4Z7QA

Integrin alphaiibbeta3 in complex with agdv-nh2 peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 4z7qA00
2VDRA 2VDOA 2VC2A 4MMYA 5HDBA 3ZDYA 4NENA 2VDLA 3NIGA 3FCSA 4MMXA 4Z7OA 3IJEA 1TYEA 2VDQA 4IRZA 4WK2A 3ZDXA 1U8CA 3T3PA 3ZDZA 2VDKA 4Z7QA 3K71A 3T3MA 1L5GA 3V4PA 3ZE2A 3VI3A 3V4VA 4O02A 3VI4A 3K72A 2VDMA 4Z7NA 5FFGA 3NIFA 1M1XA 3ZE1A 5FFOA 4G1MA 4G1EA 3NIDA 3ZE0A 2VDPA 3K6SA 4UM9A 4MMZA 4UM8A 4WK0A 2VDNA 4WJKA 4WK4A 5E6RA 3FCUA 5E6UA 5E6SA 1JV2A
chains in the Genus database with same CATH superfamily
4CY1A 3I8EA 1OLZA 3I7HA 2VDLA 4OZUA 4FA9D 4D9SA 1C9IA 1TYQC 4O2WA 2G9AA 4PSWB 5HE1B 3NVNA 4PSXB 1Q47A 2PBIB 2OIZA 2OJYA 3NVQA 4TZ4A 1GOFA 3JZNA 4G1MA 5I5MA 4BH6A 2P9SC 4FHLA 4A09B 3K6SA 1QFSA 2P9IC 3ULEC 3GFCA 1H2XA 5EMMB 1QNIA 2I3SA 4J8GA 2HJ4A 4N14A 1N6FA 4FAND 4D6VA 5C86A 2BCJB 3SFZA 5EAPA 4G56B 1NEXB 4AOWA 4GMBA 4KFMB 1I2MB 3RFHA 4ESGA 4G1EA 1YR2A 5HYNB 1RI6A 3DWLC 1GXRA 2YNNA 4IMMA 2JKXA 2B5MA 4WJKA 2GNQA 4I79A 2VDRA 3SWSD 3IKOA 5KDOB 2CN2A 4JXMA 4XYHA 5EALA 3VGZA 4AMYA 1L0QA 3A0FA 3JRPA 3I89A 4LGNA 5EM2A 3UVOA 1A12A 4X61B 2P9NC 3OKWA 5A2Qg 3IJ0A 4K3ID 1GOGA 1P22A 5FXYA 5FKRA 2PM7B 5FKQA 5AMSA 2AGZA 4UM9A 4JT6C 2PM9A 1MG2A 4PXWA 3AL8A 4RE5A 2IAAA 4A7JA 3I7LA 4EWRA 3PSCB 4J0WA 4GQ1A 4E54B 5C92A 3NIGA 4A2MA 3IURA 4J77A 2AGLA 5THAA 2GC7A 4ZOYA 3SJLD 2XE4A 3K71A 4AX4A 1SHYB 4MK0B 5IT9g 3I2NA 2P9LC 3DM0A 4BCDA 3MUNA 3K72A 5M5RA 2YNOA 4ERZA 1MG3A 4JT5C 3NIFA 1M1XA 3CFVA 4H5JA 4NAAA 4J81A 4YVDA 1B9XA 5FFOA 3N0EA 3FGBA 3MZLA 3DXMC 3EI3B 5HE0B 3IIYA 4MMZA 3E0CA 1T2XA 5GSAA 1JMXB 5I5IA 3RMZD 5H14A 2YBAA 2OK4A 2EIDA 4BUJC 1H2YA 5EMKB 3KRXB 3EI2A 2HKMA 3PXTD 3KRWB 4NENA 4JSNC 5K19A 1VZ3A 2B5NA 4OWRA 4Z7QA 5GMKn 4NBMA 5CYKB 2QXVA 1E5TA 4U7AA 3EQ9A 4BCCA 2VDMA 1GG2B 1PI6A 2J56H 3QHYB 3GD1I 4CI2A 4D0KA 4FA1D 5M5SA 2XYIA 4X60B 3BWSA 2H14A 3UVLA 3MKSB 5AJAA 2CO0A 4DNVA 4FWWA 1K3IA 5IGQA 5CXBA 3J81g 3MMYA 4E5ZB 2VDQA 3K26A 3GREA 4J82A 3P4FA 1FWXA 1MDAH 2HU8A 2H6NA 3F3FA 3RRMC 2EICA 4FAVD 1GP2B 3V4VA 4ZOVA 3V5WB 4CI3A 3RLMD 4A11B 4CY2A 4A0AB 4NSXA 3AH8B 3ZE0A 4A08B 1H2WA 2HKRA 4GQBB 5SXMA 2H47A 1U2VC 2P9UC 5TEEA 4BP9A 2OVRB 3PVWB 5HE2B 4GQ2P 2H9NA 3IJ1A 1JTDB 3W15A 4U1EI 1QFMA 1L5GA 2AGYA 3OL2A 3EMHA 5EARA 1YFQA 5EAMA 4K3JB 4JSXC 2AGWA 1U4CA 4RE6A 2QC5A 5M61A 3IUQA 3MXXA 1UOQA 1JV2A 3C75H 2G99A 3ZDYA 3PVUB 3CIKB 5TDHB 4IRZA 2UZXB 5CXCA 2P9PC 3JROA 3EG6A 5GXHA 2Q7QA 2Z2PA 3BG0A 5FKTA 4O1QD 4O02A 4ES0A 4G55A 3PXSD 4GGDA 4PBYA 2XZGA 5EMLB 3RFGA 4L3HD 3NIDA 4JD2C 4PNKB 1SQJA 4L9OA 2B4EA 3UR4A 4AN1A 2H6QA 4A0BB 1PGUA 4QQEA 3F3PA 5EM2B 5IC7A 4JSPC 2I0SA 4GM3A 4X63B 4WK2A 1K8KC 2VDKA 2CE9A 3OKYB 3FM0A 1UOPA 2I0TA 2QR5A 2H3XA 2PM9B 2WQ8A 5TEFA 4QRJA 3QI0A 2BKLA 3BG1A 3EI4A 5M5TA 3EI1A 3EWEA 3L4OD 1E8MA 3V9FA 2O9KA 5E6UA 3O4GA 1TBGA 4UI9R 4Z8LA 3RN1D 3O4HA 4GGCA 2VC2A 1R5MA 4Y7RA 2AGXA 4GGAA 5HQGA 2B5LA 2H68A 4CZXA 1JJUB 3ZE2A 5GXIA 1ERJA 3CFSB 3FRXA 4AMZA 3SCYA 3U4YA 4NC4A 2CN3A 2IWKA 4IA9A 5CYKA 3UKUC 4BL0A 2OVPB 2QZPA 3IJCA 4GM8A 4CZVA 5C9ZB 2CE8A 2VDPA 1E8NA 1JMZB 2EBSA 3FCUA 2XL2A 3I8CA 1B9YA 4O9DA 4ZOZA 1SQ9A 1N6DA 3HFQA 4J8BA 3EU7A 5HE3B 2Z2NA 4ZOXA 3T3PA 4BCBA 5EMJB 4FA4D 1VE6A 2HESX 4J78A 1GOTB 2J57G 5I5JA 2Z2OA 2AH1A 3EQ8A 4H5IA 2YNPA 5K1CC 2IUPA 1JOFA 1O6GA 4J84A 3UVKA 3I7PA 3ODTA 3C9CA 3OKTA 4X3EA 2HYEA 5B4WA 4QL1A 5E6RA 4Y5RD 5CXBB 5E6SA 3JPXA 4FB1D 2I0RA 4A09A 2H13A 5FA5B 4GM9A 4DNWA 5H17A 4LG9A 3IVMA 4FA5D 2H9LA 3FCSA 1U8CA 1VZ2A 4ERYA 5M5VA 3GC3B 3OTTA 4J87A 1A0RB 3UKRC 1VE7A 5H1MA 2HU5A 2CNXA 1N6EA 4PC0A 4A2LA 3F3GA 4UM8A 4WK0A 3ZE1A 2EIBA 2OK6A 4AEZA 2VDOA 3IIWA 3PXWD 3RSEC 4MMYA 3I7OA 3OL2B 2I3TA 3JZGA 3JZHA 1NR0A 4CZYA 3SLED 1BPOA 3IUJA 3JAMg 4ERQA 4CY3A 3I7NA 3I7KA 3VA6A 2IWFA 5M5UA 2CO0C 5C2WB 5JWZA 4CY5A 3OW8A 4PBZA 2BBKH 4QAMA 4J73A 1PEVA 2XDWA 2YB8B 4JSVC 1C9LA 3MKQA 4WK4A 3SVWD 4L1MA 2YMUA 5CXCB 3IUMA 3SMRA 5HDBA 4A0BA 3IULA 2OVQB 2AH0A 2EIEA 2IUQA 3MZKA 3ZDZA 4XEIC 4E54A 3T3MA 3PSLA 1H2ZA 2W18A 2XL3A 3PE7A 2HJBA 4J86A 5AFU3 4AN0A 4JHPC 2P9KC 1XKSA 1XIPA 2H9PA 3OKYA 1K32A 3B7FA 4J79A 4GZ8A 5FQDA 3N0DA 4HDJA 4L3GD 3AL8B 3SBPA 2UZYB 3OF7A 3SN6B 1XHMA 3EI3A 4O45A 5FLXg 3ORVD 3SBQA 3AFCA 1UTCA 3RN0D 2VZ1A 2MTAH 2VZ3A 3DXKC 4MMXA 4Z7OA 1TYEA 3IJEA 3ZDXA 2HXCA 1UOOA 2H6KA 5IJ7E 3O4IA 2TRCB 2IUVA 5IGOA 1OMWB 3V4PA 4CC9A 3VI3A 2IURA 2AQ5A 3MUOA 3EI4B 4QT8A 1GOHA 3SHFA 3EI1B 4Z7NA 5FFGA 3SXTD 4XYIA 3O4JA 4L1QD 3AL9A 4BP8A 3C99A 3NVXA 3DSMA 2HU7A 3EI2B 3ZWLB 3UVNA 4CI1A 3JB9L 1PBYB 3C5MA 4O3TB 4R7AB 5C2VB 3K27A 3KCIA 5IJ8E 3IUNA 3VH0A 3L4MD 3MVDK 3V7DB 5FKSA 4E5ZA 3J80g 3DDUA 3VI4A 2XU7A 4DNUA 4CI8A 5TF2A 2GC4A 3SBRA 2J55H 2PM6B 4JHNA 4O3UB 4J0XA 3EQ7A 1S4UX 4ZN4A 4LG8A 1O6FA 2H9MA 4A11A 3UVMA 4A0AA 2VDNA 1VYHC 4A08A
chains in the Genus database with same CATH topology
2VDRA 2VDOA 2VC2A 4MMYA 5HDBA 3ZDYA 4NENA 2VDLA 3NIGA 3FCSA 4MMXA 4Z7OA 3IJEA 1TYEA 2VDQA 4IRZA 4WK2A 3ZDXA 1U8CA 3T3PA 3ZDZA 2VDKA 4Z7QA 3K71A 3T3MA 1L5GA 3V4PA 3ZE2A 3VI3A 3V4VA 4O02A 3VI4A 3K72A 2VDMA 4Z7NA 5FFGA 3NIFA 1M1XA 3ZE1A 5FFOA 4G1MA 4G1EA 3NIDA 3ZE0A 2VDPA 3K6SA 4UM9A 4MMZA 4UM8A 4WK0A 2VDNA 4WJKA 4WK4A 5E6RA 3FCUA 5E6UA 5E6SA 1JV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDR A;  2VDO A;  2VC2 A;  4MMY A;  5HDB A;  3ZDY A;  4NEN A;  2VDL A;  3NIG A;  3FCS A;  4MMX A;  4Z7O A;  3IJE A;  1TYE A;  2VDQ A;  4IRZ A;  4WK2 A;  3ZDX A;  1U8C A;  3T3P A;  3ZDZ A;  2VDK A;  4Z7Q A;  3K71 A;  3T3M A;  1L5G A;  3V4P A;  3ZE2 A;  3VI3 A;  3V4V A;  4O02 A;  3VI4 A;  3K72 A;  2VDM A;  4Z7N A;  5FFG A;  3NIF A;  1M1X A;  3ZE1 A;  5FFO A;  4G1M A;  4G1E A;  3NID A;  3ZE0 A;  2VDP A;  3K6S A;  4UM9 A;  4MMZ A;  4UM8 A;  4WK0 A;  2VDN A;  4WJK A;  4WK4 A;  5E6R A;  3FCU A;  5E6U A;  5E6S A;  1JV2 A; 
#chains in the Genus database with same CATH topology
 4CY1 A;  3I8E A;  1OLZ A;  3I7H A;  2VDL A;  4OZU A;  4FA9 D;  4D9S A;  1C9I A;  1TYQ C;  4O2W A;  2G9A A;  4PSW B;  5HE1 B;  3NVN A;  4PSX B;  1Q47 A;  2PBI B;  2OIZ A;  2OJY A;  3NVQ A;  4TZ4 A;  1GOF A;  3JZN A;  4G1M A;  5I5M A;  4BH6 A;  2P9S C;  4FHL A;  4A09 B;  3K6S A;  1QFS A;  2P9I C;  3ULE C;  3GFC A;  1H2X A;  5EMM B;  1QNI A;  2I3S A;  4J8G A;  2HJ4 A;  4N14 A;  1N6F A;  4FAN D;  4D6V A;  5C86 A;  2BCJ B;  3SFZ A;  5EAP A;  4G56 B;  1NEX B;  4AOW A;  4GMB A;  4KFM B;  1I2M B;  3RFH A;  4ESG A;  4G1E A;  1YR2 A;  5HYN B;  1RI6 A;  3DWL C;  1GXR A;  2YNN A;  4IMM A;  2JKX A;  2B5M A;  4WJK A;  2GNQ A;  4I79 A;  2VDR A;  3SWS D;  3IKO A;  5KDO B;  2CN2 A;  4JXM A;  4XYH A;  5EAL A;  3VGZ A;  4AMY A;  1L0Q A;  3A0F A;  3JRP A;  3I89 A;  4LGN A;  5EM2 A;  3UVO A;  1A12 A;  4X61 B;  2P9N C;  3OKW A;  5A2Q g;  3IJ0 A;  4K3I D;  1GOG A;  1P22 A;  5FXY A;  5FKR A;  2PM7 B;  5FKQ A;  5AMS A;  2AGZ A;  4UM9 A;  4JT6 C;  2PM9 A;  1MG2 A;  4PXW A;  3AL8 A;  4RE5 A;  2IAA A;  4A7J A;  3I7L A;  4EWR A;  3PSC B;  4J0W A;  4GQ1 A;  4E54 B;  5C92 A;  3NIG A;  4A2M A;  3IUR A;  4J77 A;  2AGL A;  5THA A;  2GC7 A;  4ZOY A;  3SJL D;  2XE4 A;  3K71 A;  4AX4 A;  1SHY B;  4MK0 B;  5IT9 g;  3I2N A;  2P9L C;  3DM0 A;  4BCD A;  3MUN A;  3K72 A;  5M5R A;  2YNO A;  4ERZ A;  1MG3 A;  4JT5 C;  3NIF A;  1M1X A;  3CFV A;  4H5J A;  4NAA A;  4J81 A;  4YVD A;  1B9X A;  5FFO A;  3N0E A;  3FGB A;  3MZL A;  3DXM C;  3EI3 B;  5HE0 B;  3IIY A;  4MMZ A;  3E0C A;  1T2X A;  5GSA A;  1JMX B;  5I5I A;  3RMZ D;  5H14 A;  2YBA A;  2OK4 A;  2EID A;  4BUJ C;  1H2Y A;  5EMK B;  3KRX B;  3EI2 A;  2HKM A;  3PXT D;  3KRW B;  4NEN A;  4JSN C;  5K19 A;  1VZ3 A;  2B5N A;  4OWR A;  4Z7Q A;  5GMK n;  4NBM A;  5CYK B;  2QXV A;  1E5T A;  4U7A A;  3EQ9 A;  4BCC A;  2VDM A;  1GG2 B;  1PI6 A;  2J56 H;  3QHY B;  3GD1 I;  4CI2 A;  4D0K A;  4FA1 D;  5M5S A;  2XYI A;  4X60 B;  3BWS A;  2H14 A;  3UVL A;  3MKS B;  5AJA A;  2CO0 A;  4DNV A;  4FWW A;  1K3I A;  5IGQ A;  5CXB A;  3J81 g;  3MMY A;  4E5Z B;  2VDQ A;  3K26 A;  3GRE A;  4J82 A;  3P4F A;  1FWX A;  1MDA H;  2HU8 A;  2H6N A;  3F3F A;  3RRM C;  2EIC A;  4FAV D;  1GP2 B;  3V4V A;  4ZOV A;  3V5W B;  4CI3 A;  3RLM D;  4A11 B;  4CY2 A;  4A0A B;  4NSX A;  3AH8 B;  3ZE0 A;  4A08 B;  1H2W A;  2HKR A;  4GQB B;  5SXM A;  2H47 A;  1U2V C;  2P9U C;  5TEE A;  4BP9 A;  2OVR B;  3PVW B;  5HE2 B;  4GQ2 P;  2H9N A;  3IJ1 A;  1JTD B;  3W15 A;  4U1E I;  1QFM A;  1L5G A;  2AGY A;  3OL2 A;  3EMH A;  5EAR A;  1YFQ A;  5EAM A;  4K3J B;  4JSX C;  2AGW A;  1U4C A;  4RE6 A;  2QC5 A;  5M61 A;  3IUQ A;  3MXX A;  1UOQ A;  1JV2 A;  3C75 H;  2G99 A;  3ZDY A;  3PVU B;  3CIK B;  5TDH B;  4IRZ A;  2UZX B;  5CXC A;  2P9P C;  3JRO A;  3EG6 A;  5GXH A;  2Q7Q A;  2Z2P A;  3BG0 A;  5FKT A;  4O1Q D;  4O02 A;  4ES0 A;  4G55 A;  3PXS D;  4GGD A;  4PBY A;  2XZG A;  5EML B;  3RFG A;  4L3H D;  3NID A;  4JD2 C;  4PNK B;  1SQJ A;  4L9O A;  2B4E A;  3UR4 A;  4AN1 A;  2H6Q A;  4A0B B;  1PGU A;  4QQE A;  3F3P A;  5EM2 B;  5IC7 A;  4JSP C;  2I0S A;  4GM3 A;  4X63 B;  4WK2 A;  1K8K C;  2VDK A;  2CE9 A;  3OKY B;  3FM0 A;  1UOP A;  2I0T A;  2QR5 A;  2H3X A;  2PM9 B;  2WQ8 A;  5TEF A;  4QRJ A;  3QI0 A;  2BKL A;  3BG1 A;  3EI4 A;  5M5T A;  3EI1 A;  3EWE A;  3L4O D;  1E8M A;  3V9F A;  2O9K A;  5E6U A;  3O4G A;  1TBG A;  4UI9 R;  4Z8L A;  3RN1 D;  3O4H A;  4GGC A;  2VC2 A;  1R5M A;  4Y7R A;  2AGX A;  4GGA A;  5HQG A;  2B5L A;  2H68 A;  4CZX A;  1JJU B;  3ZE2 A;  5GXI A;  1ERJ A;  3CFS B;  3FRX A;  4AMZ A;  3SCY A;  3U4Y A;  4NC4 A;  2CN3 A;  2IWK A;  4IA9 A;  5CYK A;  3UKU C;  4BL0 A;  2OVP B;  2QZP A;  3IJC A;  4GM8 A;  4CZV A;  5C9Z B;  2CE8 A;  2VDP A;  1E8N A;  1JMZ B;  2EBS A;  3FCU A;  2XL2 A;  3I8C A;  1B9Y A;  4O9D A;  4ZOZ A;  1SQ9 A;  1N6D A;  3HFQ A;  4J8B A;  3EU7 A;  5HE3 B;  2Z2N A;  4ZOX A;  3T3P A;  4BCB A;  5EMJ B;  4FA4 D;  1VE6 A;  2HES X;  4J78 A;  1GOT B;  2J57 G;  5I5J A;  2Z2O A;  2AH1 A;  3EQ8 A;  4H5I A;  2YNP A;  5K1C C;  2IUP A;  1JOF A;  1O6G A;  4J84 A;  3UVK A;  3I7P A;  3ODT A;  3C9C A;  3OKT A;  4X3E A;  2HYE A;  5B4W A;  4QL1 A;  5E6R A;  4Y5R D;  5CXB B;  5E6S A;  3JPX A;  4FB1 D;  2I0R A;  4A09 A;  2H13 A;  5FA5 B;  4GM9 A;  4DNW A;  5H17 A;  4LG9 A;  3IVM A;  4FA5 D;  2H9L A;  3FCS A;  1U8C A;  1VZ2 A;  4ERY A;  5M5V A;  3GC3 B;  3OTT A;  4J87 A;  1A0R B;  3UKR C;  1VE7 A;  5H1M A;  2HU5 A;  2CNX A;  1N6E A;  4PC0 A;  4A2L A;  3F3G A;  4UM8 A;  4WK0 A;  3ZE1 A;  2EIB A;  2OK6 A;  4AEZ A;  2VDO A;  3IIW A;  3PXW D;  3RSE C;  4MMY A;  3I7O A;  3OL2 B;  2I3T A;  3JZG A;  3JZH A;  1NR0 A;  4CZY A;  3SLE D;  1BPO A;  3IUJ A;  3JAM g;  4ERQ A;  4CY3 A;  3I7N A;  3I7K A;  3VA6 A;  2IWF A;  5M5U A;  2CO0 C;  5C2W B;  5JWZ A;  4CY5 A;  3OW8 A;  4PBZ A;  2BBK H;  4QAM A;  4J73 A;  1PEV A;  2XDW A;  2YB8 B;  4JSV C;  1C9L A;  3MKQ A;  4WK4 A;  3SVW D;  4L1M A;  2YMU A;  5CXC B;  3IUM A;  3SMR A;  5HDB A;  4A0B A;  3IUL A;  2OVQ B;  2AH0 A;  2EIE A;  2IUQ A;  3MZK A;  3ZDZ A;  4XEI C;  4E54 A;  3T3M A;  3PSL A;  1H2Z A;  2W18 A;  2XL3 A;  3PE7 A;  2HJB A;  4J86 A;  5AFU 3;  4AN0 A;  4JHP C;  2P9K C;  1XKS A;  1XIP A;  2H9P A;  3OKY A;  1K32 A;  3B7F A;  4J79 A;  4GZ8 A;  5FQD A;  3N0D A;  4HDJ A;  4L3G D;  3AL8 B;  3SBP A;  2UZY B;  3OF7 A;  3SN6 B;  1XHM A;  3EI3 A;  4O45 A;  5FLX g;  3ORV D;  3SBQ A;  3AFC A;  1UTC A;  3RN0 D;  2VZ1 A;  2MTA H;  2VZ3 A;  3DXK C;  4MMX A;  4Z7O A;  1TYE A;  3IJE A;  3ZDX A;  2HXC A;  1UOO A;  2H6K A;  5IJ7 E;  3O4I A;  2TRC B;  2IUV A;  5IGO A;  1OMW B;  3V4P A;  4CC9 A;  3VI3 A;  2IUR A;  2AQ5 A;  3MUO A;  3EI4 B;  4QT8 A;  1GOH A;  3SHF A;  3EI1 B;  4Z7N A;  5FFG A;  3SXT D;  4XYI A;  3O4J A;  4L1Q D;  3AL9 A;  4BP8 A;  3C99 A;  3NVX A;  3DSM A;  2HU7 A;  3EI2 B;  3ZWL B;  3UVN A;  4CI1 A;  3JB9 L;  1PBY B;  3C5M A;  4O3T B;  4R7A B;  5C2V B;  3K27 A;  3KCI A;  5IJ8 E;  3IUN A;  3VH0 A;  3L4M D;  3MVD K;  3V7D B;  5FKS A;  4E5Z A;  3J80 g;  3DDU A;  3VI4 A;  2XU7 A;  4DNU A;  4CI8 A;  5TF2 A;  2GC4 A;  3SBR A;  2J55 H;  2PM6 B;  4JHN A;  4O3U B;  4J0X A;  3EQ7 A;  1S4U X;  4ZN4 A;  4LG8 A;  1O6F A;  2H9M A;  4A11 A;  3UVM A;  4A0A A;  2VDN A;  1VYH C;  4A08 A; 
#chains in the Genus database with same CATH homology
 2VDR A;  2VDO A;  2VC2 A;  4MMY A;  5HDB A;  3ZDY A;  4NEN A;  2VDL A;  3NIG A;  3FCS A;  4MMX A;  4Z7O A;  3IJE A;  1TYE A;  2VDQ A;  4IRZ A;  4WK2 A;  3ZDX A;  1U8C A;  3T3P A;  3ZDZ A;  2VDK A;  4Z7Q A;  3K71 A;  3T3M A;  1L5G A;  3V4P A;  3ZE2 A;  3VI3 A;  3V4V A;  4O02 A;  3VI4 A;  3K72 A;  2VDM A;  4Z7N A;  5FFG A;  3NIF A;  1M1X A;  3ZE1 A;  5FFO A;  4G1M A;  4G1E A;  3NID A;  3ZE0 A;  2VDP A;  3K6S A;  4UM9 A;  4MMZ A;  4UM8 A;  4WK0 A;  2VDN A;  4WJK A;  4WK4 A;  5E6R A;  3FCU A;  5E6U A;  5E6S A;  1JV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...