4Z7QA

Integrin alphaiibbeta3 in complex with agdv-nh2 peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
454
structure length
454
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
molecule tags Membrane protein/immune system
source organism Homo sapiens
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
total genus 102
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 4z7qA00
3NIDA 4G1EA 5E6SA 4Z7OA 3V4VA 2VDLA 3T3PA 3K72A 3VI3A 3K71A 3ZE0A 3T3MA 4WJKA 3FCSA 3ZE1A 4Z7QA 3ZDZA 3ZDYA 4O02A 1JV2A 3ZE2A 2VDKA 1L5GA 2VDRA 3ZDXA 4IRZA 4MMYA 4G1MA 3IJEA 3K6SA 2VDPA 1U8CA 4NENA 5FFGA 2VDQA 4WK2A 4Z7NA 2VDOA 4MMXA 3NIFA 3FCUA 4UM9A 4UM8A 2VDNA 3V4PA 4MMZA 4WK4A 5HDBA 1TYEA 3NIGA 2VDMA 5FFOA 5E6UA 3VI4A 1M1XA 4WK0A 5E6RA 2VC2A
chains in the Genus database with same CATH superfamily
3NIDA 5H17A 1MG2A 4ZOZA 2H13A 3IUJA 3V5WB 1QNIA 5KDOB 5HQGA 2G99A 3CIKB 4MMYA 4O3TB 4GZ8A 4UI9R 1OMWB 2Z2NA 3CFSB 4NAAA 4EWRA 5EMLB 4UM9A 4ESGA 1P22A 3SVWD 1TYEA 3V7DB 4J73A 3JZGA 4CZVA 4ERQA 3DWLC 1GOTB 2HESX 2PM7B 2Z2OA 5E6RA 4FA1D 5E6SA 2H6NA 3I7PA 2CO0C 4G56B 1E8MA 2XYIA 2J57G 4ZOVA 2W18A 4O02A 3ZE2A 3JB9L 2CNXA 4J77A 1L5GA 2P9SC 3JZHA 3MMYA 3EU7A 2GC7A 3I7KA 1PEVA 1K3IA 4GM9A 4GMBA 4ERYA 3MZKA 4MMZA 4J8GA 2H68A 4ES0A 4FB1D 2IUVA 3UVKA 5M5SA 4CY3A 2P9UC 3RLMD 3NVNA 4JHPC 3FRXA 3MXXA 5M5RA 5CXCB 4O3UB 2AGWA 2OIZA 3I7OA 3A0FA 3CFVA 3PSLA 3O4IA 2YNPA 5CYKA 5C2WB 3F3GA 4JSVC 4H5JA 2CN3A 4BCDA 2VDNA 4WK4A 4L1MA 3VGZA 4KFMB 1OLZA 3EI1B 3JROA 3PVUB 1UOQA 1MDAH 3I89A 5EAMA 2OJYA 1FWXA 4GM8A 1MG3A 3MKQA 3C5MA 2P9KC 5TF2A 1E5TA 5I5IA 4CI8A 4CI2A 3PXWD 2IUQA 3O4JA 3O4GA 3K26A 5CXCA 4J84A 1JTDB 5IC7A 3OKYA 5EMMB 3PE7A 1I2MB 3EI4A 5FXYA 3PSCB 3RMZD 4FAVD 2VDQA 1E8NA 1JOFA 3EMHA 4JSPC 3IUMA 3UKRC 3JZNA 4CI1A 4A08B 3KRXB 1M1XA 4LG8A 4GQ1A 3L4MD 5EMKB 3V4VA 4J78A 2VDLA 3K71A 3I7LA 2B4EA 4Y7RA 4A0BA 3OKWA 2XU7A 3C75H 5FKQA 5AMSA 3EWEA 3KCIA 5AFU3 4IMMA 3MKSB 4J8BA 3ZDXA 2B5LA 1XHMA 5CXBB 1UOPA 5I5JA 4J0WA 2BKLA 3JPXA 5HE3B 3EI2B 5THAA 3AL8A 3ODTA 3E0CA 4FA9D 3EI2A 1B9YA 4J0XA 3EQ8A 5E6UA 3IKOA 4QL1A 3AFCA 3UVMA 1QFMA 4FWWA 2VC2A 1N6EA 3OTTA 5IGOA 1PI6A 3C99A 3N0DA 2IWKA 2HU8A 4R7AB 3PVWB 1JV2A 2UZXB 2BBKH 4E5ZB 2IURA 4BL0A 2H9NA 4PSWB 1UOOA 3PXSD 3IJ0A 4J87A 2CE9A 3MUNA 2VDOA 1XIPA 2I3TA 5IT9g 3EI3B 3AH8B 4GQBB 4Y5RD 4DNVA 4E54A 4CY2A 2O9KA 1T2XA 2XL2A 4O45A 1VE6A 1U4CA 5M5UA 1SHYB 3SWSD 4WJKA 4A0BB 2QR5A 3SFZA 3OF7A 4GGDA 2UZYB 3SLED 4A11B 2P9IC 4RE6A 2BCJB 2GNQA 1N6FA 4QQEA 3SJLD 3RRMC 2QZPA 4FA4D 4NENA 1TBGA 4A2LA 5TEFA 3DDUA 3DXMC 3FGBA 3IJCA 4K3ID 4FAND 2AGYA 4U7AA 2YMUA 1GOGA 4X3EA 5B4WA 3IUQA 3EI3A 3T3MA 3FCSA 5FLXg 3JRPA 3EG6A 4JXMA 4FA5D 4GQ2P 1U2VC 4X60B 4K3JB 2VDRA 2OVRB 3MVDK 4J79A 3SBQA 5M5VA 1L0QA 2VZ3A 3SHFA 3GREA 4O9DA 4CY5A 3DSMA 1A0RB 3OKYB 4MMXA 5JWZA 3FCUA 2VZ1A 4XYIA 4AEZA 5EARA 2YBAA 4HDJA 5IGQA 4A08A 3IJ1A 5HE1B 3F3PA 4BH6A 1VYHC 4GGAA 4DNUA 5CXBA 3EI4B 5TEEA 5GXHA 2EIDA 2WQ8A 2P9NC 3GD1I 4PC0A 2VDPA 3J80g 4NC4A 5FKTA 3PXTD 5AJAA 3BWSA 5C92A 4L9OA 2XE4A 4AN0A 3NIFA 1NEXB 3RFHA 4FHLA 3QI0A 2H6QA 3IUNA 2EICA 2Q7QA 3ULEC 2I0TA 2HJBA 3BG0A 3EI1A 3I7HA 3ZE0A 4A2MA 4GGCA 5C86A 1O6GA 4QT8A 2HU7A 1R5MA 4IA9A 4JHNA 2EIEA 2HKRA 4LGNA 4ZN4A 4AN1A 3RSEC 4AMYA 5K19A 1VE7A 2B5MA 2OK4A 3C9CA 2CN2A 2IUPA 3F3FA 5HDBA 4RE5A 1GG2B 3K27A 2B5NA 3I2NA 3NVXA 4JD2C 4G1EA 2P9PC 3J81g 3T3PA 4L3GD 3DXKC 4PNKB 3OKTA 2PBIB 2JKXA 3ORVD 3ZE1A 3UVOA 4AMZA 4A0AA 2VDKA 5SXMA 1JMZB 2IAAA 5HE0B 5A2Qg 1XKSA 2H3XA 2H14A 1H2YA 2TRCB 3OL2A 4WK2A 4JSNC 3AL9A 5EM2A 3UVLA 2QXVA 4GM3A 2VDMA 1O6FA 3I8CA 1GOFA 1K32A 1GXRA 1YFQA 2AGZA 1Q47A 4PBZA 3U4YA 4NSXA 3N0EA 4J86A 4XEIC 1NR0A 5M5TA 3IULA 2QC5A 1H2WA 1VZ2A 1GOHA 3MUOA 2CO0A 3ZDYA 1TYQC 3ZDZA 4CZYA 3OW8A 4PBYA 2G9AA 2Z2PA 4QAMA 1SQJA 5HYNB 3K6SA 2PM6B 3RN0D 4NBMA 4JT5C 4D6VA 4ZOYA 4O2WA 3QHYB 1PBYB 5H1MA 4L3HD 2XL3A 2IWFA 3SMRA 2AGLA 5CYKB 2J55H 4QRJA 4BUJC 3NVQA 4MK0B 4A7JA 2YNNA 1ERJA 5FKSA 2MTAH 4BP9A 3IURA 5TDHB 5H14A 2H9MA 1B9XA 4J82A 2H6KA 4L1QD 3P4FA 5EALA 5HE2B 2I0SA 5EAPA 1JMXB 5EM2B 4J81A 2XDWA 4TZ4A 1A12A 3SBPA 3VA6A 4IRZA 3RN1D 1QFSA 5GMKn 2OVQB 1PGUA 3SCYA 3EQ9A 2OVPB 4O1QD 3DM0A 4Z7NA 2HU5A 1C9IA 3V4PA 1JJUB 5C9ZB 3NIGA 5EMJB 2XZGA 1BPOA 3VI4A 2H9PA 2AGXA 4XYHA 4Z7OA 4OZUA 2EBSA 2PM9B 2CE8A 3K72A 4A09A 1H2ZA 1C9LA 4A09B 4N14A 2AH1A 3L4OD 4CY1A 3ZWLB 5K1CC 3MZLA 5IJ8E 3B7FA 3KRWB 3O4HA 3I8EA 4BCBA 3VH0A 4PXWA 4G55A 1SQ9A 4CI3A 1GP2B 5FFOA 4AOWA 3GFCA 4WK0A 2EIBA 5FKRA 4DNWA 4AX4A 3VI3A 4H5IA 5FA5B 3W15A 4A11A 3GC3B 5GXIA 3EQ7A 2I0RA 2YB8B 5IJ7E 5M61A 4G1MA 2H9LA 3IJEA 4D0KA 4X63B 1U8CA 4CZXA 2HJ4A 5FFGA 1RI6A 1UTCA 5FQDA 3V9FA 2PM9A 5GSAA 3I7NA 2J56H 4Z8LA 3SBRA 2YNOA 2AH0A 3UKUC 2P9LC 2GC4A 4BP8A 3JAMg 2HKMA 3RFGA 4JSXC 4U1EI 3SXTD 4ERZA 4LG9A 3IVMA 2H47A 4BCCA 2AQ5A 4E5ZA 3IIYA 1VZ3A 2I3SA 3HFQA 4Z7QA 4A0AB 4PSXB 1S4UX 4X61B 1N6DA 3UR4A 5I5MA 2OK6A 4YVDA 3OL2B 3BG1A 3IIWA 1YR2A 4ZOXA 4UM8A 2HYEA 3FM0A 4E54B 2HXCA 1K8KC 1H2XA 3AL8B 3SN6B 4D9SA 4CC9A 5C2VB 4JT6C 4I79A 4OWRA 3UVNA
chains in the Genus database with same CATH topology
3NIDA 4G1EA 5E6SA 4Z7OA 3V4VA 2VDLA 3T3PA 3K72A 3VI3A 3K71A 3ZE0A 3T3MA 4WJKA 3FCSA 3ZE1A 4Z7QA 3ZDZA 3ZDYA 4O02A 1JV2A 3ZE2A 2VDKA 1L5GA 2VDRA 3ZDXA 4IRZA 4MMYA 4G1MA 3IJEA 3K6SA 2VDPA 1U8CA 4NENA 5FFGA 2VDQA 4WK2A 4Z7NA 2VDOA 4MMXA 3NIFA 3FCUA 4UM9A 4UM8A 2VDNA 3V4PA 4MMZA 4WK4A 5HDBA 1TYEA 3NIGA 2VDMA 5FFOA 5E6UA 3VI4A 1M1XA 4WK0A 5E6RA 2VC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NID A;  4G1E A;  5E6S A;  4Z7O A;  3V4V A;  2VDL A;  3T3P A;  3K72 A;  3VI3 A;  3K71 A;  3ZE0 A;  3T3M A;  4WJK A;  3FCS A;  3ZE1 A;  4Z7Q A;  3ZDZ A;  3ZDY A;  4O02 A;  1JV2 A;  3ZE2 A;  2VDK A;  1L5G A;  2VDR A;  3ZDX A;  4IRZ A;  4MMY A;  4G1M A;  3IJE A;  3K6S A;  2VDP A;  1U8C A;  4NEN A;  5FFG A;  2VDQ A;  4WK2 A;  4Z7N A;  2VDO A;  4MMX A;  3NIF A;  3FCU A;  4UM9 A;  4UM8 A;  2VDN A;  3V4P A;  4MMZ A;  4WK4 A;  5HDB A;  1TYE A;  3NIG A;  2VDM A;  5FFO A;  5E6U A;  3VI4 A;  1M1X A;  4WK0 A;  5E6R A;  2VC2 A; 
#chains in the Genus database with same CATH topology
 3NID A;  5H17 A;  1MG2 A;  4ZOZ A;  2H13 A;  3IUJ A;  3V5W B;  1QNI A;  5KDO B;  5HQG A;  2G99 A;  3CIK B;  4MMY A;  4O3T B;  4GZ8 A;  4UI9 R;  1OMW B;  2Z2N A;  3CFS B;  4NAA A;  4EWR A;  5EML B;  4UM9 A;  4ESG A;  1P22 A;  3SVW D;  1TYE A;  3V7D B;  4J73 A;  3JZG A;  4CZV A;  4ERQ A;  3DWL C;  1GOT B;  2HES X;  2PM7 B;  2Z2O A;  5E6R A;  4FA1 D;  5E6S A;  2H6N A;  3I7P A;  2CO0 C;  4G56 B;  1E8M A;  2XYI A;  2J57 G;  4ZOV A;  2W18 A;  4O02 A;  3ZE2 A;  3JB9 L;  2CNX A;  4J77 A;  1L5G A;  2P9S C;  3JZH A;  3MMY A;  3EU7 A;  2GC7 A;  3I7K A;  1PEV A;  1K3I A;  4GM9 A;  4GMB A;  4ERY A;  3MZK A;  4MMZ A;  4J8G A;  2H68 A;  4ES0 A;  4FB1 D;  2IUV A;  3UVK A;  5M5S A;  4CY3 A;  2P9U C;  3RLM D;  3NVN A;  4JHP C;  3FRX A;  3MXX A;  5M5R A;  5CXC B;  4O3U B;  2AGW A;  2OIZ A;  3I7O A;  3A0F A;  3CFV A;  3PSL A;  3O4I A;  2YNP A;  5CYK A;  5C2W B;  3F3G A;  4JSV C;  4H5J A;  2CN3 A;  4BCD A;  2VDN A;  4WK4 A;  4L1M A;  3VGZ A;  4KFM B;  1OLZ A;  3EI1 B;  3JRO A;  3PVU B;  1UOQ A;  1MDA H;  3I89 A;  5EAM A;  2OJY A;  1FWX A;  4GM8 A;  1MG3 A;  3MKQ A;  3C5M A;  2P9K C;  5TF2 A;  1E5T A;  5I5I A;  4CI8 A;  4CI2 A;  3PXW D;  2IUQ A;  3O4J A;  3O4G A;  3K26 A;  5CXC A;  4J84 A;  1JTD B;  5IC7 A;  3OKY A;  5EMM B;  3PE7 A;  1I2M B;  3EI4 A;  5FXY A;  3PSC B;  3RMZ D;  4FAV D;  2VDQ A;  1E8N A;  1JOF A;  3EMH A;  4JSP C;  3IUM A;  3UKR C;  3JZN A;  4CI1 A;  4A08 B;  3KRX B;  1M1X A;  4LG8 A;  4GQ1 A;  3L4M D;  5EMK B;  3V4V A;  4J78 A;  2VDL A;  3K71 A;  3I7L A;  2B4E A;  4Y7R A;  4A0B A;  3OKW A;  2XU7 A;  3C75 H;  5FKQ A;  5AMS A;  3EWE A;  3KCI A;  5AFU 3;  4IMM A;  3MKS B;  4J8B A;  3ZDX A;  2B5L A;  1XHM A;  5CXB B;  1UOP A;  5I5J A;  4J0W A;  2BKL A;  3JPX A;  5HE3 B;  3EI2 B;  5THA A;  3AL8 A;  3ODT A;  3E0C A;  4FA9 D;  3EI2 A;  1B9Y A;  4J0X A;  3EQ8 A;  5E6U A;  3IKO A;  4QL1 A;  3AFC A;  3UVM A;  1QFM A;  4FWW A;  2VC2 A;  1N6E A;  3OTT A;  5IGO A;  1PI6 A;  3C99 A;  3N0D A;  2IWK A;  2HU8 A;  4R7A B;  3PVW B;  1JV2 A;  2UZX B;  2BBK H;  4E5Z B;  2IUR A;  4BL0 A;  2H9N A;  4PSW B;  1UOO A;  3PXS D;  3IJ0 A;  4J87 A;  2CE9 A;  3MUN A;  2VDO A;  1XIP A;  2I3T A;  5IT9 g;  3EI3 B;  3AH8 B;  4GQB B;  4Y5R D;  4DNV A;  4E54 A;  4CY2 A;  2O9K A;  1T2X A;  2XL2 A;  4O45 A;  1VE6 A;  1U4C A;  5M5U A;  1SHY B;  3SWS D;  4WJK A;  4A0B B;  2QR5 A;  3SFZ A;  3OF7 A;  4GGD A;  2UZY B;  3SLE D;  4A11 B;  2P9I C;  4RE6 A;  2BCJ B;  2GNQ A;  1N6F A;  4QQE A;  3SJL D;  3RRM C;  2QZP A;  4FA4 D;  4NEN A;  1TBG A;  4A2L A;  5TEF A;  3DDU A;  3DXM C;  3FGB A;  3IJC A;  4K3I D;  4FAN D;  2AGY A;  4U7A A;  2YMU A;  1GOG A;  4X3E A;  5B4W A;  3IUQ A;  3EI3 A;  3T3M A;  3FCS A;  5FLX g;  3JRP A;  3EG6 A;  4JXM A;  4FA5 D;  4GQ2 P;  1U2V C;  4X60 B;  4K3J B;  2VDR A;  2OVR B;  3MVD K;  4J79 A;  3SBQ A;  5M5V A;  1L0Q A;  2VZ3 A;  3SHF A;  3GRE A;  4O9D A;  4CY5 A;  3DSM A;  1A0R B;  3OKY B;  4MMX A;  5JWZ A;  3FCU A;  2VZ1 A;  4XYI A;  4AEZ A;  5EAR A;  2YBA A;  4HDJ A;  5IGQ A;  4A08 A;  3IJ1 A;  5HE1 B;  3F3P A;  4BH6 A;  1VYH C;  4GGA A;  4DNU A;  5CXB A;  3EI4 B;  5TEE A;  5GXH A;  2EID A;  2WQ8 A;  2P9N C;  3GD1 I;  4PC0 A;  2VDP A;  3J80 g;  4NC4 A;  5FKT A;  3PXT D;  5AJA A;  3BWS A;  5C92 A;  4L9O A;  2XE4 A;  4AN0 A;  3NIF A;  1NEX B;  3RFH A;  4FHL A;  3QI0 A;  2H6Q A;  3IUN A;  2EIC A;  2Q7Q A;  3ULE C;  2I0T A;  2HJB A;  3BG0 A;  3EI1 A;  3I7H A;  3ZE0 A;  4A2M A;  4GGC A;  5C86 A;  1O6G A;  4QT8 A;  2HU7 A;  1R5M A;  4IA9 A;  4JHN A;  2EIE A;  2HKR A;  4LGN A;  4ZN4 A;  4AN1 A;  3RSE C;  4AMY A;  5K19 A;  1VE7 A;  2B5M A;  2OK4 A;  3C9C A;  2CN2 A;  2IUP A;  3F3F A;  5HDB A;  4RE5 A;  1GG2 B;  3K27 A;  2B5N A;  3I2N A;  3NVX A;  4JD2 C;  4G1E A;  2P9P C;  3J81 g;  3T3P A;  4L3G D;  3DXK C;  4PNK B;  3OKT A;  2PBI B;  2JKX A;  3ORV D;  3ZE1 A;  3UVO A;  4AMZ A;  4A0A A;  2VDK A;  5SXM A;  1JMZ B;  2IAA A;  5HE0 B;  5A2Q g;  1XKS A;  2H3X A;  2H14 A;  1H2Y A;  2TRC B;  3OL2 A;  4WK2 A;  4JSN C;  3AL9 A;  5EM2 A;  3UVL A;  2QXV A;  4GM3 A;  2VDM A;  1O6F A;  3I8C A;  1GOF A;  1K32 A;  1GXR A;  1YFQ A;  2AGZ A;  1Q47 A;  4PBZ A;  3U4Y A;  4NSX A;  3N0E A;  4J86 A;  4XEI C;  1NR0 A;  5M5T A;  3IUL A;  2QC5 A;  1H2W A;  1VZ2 A;  1GOH A;  3MUO A;  2CO0 A;  3ZDY A;  1TYQ C;  3ZDZ A;  4CZY A;  3OW8 A;  4PBY A;  2G9A A;  2Z2P A;  4QAM A;  1SQJ A;  5HYN B;  3K6S A;  2PM6 B;  3RN0 D;  4NBM A;  4JT5 C;  4D6V A;  4ZOY A;  4O2W A;  3QHY B;  1PBY B;  5H1M A;  4L3H D;  2XL3 A;  2IWF A;  3SMR A;  2AGL A;  5CYK B;  2J55 H;  4QRJ A;  4BUJ C;  3NVQ A;  4MK0 B;  4A7J A;  2YNN A;  1ERJ A;  5FKS A;  2MTA H;  4BP9 A;  3IUR A;  5TDH B;  5H14 A;  2H9M A;  1B9X A;  4J82 A;  2H6K A;  4L1Q D;  3P4F A;  5EAL A;  5HE2 B;  2I0S A;  5EAP A;  1JMX B;  5EM2 B;  4J81 A;  2XDW A;  4TZ4 A;  1A12 A;  3SBP A;  3VA6 A;  4IRZ A;  3RN1 D;  1QFS A;  5GMK n;  2OVQ B;  1PGU A;  3SCY A;  3EQ9 A;  2OVP B;  4O1Q D;  3DM0 A;  4Z7N A;  2HU5 A;  1C9I A;  3V4P A;  1JJU B;  5C9Z B;  3NIG A;  5EMJ B;  2XZG A;  1BPO A;  3VI4 A;  2H9P A;  2AGX A;  4XYH A;  4Z7O A;  4OZU A;  2EBS A;  2PM9 B;  2CE8 A;  3K72 A;  4A09 A;  1H2Z A;  1C9L A;  4A09 B;  4N14 A;  2AH1 A;  3L4O D;  4CY1 A;  3ZWL B;  5K1C C;  3MZL A;  5IJ8 E;  3B7F A;  3KRW B;  3O4H A;  3I8E A;  4BCB A;  3VH0 A;  4PXW A;  4G55 A;  1SQ9 A;  4CI3 A;  1GP2 B;  5FFO A;  4AOW A;  3GFC A;  4WK0 A;  2EIB A;  5FKR A;  4DNW A;  4AX4 A;  3VI3 A;  4H5I A;  5FA5 B;  3W15 A;  4A11 A;  3GC3 B;  5GXI A;  3EQ7 A;  2I0R A;  2YB8 B;  5IJ7 E;  5M61 A;  4G1M A;  2H9L A;  3IJE A;  4D0K A;  4X63 B;  1U8C A;  4CZX A;  2HJ4 A;  5FFG A;  1RI6 A;  1UTC A;  5FQD A;  3V9F A;  2PM9 A;  5GSA A;  3I7N A;  2J56 H;  4Z8L A;  3SBR A;  2YNO A;  2AH0 A;  3UKU C;  2P9L C;  2GC4 A;  4BP8 A;  3JAM g;  2HKM A;  3RFG A;  4JSX C;  4U1E I;  3SXT D;  4ERZ A;  4LG9 A;  3IVM A;  2H47 A;  4BCC A;  2AQ5 A;  4E5Z A;  3IIY A;  1VZ3 A;  2I3S A;  3HFQ A;  4Z7Q A;  4A0A B;  4PSX B;  1S4U X;  4X61 B;  1N6D A;  3UR4 A;  5I5M A;  2OK6 A;  4YVD A;  3OL2 B;  3BG1 A;  3IIW A;  1YR2 A;  4ZOX A;  4UM8 A;  2HYE A;  3FM0 A;  4E54 B;  2HXC A;  1K8K C;  1H2X A;  3AL8 B;  3SN6 B;  4D9S A;  4CC9 A;  5C2V B;  4JT6 C;  4I79 A;  4OWR A;  3UVN A; 
#chains in the Genus database with same CATH homology
 3NID A;  4G1E A;  5E6S A;  4Z7O A;  3V4V A;  2VDL A;  3T3P A;  3K72 A;  3VI3 A;  3K71 A;  3ZE0 A;  3T3M A;  4WJK A;  3FCS A;  3ZE1 A;  4Z7Q A;  3ZDZ A;  3ZDY A;  4O02 A;  1JV2 A;  3ZE2 A;  2VDK A;  1L5G A;  2VDR A;  3ZDX A;  4IRZ A;  4MMY A;  4G1M A;  3IJE A;  3K6S A;  2VDP A;  1U8C A;  4NEN A;  5FFG A;  2VDQ A;  4WK2 A;  4Z7N A;  2VDO A;  4MMX A;  3NIF A;  3FCU A;  4UM9 A;  4UM8 A;  2VDN A;  3V4P A;  4MMZ A;  4WK4 A;  5HDB A;  1TYE A;  3NIG A;  2VDM A;  5FFO A;  5E6U A;  3VI4 A;  1M1X A;  4WK0 A;  5E6R A;  2VC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...