZDXA 2EIEA 3JROA 3NVXA 1QFMA 1GXRA 4CI1A 4Z7QA 4AMZA 3K6SA 5C2VB 3C99A 2HU8A 3V4PA 3UVKA 5AMSA 4N14A 2CO0C 2GNQA 4JT5C 2YB8B 1H2XA 2AH1A 2CN2A 3SJLD 3NIGA 4AOWA 2CN3A 2H68A 4J81A 3VI4A 2HKRA 2P9PC 3MUNA 3NIDA 1VZ3A 3B7FA 2VDPA 3IULA 3ZE1A 1QNIA 1T2XA 3BG1A 2HKMA 4ZOXA 5THAA 2WQ8A 2EICA 3DXKC 4LG9A 3DSMA 2BCJB 3JZNA 3BWSA 3GD1I 3I7LA 4WJKA 1UOOA 3OKYA 4X63B 3C75H 3VGZA 4HDJA 5I5MA 3AL9A 3JZGA 4LG8A 1PGUA 4Y7RA 3I7OA 4GQBB 3EQ7A 3IJ1A 4BL0A 1H2ZA 3DDUA 3I7KA 3OL2B 2AGXA 1R5MA 1OLZA 3SLED 3DWLC 5A2Qg 3FCUA 4MMXA 3AL8A 1ERJA 3T3PA 4AEZA 4GM8A 4G55A 2OJYA 2VDNA 3PXTD 3EI1B 2HESX 2QZPA 3MMYA 3J81g 3O4GA 3BG0A 4ZOZA 4FAND 4JD2C 1VE7A 5TEEA 2Q7QA 5M5TA 3CIKB 4CY2A 2VZ1A 4A0BA 4DNUA 4ERYA 5IGOA 1U2VC 1A0RB 3NIFA 5CXCA 2P9KC 3L4MD 4CI3A 4G1EA 4QAMA 2H6QA 4Y5RD 4U1EI 1TYEA 2HXCA 1GOFA 4GQ1A 3V9FA 2CO0A 4NBMA 4UM8A 1K32A 3UKUC 4GQ2P 3DXMC 4L3HD 2YNOA 5FFOA 5FQDA 3PVWB 2IAAA 3JZHA 4H5JA 3EI4B 3MKSB 1E8MA 5C2WB 2XL2A 4K3ID 5AJAA 3N0DA 3ODTA 3RFGA 3IUJA 3J80g 1K3IA 4E54B 4FA1D 4JHNA 5FLXg 2MTAH 2AGZA 2Z2OA 2H13A 3FM0A 3JRPA 2CE8A 1GOHA 3ZWLB 3VA6A 1N6EA 4OWRA 2YNNA 3ZDZA 1JMXB 3IJCA
chains in the Genus database with same CATH topology
5E6RA 2VDQA 5FFOA 3ZE2A 3NIGA 3IJEA 4WK2A 2VDKA 4G1MA 3ZDYA 5E6UA 5FFGA 1JV2A 3VI4A 4WK0A 3NIDA 4UM9A 3ZE0A 3K72A 3NIFA 4MMZA 1M1XA 2VDRA 4MMYA 2VDPA 5HDBA 2VC2A 3FCUA 4G1EA 3ZE1A 4Z7NA 4Z7OA 4MMXA 3ZDXA 1U8CA 3V4VA 2VDOA 3K71A 1L5GA 3T3PA 4WK4A 3VI3A 1TYEA 3FCSA 4Z7QA 2VDNA 4O02A 3K6SA 5E6SA 4UM8A 3V4PA 4IRZA 4NENA 4WJKA 3T3MA 3ZDZA 2VDLA 2VDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6R A;  2VDQ A;  5FFO A;  3ZE2 A;  3NIG A;  3IJE A;  4WK2 A;  2VDK A;  4G1M A;  3ZDY A;  5E6U A;  5FFG A;  1JV2 A;  3VI4 A;  4WK0 A;  3NID A;  4UM9 A;  3ZE0 A;  3K72 A;  3NIF A;  4MMZ A;  1M1X A;  2VDR A;  4MMY A;  2VDP A;  5HDB A;  2VC2 A;  3FCU A;  4G1E A;  3ZE1 A;  4Z7N A;  4Z7O A;  4MMX A;  3ZDX A;  1U8C A;  3V4V A;  2VDO A;  3K71 A;  1L5G A;  3T3P A;  4WK4 A;  3VI3 A;  1TYE A;  3FCS A;  4Z7Q A;  2VDN A;  4O02 A;  3K6S A;  5E6S A;  4UM8 A;  3V4P A;  4IRZ A;  4NEN A;  4WJK A;  3T3M A;  3ZDZ A;  2VDL A;  2VDM A; 
#chains in the Genus database with same CATH topology
 4ZOV A;  3ZE2 A;  5FXY A;  3UVM A;  5EML B;  4J0W A;  3MKQ A;  3OL2 A;  4BCB A;  4FA9 D;  3I8E A;  1MDA H;  4WK0 A;  2Z2P A;  2TRC B;  3I8C A;  1VZ2 A;  4PC0 A;  2CE9 A;  1VYH C;  2XU7 A;  4J78 A;  3EI1 A;  4AMY A;  3IIY A;  3JPX A;  4QRJ A;  1S4U X;  2J56 H;  4CZY A;  5GXH A;  1B9Y A;  1GG2 B;  4NAA A;  5E6R A;  5EMJ B;  1N6F A;  3FGB A;  3V7D B;  4PBY A;  4PBZ A;  4ZOY A;  1K8K C;  3PXS D;  2XL3 A;  2H9N A;  4O2W A;  2VZ3 A;  5I5I A;  1E8N A;  2I3T A;  4NSX A;  4L9O A;  5I5J A;  1JMZ B;  2J55 H;  3I89 A;  4Z7O A;  2YMU A;  4EWR A;  2G9A A;  3I7N A;  3EU7 A;  5EMM B;  3K71 A;  1BPO A;  4WK4 A;  3UR4 A;  4J8B A;  4D6V A;  1VE6 A;  2EBS A;  3K27 A;  4BP8 A;  4GGD A;  1C9L A;  1UOP A;  3EI4 A;  3IIW A;  4A2L A;  4L1M A;  4FB1 D;  4FA4 D;  4MK0 B;  4E54 A;  2I0R A;  2PM9 B;  2BKL A;  3MZK A;  3QHY B;  3IUR A;  4L3G D;  2I0T A;  1L0Q A;  3F3F A;  5IJ7 E;  1NEX B;  3EWE A;  2IUP A;  2AGW A;  3PSL A;  4ESG A;  4ES0 A;  2EIB A;  5CXB B;  2IWK A;  2UZX B;  5TDH B;  1C9I A;  4CY3 A;  3EQ8 A;  1UOQ A;  4QT8 A;  4CC9 A;  4IA9 A;  3OW8 A;  4QL1 A;  2VDK A;  5K1C C;  2YNP A;  5GMK n;  5KDO B;  5M5U A;  3RLM D;  5IGQ A;  2HJB A;  2XZG A;  4FWW A;  4A11 B;  5JWZ A;  1U8C A;  1P22 A;  4J87 A;  3V4V A;  5FKT A;  3VI3 A;  4A7J A;  3NVQ A;  3AFC A;  2XYI A;  5HE3 B;  2IUV A;  4GM3 A;  3W15 A;  2P9I C;  2CNX A;  3F3G A;  1TBG A;  3KRW B;  3PVU B;  4O1Q D;  2PM6 B;  4TZ4 A;  4X60 B;  2OVP B;  1FWX A;  4R7A B;  3UVL A;  2XDW A;  4E5Z B;  1JV2 A;  3SFZ A;  4A09 B;  1O6F A;  4JHP C;  4O9D A;  4DNW A;  2AH0 A;  5C9Z B;  3JB9 L;  3V5W B;  2BBK H;  4MMZ A;  5HDB A;  5HYN B;  4K3J B;  1H2W A;  4J79 A;  5FKS A;  5FA5 B;  3VH0 A;  2OIZ A;  4XYI A;  3ULE C;  3EI2 B;  2B5N A;  3OF7 A;  4O3T B;  1GOT B;  4XEI C;  5H1M A;  4H5I A;  2P9L C;  4OZU A;  5M5V A;  4ERZ A;  4U7A A;  3IUQ A;  4GGA A;  3PXW D;  2PM9 A;  2IWF A;  3GC3 B;  3IUM A;  4AN1 A;  4J84 A;  4O45 A;  1RI6 A;  1GP2 B;  4IMM A;  5CYK B;  1JJU B;  5EAM A;  4BUJ C;  3SHF A;  1Q47 A;  4BCC A;  4CZV A;  5HE1 B;  5CXB A;  1O6G A;  5GSA A;  3OKW A;  3QI0 A;  4YVD A;  3FCS A;  5AFU 3;  3EMH A;  2PM7 B;  3I2N A;  1PI6 A;  4JSX C;  4KFM B;  1SQ9 A;  5K19 A;  2JKX A;  2OK4 A;  4L1Q D;  3O4H A;  4FAV D;  3L4O D;  4J82 A;  4JSP C;  3NVN A;  3SVW D;  2H6N A;  4J73 A;  3F3P A;  4JXM A;  3RMZ D;  4JT6 C;  3KCI A;  5IJ8 E;  3ZE0 A;  5TEF A;  3EI3 B;  5B4W A;  1XHM A;  1JOF A;  3MVD K;  1I2M B;  3SMR A;  2AQ5 A;  2J57 G;  2VDO A;  3HFQ A;  3IKO A;  1H2Y A;  4PSW B;  4PXW A;  4X61 B;  2P9U C;  3O4J A;  1A12 A;  3I7H A;  4A08 B;  3P4F A;  4D0K A;  4G56 B;  4BCD A;  5M5S A;  4A0A B;  4A09 A;  4BP9 A;  3C5M A;  4E5Z A;  2H6K A;  4AX4 A;  3ZDY A;  5FFG A;  3MZL A;  2IUR A;  1YR2 A;  1UTC A;  4O3U B;  5EAL A;  3GFC A;  3CFV A;  2VC2 A;  1QFS A;  4XYH A;  2I0S A;  1L5G A;  4PSX B;  3U4Y A;  3EI2 A;  3E0C A;  4J8G A;  4O02 A;  3IUN A;  2O9K A;  5EM2 B;  4UI9 R;  4AN0 A;  3T3M A;  4FA5 D;  3OKT A;  3MUO A;  2B5M A;  2B4E A;  2H9M A;  3KRX B;  4D9S A;  3PSC B;  4WK2 A;  3SCY A;  5FKQ A;  4BH6 A;  4J86 A;  4NC4 A;  4CY1 A;  3SBR A;  5E6U A;  5CYK A;  4JSV C;  1XIP A;  4UM9 A;  3K72 A;  1M1X A;  3SBP A;  4CY5 A;  3SWS D;  4DNV A;  5GXI A;  5EMK B;  3SBQ A;  3EQ9 A;  4GZ8 A;  2P9S C;  5HE2 B;  3RFH A;  3OTT A;  5TF2 A;  3RN1 D;  4J0X A;  4Z7N A;  5EAP A;  4A2M A;  2VDL A;  2HU7 A;  2VDM A;  4ZN4 A;  2VDQ A;  4GGC A;  1PBY B;  3IJE A;  3SN6 B;  3SXT D;  4J77 A;  4G1M A;  1E5T A;  3PE7 A;  4GM9 A;  2H9L A;  1MG3 A;  3EI3 A;  4Z8L A;  2GC4 A;  3IVM A;  5C92 A;  2IUQ A;  1TYQ C;  1NR0 A;  4CI8 A;  2HJ4 A;  5H17 A;  5HQG A;  4CZX A;  4QQE A;  2AGY A;  3JAM g;  3DM0 A;  4X3E A;  2B5L A;  1PEV A;  2H14 A;  4ERQ A;  3CFS B;  4A08 A;  4IRZ A;  4NEN A;  4A0A A;  2HYE A;  4PNK B;  3UVN A;  3K26 A;  3AH8 B;  3RRM C;  2EID A;  3OKY B;  2QR5 A;  2QC5 A;  3I7P A;  4RE6 A;  2XE4 A;  5EAR A;  3FRX A;  5H14 A;  3O4I A;  1JTD B;  1OMW B;  5IT9 g;  4JSN C;  5C86 A;  2I3S A;  1GOG A;  4GMB A;  3GRE A;  2OK6 A;  4RE5 A;  2AGL A;  3UVO A;  2W18 A;  2HU5 A;  2VDR A;  4MMY A;  1N6D A;  3MXX A;  5HE0 B;  1U4C A;  2QXV A;  3EG6 A;  2G99 A;  3AL8 B;  3ORV D;  3N0E A;  5EM2 A;  3RSE C;  2PBI B;  2Z2N A;  5E6S A;  5FKR A;  3A0F A;  3IJ0 A;  2OVQ B;  3RN0 D;  3UKR C;  3C9C A;  2H3X A;  4I79 A;  1XKS A;  5IC7 A;  1B9X A;  4CI2 A;  1MG2 A;  1SQJ A;  2OVR B;  1YFQ A;  2UZY B;  4LGN A;  5M61 A;  2GC7 A;  4A0B B;  2YBA A;  5M5R A;  1SHY B;  4FHL A;  2P9N C;  2H47 A;  5SXM A;  2H9P A;  4A11 A;  5CXC B;  3ZDX A;  2EIE A;  3JRO A;  3NVX A;  1QFM A;  1GXR A;  4CI1 A;  4Z7Q A;  4AMZ A;  3K6S A;  5C2V B;  3C99 A;  2HU8 A;  3V4P A;  3UVK A;  5AMS A;  4N14 A;  2CO0 C;  2GNQ A;  4JT5 C;  2YB8 B;  1H2X A;  2AH1 A;  2CN2 A;  3SJL D;  3NIG A;  4AOW A;  2CN3 A;  2H68 A;  4J81 A;  3VI4 A;  2HKR A;  2P9P C;  3MUN A;  3NID A;  1VZ3 A;  3B7F A;  2VDP A;  3IUL A;  3ZE1 A;  1QNI A;  1T2X A;  3BG1 A;  2HKM A;  4ZOX A;  5THA A;  2WQ8 A;  2EIC A;  3DXK C;  4LG9 A;  3DSM A;  2BCJ B;  3JZN A;  3BWS A;  3GD1 I;  3I7L A;  4WJK A;  1UOO A;  3OKY A;  4X63 B;  3C75 H;  3VGZ A;  4HDJ A;  5I5M A;  3AL9 A;  3JZG A;  4LG8 A;  1PGU A;  4Y7R A;  3I7O A;  4GQB B;  3EQ7 A;  3IJ1 A;  4BL0 A;  1H2Z A;  3DDU A;  3I7K A;  3OL2 B;  2AGX A;  1R5M A;  1OLZ A;  3SLE D;  3DWL C;  5A2Q g;  3FCU A;  4MMX A;  3AL8 A;  1ERJ A;  3T3P A;  4AEZ A;  4GM8 A;  4G55 A;  2OJY A;  2VDN A;  3PXT D;  3EI1 B;  2HES X;  2QZP A;  3MMY A;  3J81 g;  3O4G A;  3BG0 A;  4ZOZ A;  4FAN D;  4JD2 C;  1VE7 A;  5TEE A;  2Q7Q A;  5M5T A;  3CIK B;  4CY2 A;  2VZ1 A;  4A0B A;  4DNU A;  4ERY A;  5IGO A;  1U2V C;  1A0R B;  3NIF A;  5CXC A;  2P9K C;  3L4M D;  4CI3 A;  4G1E A;  4QAM A;  2H6Q A;  4Y5R D;  4U1E I;  1TYE A;  2HXC A;  1GOF A;  4GQ1 A;  3V9F A;  2CO0 A;  4NBM A;  4UM8 A;  1K32 A;  3UKU C;  4GQ2 P;  3DXM C;  4L3H D;  2YNO A;  5FFO A;  5FQD A;  3PVW B;  2IAA A;  3JZH A;  4H5J A;  3EI4 B;  3MKS B;  1E8M A;  5C2W B;  2XL2 A;  4K3I D;  5AJA A;  3N0D A;  3ODT A;  3RFG A;  3IUJ A;  3J80 g;  1K3I A;  4E54 B;  4FA1 D;  4JHN A;  5FLX g;  2MTA H;  2AGZ A;  2Z2O A;  2H13 A;  3FM0 A;  3JRP A;  2CE8 A;  1GOH A;  3ZWL B;  3VA6 A;  1N6E A;  4OWR A;  2YNN A;  3ZDZ A;  1JMX B;  3IJC A; 
#chains in the Genus database with same CATH homology
 5E6R A;  2VDQ A;  5FFO A;  3ZE2 A;  3NIG A;  3IJE A;  4WK2 A;  2VDK A;  4G1M A;  3ZDY A;  5E6U A;  5FFG A;  1JV2 A;  3VI4 A;  4WK0 A;  3NID A;  4UM9 A;  3ZE0 A;  3K72 A;  3NIF A;  4MMZ A;  1M1X A;  2VDR A;  4MMY A;  2VDP A;  5HDB A;  2VC2 A;  3FCU A;  4G1E A;  3ZE1 A;  4Z7N A;  4Z7O A;  4MMX A;  3ZDX A;  1U8C A;  3V4V A;  2VDO A;  3K71 A;  1L5G A;  3T3P A;  4WK4 A;  3VI3 A;  1TYE A;  3FCS A;  4Z7Q A;  2VDN A;  4O02 A;  3K6S A;  5E6S A;  4UM8 A;  3V4P A;  4IRZ A;  4NEN A;  4WJK A;  3T3M A;  3ZDZ A;  2VDL A;  2VDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...