4FAVD

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 50 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4favD00
5CXBA 3NVXA 5CYKB 2OK4A 5FLXg 2GNQA 5K1CC 1OLZA 2J57G 2IURA 5SXMA 3I8EA 3IJ0A 1L0QA 2B5NA 5B4WA 2HKMA 5I5IA 3A0FA 4PNKB 5GXHA 4A09B 2CO0C 2P9NC 4FA9D 5IGOA 3RLMD 2B5LA 2HESX 4GM8A 5IT9g 4UI9R 2AGYA 3C5MA 5H1MA 4A2LA 4GQ2P 2UZYB 2YMUA 3SJLD 3J81g 2O9KA 4PSWB 2GC4A 2GC7A 4E54A 3I7PA 2H6NA 3KRWB 2CE9A 4PBZA 3I7HA 1PBYB 3BG0A 4J82A 2I3TA 1A0RB 1PGUA 4AOWA 4O3TB 1TYQC 5EMLB 1SQJA 1N6EA 4L1QD 5EMKB 3JAMg 4FAND 4GGDA 4X3EA 1OMWB 3I7NA 4CI8A 3NVQA 2I0TA 3PVWB 4A0BB 2PM6B 1K8KC 2AQ5A 4J0WA 2Z2OA 4OZUA 3JZGA 1N6DA 3MKSB 3MXXA 5CYKA 3MZLA 3V7DB 3SBRA 3JROA 5AMSA 1MG3A 2HJBA 4N14A 5FKRA 5FKQA 4A11B 4O1QD 5FKSA 2H14A 4FWWA 4X60B 5EM2A 4O45A 3GREA 3AL9A 3JRPA 3I7LA 1JJUB 5CXCB 1GOTB 2PM9A 5HE3B 1S4UX 3EU7A 4A0AA 1GXRA 2CN2A 3C9CA 3PXTD 4J77A 3SLED 1VYHC 3HFQA 4L3GD 2B5MA 3JB9L 2AH0A 4A08A 3K27A 1P22A 3RRMC 4U7AA 4X63B 1PEVA 2I0SA 3K26A 2OIZA 3PE7A 4GQ1A 3AL8B 3FRXA 3EI2A 3PSLA 2I3SA 2MTAH 5GSAA 2XU7A 5EARA 3PSCB 5HQGA 3EI4B 3I89A 2BCJB 5THAA 4CZXA 4QL1A 4CZVA 4K3JB 2QXVA 4JT6C 3ZWLB 3VA6A 2B4EA 3EI3B 3C75H 2H3XA 1MG2A 4FA5D 5TF2A 4FAVD 4GM9A 5TDHB 4QT8A 2YBAA 4JSXC 3OKYB 3IIYA 4CI1A 2IUPA 2AGWA 3SCYA 4YVDA 1N6FA 2H68A 2YNOA 1NR0A 3DXKC 3JZHA 4PSXB 2OVQB 3EMHA 3RFHA 3EI1B 2Q7QA 4QRJA 3F3FA 2CO0A 2OK6A 4IMMA 4ZN4A 2H6KA 3SVWD 4D0KA 2EBSA 3UR4A 3L4OD 2H9NA 2H13A 5TEEA 3V9FA 3PVUB 2P9LC 3I7OA 4PC0A 3N0DA 5KDOB 4A11A 3ODTA 2OJYA 5EMMB 4FA1D 3PXWD 3OL2B 3SBPA 3IJ1A 1GG2B 4JD2C 5CXCA 5CXBB 5H17A 4Z8LA 3BWSA 1YFQA 3CIKB 3DXMC 5AJAA 2H47A 4MK0B 2QC5A 2TRCB 4H5JA 4BH6A 4E5ZA 4PBYA 2YB8B 4EWRA 3KRXB 4ERZA 4H5IA 3IIWA 4ZOYA 4QQEA 3AL8A 1JMZB 2J55H 1XIPA 3SWSD 3UVLA 5GXIA 4GMBA 5FA5B 2P9SC 2YNPA 3UKRC 1RI6A 1U4CA 5IJ8E 4J78A 3UVMA 2CN3A 2P9UC 5EMJB 3OKTA 4GGCA 3V5WB 3EWEA 2H9MA 2XL3A 4A09A 3L4MD 4GZ8A 2P9IC 2H6QA 3J80g 4GQBB 4E54B 2Z2NA 3OKYA 5C9ZB 4AEZA 4K3ID 1PI6A 1QNIA 4O9DA 1XKSA 4Y7RA 1XHMA 5HE0B 3DM0A 2P9PC 2I0RA 4CY1A 2XL2A 4U1EI 1Q47A 3EI1A 1GP2B 3VGZA 3F3PA 3IKOA 3SHFA 3JZNA 1B9XA 5FQDA 3UVNA 5EAMA 3P4FA 5HE2B 3DWLC 4J81A 4ZOXA 4L3HD 4G56B 4CZYA 2CNXA 4J84A 3CFSB 1SQ9A 3SMRA 5HE1B 4I79A 3OL2A 1MDAH 1TBGA 3ORVD 4ZOZA 3F3GA 3U4YA 5GMKn 3OTTA 3SN6B 4GGAA 4LGNA 3PXSD 2IWFA 3IJCA 4ES0A 1JOFA 2J56H 2BBKH 5IJ7E 3MMYA 4TZ4A 5EM2B 4A0BA 3MZKA 2OVPB 4FHLA 3RN1D 4J86A 5FXYA 5EALA 3SFZA 2PM9B 5C2VB 3AFCA 4JSPC 2IUQA 2P9KC 4Y5RD 4A0AB 3E0CA 2UZXB 4ERQA 4JSNC 2AGLA 2PM7B 4HDJA 3DSMA 3UVOA 4A08B 3UKUC 3N0EA 5H14A 5A2Qg 3VH0A 2Z2PA 2HXCA 3AH8B 4R7AB 3W15A 1ERJA 3SBQA 2HYEA 4CI2A 3EI2B 3UVKA 3RSEC 2IWKA 4KFMB 5FKTA 2HJ4A 5EAPA 4XYHA 3RFGA 2YNNA 4JXMA 4CC9A 2IAAA 2H9LA 2HKRA 3I7KA 5IGQA 5K19A 4LG9A 4J0XA 3SXTD 4NSXA 4ERYA 3FGBA 3FM0A 4XEIC 2XYIA 4L9OA 3ULEC 3CFVA 3BG1A 4J8BA 2AGXA 3I2NA 2AGZA 5I5MA 4A7JA 2AH1A 5AFU3 4FB1D 1FWXA 2W18A 5HYNB 3EI4A 5TEFA 5I5JA 4D6VA 4CI3A 4J8GA 3EI3A 4J79A 2IUVA 4CY3A 3I8CA 4FA4D 1K32A 5JWZA 4BL0A 4X61B 4BUJC 4CY2A 4ESGA 4PXWA 3B7FA 4J73A 1SHYB 3JPXA 4CY5A 1NEXB 5IC7A 3OW8A 4LG8A 4JSVC 4GM3A 3C99A 1U2VC 1JMXB 2OVRB 3MKQA 2CE8A 1R5MA 3GFCA 4OWRA 2G99A 3RMZD 1B9YA 5C2WB 4J87A 2PBIB 4E5ZB 3NVNA 4ZOVA 2G9AA 4IA9A 3RN0D 4A2MA 2H9PA 4O3UB 4JT5C 3OKWA 4XYIA 3EG6A
chains in the Genus database with same CATH superfamily
5CXBA 3NVXA 4Z7QA 5CYKB 2OK4A 4BP9A 3OF7A 5FLXg 2VC2A 2GNQA 5K1CC 1OLZA 2J57G 4G1EA 4NAAA 2IURA 5SXMA 3I8EA 3IJ0A 2EICA 1L0QA 3IUJA 4DNVA 2B5NA 4IRZA 5B4WA 2HKMA 5I5IA 3A0FA 4PNKB 5GXHA 3NIDA 5M5UA 4A09B 2CO0C 2P9NC 4FA9D 3IURA 1O6GA 5IGOA 3RLMD 2B5LA 2HESX 1TYEA 4JHNA 4GM8A 1E5TA 5IT9g 4UI9R 2AGYA 2VZ3A 3C5MA 5HDBA 4UM8A 4AMYA 5H1MA 3EQ9A 4A2LA 4WK4A 4GQ2P 2UZYB 2YMUA 3SJLD 3J81g 2O9KA 3FCUA 4PSWB 2GC4A 2GC7A 4E54A 3I7PA 2H6NA 3KRWB 2CE9A 1VE6A 3V4VA 4PBZA 3I7HA 1PBYB 3BG0A 4J82A 3ZDXA 2I3TA 5FFGA 3O4JA 2HU5A 1A0RB 1PGUA 3IUNA 4AOWA 4O3TB 4BCBA 1TYQC 5EMLB 4O02A 1SQJA 1N6EA 4L1QD 5EMKB 3JAMg 4FAND 4D9SA 4AX4A 1O6FA 4GGDA 4X3EA 1OMWB 3I7NA 4CI8A 2HU7A 2I0TA 3NVQA 3PVWB 4A0BB 2PM6B 3EQ7A 1K8KC 2AQ5A 4J0WA 2VDKA 2Z2OA 4OZUA 3JZGA 1N6DA 3MKSB 3MXXA 5CYKA 3MZLA 3V7DB 3SBRA 3JROA 2XE4A 2XZGA 2VDMA 4WK2A 5AMSA 1MG3A 2HJBA 4N14A 5FKRA 5FKQA 4A11B 4O1QD 1UOQA 5FKSA 2H14A 4FWWA 4X60B 5EM2A 4O45A 3GREA 3AL9A 3JRPA 3I7LA 1JJUB 5CXCB 1GOTB 2PM9A 5HE3B 1S4UX 3EU7A 4A0AA 1GXRA 2CN2A 3C9CA 3PXTD 4J77A 3SLED 2XDWA 1VYHC 3HFQA 4L3GD 2B5MA 3JB9L 2AH0A 4A08A 3K27A 1P22A 3RRMC 4U7AA 1YR2A 4X63B 1PEVA 4BCCA 2I0SA 3K26A 2OIZA 3PE7A 4GQ1A 3AL8B 3FRXA 3EI2A 3IULA 3PSLA 2I3SA 1UOPA 3T3PA 2MTAH 5GSAA 4AN0A 2XU7A 5EARA 3PSCB 5HQGA 1L5GA 3EI4B 3I89A 2BCJB 5THAA 4CZXA 4QL1A 4CZVA 4K3JB 2QXVA 4JT6C 3ZWLB 3K71A 3VA6A 2B4EA 3EI3B 3C75H 2H3XA 1C9IA 5M5RA 1MG2A 3O4IA 5TF2A 4BCDA 4FA5D 3QI0A 4FAVD 4GM9A 5TDHB 4BP8A 4QT8A 1QFSA 2YBAA 4JSXC 2EIEA 3OKYB 3IIYA 1I2MB 4MMZA 5C86A 4CI1A 2IUPA 2AGWA 3SCYA 4NENA 5M5TA 1H2ZA 4YVDA 1N6FA 2H68A 4RE6A 2YNOA 1NR0A 3DXKC 3JZHA 4AMZA 4PSXB 2OVQB 3EMHA 3RFHA 3EI1B 2Q7QA 4QRJA 3F3FA 2CO0A 5FFOA 2JKXA 2OK6A 2VZ1A 4IMMA 4ZN4A 2H6KA 3SVWD 4Z7NA 4D0KA 2EBSA 3UR4A 3L4OD 2H9NA 3ZE1A 2H13A 5TEEA 3V9FA 3PVUB 2P9LC 3I7OA 4PC0A 3N0DA 5KDOB 4A11A 3ODTA 2OJYA 5EMMB 4FA1D 3PXWD 3OL2B 3DDUA 3SBPA 3IJ1A 1H2WA 1GG2B 4JD2C 5CXCA 5CXBB 4G1MA 3MVDK 5H17A 4QAMA 4Z8LA 3BWSA 1YFQA 3CIKB 3DXMC 5AJAA 2H47A 4UM9A 3GD1I 4JHPC 4MK0B 2QC5A 2TRCB 2VDQA 4H5JA 4BH6A 4E5ZA 1K3IA 4PBYA 2YB8B 4EWRA 3KRXB 4ERZA 4H5IA 3IIWA 2EIDA 4ZOYA 4QQEA 3AL8A 1JMZB 2J55H 1XIPA 3SWSD 3UVLA 1JV2A 3O4HA 5GXIA 4GMBA 1GOGA 5FA5B 2P9SC 2YNPA 4MMYA 4RE5A 3UKRC 1RI6A 1U4CA 2WQ8A 3T3MA 5IJ8E 2QR5A 4J78A 2BKLA 3ZE2A 1QFMA 3UVMA 2CN3A 1U8CA 3K72A 2P9UC 5EMJB 2VDRA 3OKTA 4GGCA 1UOOA 3V5WB 3EWEA 4DNWA 2H9MA 2XL3A 4A09A 3GC3B 5M61A 3L4MD 3O4GA 4GZ8A 2P9IC 2H6QA 3J80g 4GQBB 4E54B 2Z2NA 3OKYA 5C9ZB 4AEZA 3ZDYA 3ZDZA 4K3ID 1PI6A 1QNIA 4O9DA 1XKSA 1VZ2A 4Y7RA 5M5SA 1XHMA 5HE0B 3DM0A 2P9PC 2I0RA 4CY1A 2XL2A 1H2YA 1Q47A 4U1EI 3EI1A 1GP2B 3VGZA 3FCSA 3F3PA 3IKOA 3SHFA 3JZNA 1B9XA 5FQDA 3UVNA 5EAMA 3P4FA 5HE2B 3DWLC 4J81A 4ZOXA 3IVMA 4L3HD 4WJKA 4G56B 4CZYA 2CNXA 3EQ8A 4J84A 3CFSB 1A12A 1SQ9A 3SMRA 3QHYB 5HE1B 4I79A 3OL2A 1MDAH 1TBGA 1VE7A 3ORVD 4ZOZA 3F3GA 3U4YA 5GMKn 5E6SA 3OTTA 3SN6B 4GGAA 4LGNA 2VDLA 3PXSD 2IWFA 3IJCA 1E8NA 4L1MA 1BPOA 4MMXA 4ES0A 1JOFA 2VDOA 2J56H 3NIGA 2BBKH 5IJ7E 4Z7OA 3MMYA 4TZ4A 5EM2B 4A0BA 3MZKA 2OVPB 4FHLA 3RN1D 1UTCA 2VDNA 4J86A 5FXYA 5EALA 3SFZA 2PM9B 5C2VB 3AFCA 4JSPC 2IUQA 2P9KC 4Y5RD 4A0AB 3E0CA 2UZXB 4ERQA 4JSNC 2AGLA 2PM7B 3MUNA 3DSMA 4HDJA 3UVOA 3NIFA 4A08B 4O2WA 3UKUC 3N0EA 4WK0A 2HU8A 5H14A 5A2Qg 3VH0A 2Z2PA 2HXCA 3AH8B 4R7AB 1C9LA 3W15A 1ERJA 3SBQA 2HYEA 4CI2A 3EI2B 3UVKA 1H2XA 3IUMA 3RSEC 2IWKA 4KFMB 5FKTA 1JTDB 1GOFA 2HJ4A 5EAPA 4XYHA 5C92A 3RFGA 2YNNA 4JXMA 4CC9A 2IAAA 2H9LA 3KCIA 2HKRA 3I7KA 5IGQA 5K19A 4LG9A 4J0XA 3SXTD 4NSXA 3V4PA 4ERYA 3FGBA 3FM0A 4XEIC 2XYIA 4L9OA 3ZE0A 3ULEC 3CFVA 3BG1A 4J8BA 2AGXA 3I2NA 2AGZA 5I5MA 4A7JA 2AH1A 1E8MA 5AFU3 4FB1D 2VDPA 1FWXA 2W18A 1M1XA 5HYNB 3EI4A 5TEFA 5I5JA 4D6VA 4CI3A 4J8GA 3EI3A 4J79A 2IUVA 4CY3A 3I8CA 1GOHA 5E6UA 2QZPA 4NBMA 3MUOA 4FA4D 1K32A 5JWZA 3VI4A 4BL0A 4X61B 4BUJC 4G55A 4CY2A 4ESGA 4PXWA 3B7FA 4J73A 1SHYB 1VZ3A 3JPXA 5M5VA 4CY5A 1NEXB 5IC7A 3VI3A 3OW8A 4JSVC 4LG8A 4GM3A 3C99A 1U2VC 1JMXB 2OVRB 3MKQA 4AN1A 2CE8A 3IJEA 1R5MA 3GFCA 4OWRA 2G99A 3RMZD 1B9YA 5C2WB 4J87A 2PBIB 5E6RA 1T2XA 4E5ZB 3K6SA 3NVNA 4ZOVA 2G9AA 2EIBA 4IA9A 3RN0D 4A2MA 2H9PA 4O3UB 4DNUA 4JT5C 3OKWA 3IUQA 4XYIA 3EG6A 4NC4A
chains in the Genus database with same CATH topology
5CXBA 3NVXA 5CYKB 2OK4A 5FLXg 2GNQA 5K1CC 1OLZA 2J57G 2IURA 5SXMA 3I8EA 3IJ0A 1L0QA 2B5NA 5B4WA 2HKMA 5I5IA 3A0FA 4PNKB 5GXHA 4A09B 2CO0C 2P9NC 4FA9D 5IGOA 3RLMD 2B5LA 2HESX 4GM8A 5IT9g 4UI9R 2AGYA 3C5MA 5H1MA 4A2LA 4GQ2P 2UZYB 2YMUA 3SJLD 3J81g 2O9KA 4PSWB 2GC4A 2GC7A 4E54A 3I7PA 2H6NA 3KRWB 2CE9A 4PBZA 3I7HA 1PBYB 3BG0A 4J82A 2I3TA 1A0RB 1PGUA 4AOWA 4O3TB 1TYQC 5EMLB 1SQJA 1N6EA 4L1QD 5EMKB 3JAMg 4FAND 4GGDA 4X3EA 1OMWB 3I7NA 4CI8A 3NVQA 2I0TA 3PVWB 4A0BB 2PM6B 1K8KC 2AQ5A 4J0WA 2Z2OA 4OZUA 3JZGA 1N6DA 3MKSB 3MXXA 5CYKA 3MZLA 3V7DB 3SBRA 3JROA 5AMSA 1MG3A 2HJBA 4N14A 5FKRA 5FKQA 4A11B 4O1QD 5FKSA 2H14A 4FWWA 4X60B 5EM2A 4O45A 3GREA 3AL9A 3JRPA 3I7LA 1JJUB 5CXCB 1GOTB 2PM9A 5HE3B 1S4UX 3EU7A 4A0AA 1GXRA 2CN2A 3C9CA 3PXTD 4J77A 3SLED 1VYHC 3HFQA 4L3GD 2B5MA 3JB9L 2AH0A 4A08A 3K27A 1P22A 3RRMC 4U7AA 4X63B 1PEVA 2I0SA 3K26A 2OIZA 3PE7A 4GQ1A 3AL8B 3FRXA 3EI2A 3PSLA 2I3SA 2MTAH 5GSAA 2XU7A 5EARA 3PSCB 5HQGA 3EI4B 3I89A 2BCJB 5THAA 4CZXA 4QL1A 4CZVA 4K3JB 2QXVA 4JT6C 3ZWLB 3VA6A 2B4EA 3EI3B 3C75H 2H3XA 1MG2A 4FA5D 5TF2A 4FAVD 4GM9A 5TDHB 4QT8A 2YBAA 4JSXC 3OKYB 3IIYA 4CI1A 2IUPA 2AGWA 3SCYA 4YVDA 1N6FA 2H68A 2YNOA 1NR0A 3DXKC 3JZHA 4PSXB 2OVQB 3EMHA 3RFHA 3EI1B 2Q7QA 4QRJA 3F3FA 2CO0A 2OK6A 4IMMA 4ZN4A 2H6KA 3SVWD 4D0KA 2EBSA 3UR4A 3L4OD 2H9NA 2H13A 5TEEA 3V9FA 3PVUB 2P9LC 3I7OA 4PC0A 3N0DA 5KDOB 4A11A 3ODTA 2OJYA 5EMMB 4FA1D 3PXWD 3OL2B 3SBPA 3IJ1A 1GG2B 4JD2C 5CXCA 5CXBB 5H17A 4Z8LA 3BWSA 1YFQA 3CIKB 3DXMC 5AJAA 2H47A 4MK0B 2QC5A 2TRCB 4H5JA 4BH6A 4E5ZA 4PBYA 2YB8B 4EWRA 3KRXB 4ERZA 4H5IA 3IIWA 4ZOYA 4QQEA 3AL8A 1JMZB 2J55H 1XIPA 3SWSD 3UVLA 5GXIA 4GMBA 5FA5B 2P9SC 2YNPA 3UKRC 1RI6A 1U4CA 5IJ8E 4J78A 3UVMA 2CN3A 2P9UC 5EMJB 3OKTA 4GGCA 3V5WB 3EWEA 2H9MA 2XL3A 4A09A 3L4MD 4GZ8A 2P9IC 2H6QA 3J80g 4GQBB 4E54B 2Z2NA 3OKYA 5C9ZB 4AEZA 4K3ID 1PI6A 1QNIA 4O9DA 1XKSA 4Y7RA 1XHMA 5HE0B 3DM0A 2P9PC 2I0RA 4CY1A 2XL2A 4U1EI 1Q47A 3EI1A 1GP2B 3VGZA 3F3PA 3IKOA 3SHFA 3JZNA 1B9XA 5FQDA 3UVNA 5EAMA 3P4FA 5HE2B 3DWLC 4J81A 4ZOXA 4L3HD 4G56B 4CZYA 2CNXA 4J84A 3CFSB 1SQ9A 3SMRA 5HE1B 4I79A 3OL2A 1MDAH 1TBGA 3ORVD 4ZOZA 3F3GA 3U4YA 5GMKn 3OTTA 3SN6B 4GGAA 4LGNA 3PXSD 2IWFA 3IJCA 4ES0A 1JOFA 2J56H 2BBKH 5IJ7E 3MMYA 4TZ4A 5EM2B 4A0BA 3MZKA 2OVPB 4FHLA 3RN1D 4J86A 5FXYA 5EALA 3SFZA 2PM9B 5C2VB 3AFCA 4JSPC 2IUQA 2P9KC 4Y5RD 4A0AB 3E0CA 2UZXB 4ERQA 4JSNC 2AGLA 2PM7B 4HDJA 3DSMA 3UVOA 4A08B 3UKUC 3N0EA 5H14A 5A2Qg 3VH0A 2Z2PA 2HXCA 3AH8B 4R7AB 3W15A 1ERJA 3SBQA 2HYEA 4CI2A 3EI2B 3UVKA 3RSEC 2IWKA 4KFMB 5FKTA 2HJ4A 5EAPA 4XYHA 3RFGA 2YNNA 4JXMA 4CC9A 2IAAA 2H9LA 2HKRA 3I7KA 5IGQA 5K19A 4LG9A 4J0XA 3SXTD 4NSXA 4ERYA 3FGBA 3FM0A 4XEIC 2XYIA 4L9OA 3ULEC 3CFVA 3BG1A 4J8BA 2AGXA 3I2NA 2AGZA 5I5MA 4A7JA 2AH1A 5AFU3 4FB1D 1FWXA 2W18A 5HYNB 3EI4A 5TEFA 5I5JA 4D6VA 4CI3A 4J8GA 3EI3A 4J79A 2IUVA 4CY3A 3I8CA 4FA4D 1K32A 5JWZA 4BL0A 4X61B 4BUJC 4CY2A 4ESGA 4PXWA 3B7FA 4J73A 1SHYB 3JPXA 4CY5A 1NEXB 5IC7A 3OW8A 4LG8A 4JSVC 4GM3A 3C99A 1U2VC 1JMXB 2OVRB 3MKQA 2CE8A 1R5MA 3GFCA 4OWRA 2G99A 3RMZD 1B9YA 5C2WB 4J87A 2PBIB 4E5ZB 3NVNA 4ZOVA 2G9AA 4IA9A 3RN0D 4A2MA 2H9PA 4O3UB 4JT5C 3OKWA 4XYIA 3EG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXB A;  3NVX A;  5CYK B;  2OK4 A;  5FLX g;  2GNQ A;  5K1C C;  1OLZ A;  2J57 G;  2IUR A;  5SXM A;  3I8E A;  3IJ0 A;  1L0Q A;  2B5N A;  5B4W A;  2HKM A;  5I5I A;  3A0F A;  4PNK B;  5GXH A;  4A09 B;  2CO0 C;  2P9N C;  4FA9 D;  5IGO A;  3RLM D;  2B5L A;  2HES X;  4GM8 A;  5IT9 g;  4UI9 R;  2AGY A;  3C5M A;  5H1M A;  4A2L A;  4GQ2 P;  2UZY B;  2YMU A;  3SJL D;  3J81 g;  2O9K A;  4PSW B;  2GC4 A;  2GC7 A;  4E54 A;  3I7P A;  2H6N A;  3KRW B;  2CE9 A;  4PBZ A;  3I7H A;  1PBY B;  3BG0 A;  4J82 A;  2I3T A;  1A0R B;  1PGU A;  4AOW A;  4O3T B;  1TYQ C;  5EML B;  1SQJ A;  1N6E A;  4L1Q D;  5EMK B;  3JAM g;  4FAN D;  4GGD A;  4X3E A;  1OMW B;  3I7N A;  4CI8 A;  3NVQ A;  2I0T A;  3PVW B;  4A0B B;  2PM6 B;  1K8K C;  2AQ5 A;  4J0W A;  2Z2O A;  4OZU A;  3JZG A;  1N6D A;  3MKS B;  3MXX A;  5CYK A;  3MZL A;  3V7D B;  3SBR A;  3JRO A;  5AMS A;  1MG3 A;  2HJB A;  4N14 A;  5FKR A;  5FKQ A;  4A11 B;  4O1Q D;  5FKS A;  2H14 A;  4FWW A;  4X60 B;  5EM2 A;  4O45 A;  3GRE A;  3AL9 A;  3JRP A;  3I7L A;  1JJU B;  5CXC B;  1GOT B;  2PM9 A;  5HE3 B;  1S4U X;  3EU7 A;  4A0A A;  1GXR A;  2CN2 A;  3C9C A;  3PXT D;  4J77 A;  3SLE D;  1VYH C;  3HFQ A;  4L3G D;  2B5M A;  3JB9 L;  2AH0 A;  4A08 A;  3K27 A;  1P22 A;  3RRM C;  4U7A A;  4X63 B;  1PEV A;  2I0S A;  3K26 A;  2OIZ A;  3PE7 A;  4GQ1 A;  3AL8 B;  3FRX A;  3EI2 A;  3PSL A;  2I3S A;  2MTA H;  5GSA A;  2XU7 A;  5EAR A;  3PSC B;  5HQG A;  3EI4 B;  3I89 A;  2BCJ B;  5THA A;  4CZX A;  4QL1 A;  4CZV A;  4K3J B;  2QXV A;  4JT6 C;  3ZWL B;  3VA6 A;  2B4E A;  3EI3 B;  3C75 H;  2H3X A;  1MG2 A;  4FA5 D;  5TF2 A;  4FAV D;  4GM9 A;  5TDH B;  4QT8 A;  2YBA A;  4JSX C;  3OKY B;  3IIY A;  4CI1 A;  2IUP A;  2AGW A;  3SCY A;  4YVD A;  1N6F A;  2H68 A;  2YNO A;  1NR0 A;  3DXK C;  3JZH A;  4PSX B;  2OVQ B;  3EMH A;  3RFH A;  3EI1 B;  2Q7Q A;  4QRJ A;  3F3F A;  2CO0 A;  2OK6 A;  4IMM A;  4ZN4 A;  2H6K A;  3SVW D;  4D0K A;  2EBS A;  3UR4 A;  3L4O D;  2H9N A;  2H13 A;  5TEE A;  3V9F A;  3PVU B;  2P9L C;  3I7O A;  4PC0 A;  3N0D A;  5KDO B;  4A11 A;  3ODT A;  2OJY A;  5EMM B;  4FA1 D;  3PXW D;  3OL2 B;  3SBP A;  3IJ1 A;  1GG2 B;  4JD2 C;  5CXC A;  5CXB B;  5H17 A;  4Z8L A;  3BWS A;  1YFQ A;  3CIK B;  3DXM C;  5AJA A;  2H47 A;  4MK0 B;  2QC5 A;  2TRC B;  4H5J A;  4BH6 A;  4E5Z A;  4PBY A;  2YB8 B;  4EWR A;  3KRX B;  4ERZ A;  4H5I A;  3IIW A;  4ZOY A;  4QQE A;  3AL8 A;  1JMZ B;  2J55 H;  1XIP A;  3SWS D;  3UVL A;  5GXI A;  4GMB A;  5FA5 B;  2P9S C;  2YNP A;  3UKR C;  1RI6 A;  1U4C A;  5IJ8 E;  4J78 A;  3UVM A;  2CN3 A;  2P9U C;  5EMJ B;  3OKT A;  4GGC A;  3V5W B;  3EWE A;  2H9M A;  2XL3 A;  4A09 A;  3L4M D;  4GZ8 A;  2P9I C;  2H6Q A;  3J80 g;  4GQB B;  4E54 B;  2Z2N A;  3OKY A;  5C9Z B;  4AEZ A;  4K3I D;  1PI6 A;  1QNI A;  4O9D A;  1XKS A;  4Y7R A;  1XHM A;  5HE0 B;  3DM0 A;  2P9P C;  2I0R A;  4CY1 A;  2XL2 A;  4U1E I;  1Q47 A;  3EI1 A;  1GP2 B;  3VGZ A;  3F3P A;  3IKO A;  3SHF A;  3JZN A;  1B9X A;  5FQD A;  3UVN A;  5EAM A;  3P4F A;  5HE2 B;  3DWL C;  4J81 A;  4ZOX A;  4L3H D;  4G56 B;  4CZY A;  2CNX A;  4J84 A;  3CFS B;  1SQ9 A;  3SMR A;  5HE1 B;  4I79 A;  3OL2 A;  1MDA H;  1TBG A;  3ORV D;  4ZOZ A;  3F3G A;  3U4Y A;  5GMK n;  3OTT A;  3SN6 B;  4GGA A;  4LGN A;  3PXS D;  2IWF A;  3IJC A;  4ES0 A;  1JOF A;  2J56 H;  2BBK H;  5IJ7 E;  3MMY A;  4TZ4 A;  5EM2 B;  4A0B A;  3MZK A;  2OVP B;  4FHL A;  3RN1 D;  4J86 A;  5FXY A;  5EAL A;  3SFZ A;  2PM9 B;  5C2V B;  3AFC A;  4JSP C;  2IUQ A;  2P9K C;  4Y5R D;  4A0A B;  3E0C A;  2UZX B;  4ERQ A;  4JSN C;  2AGL A;  2PM7 B;  4HDJ A;  3DSM A;  3UVO A;  4A08 B;  3UKU C;  3N0E A;  5H14 A;  5A2Q g;  3VH0 A;  2Z2P A;  2HXC A;  3AH8 B;  4R7A B;  3W15 A;  1ERJ A;  3SBQ A;  2HYE A;  4CI2 A;  3EI2 B;  3UVK A;  3RSE C;  2IWK A;  4KFM B;  5FKT A;  2HJ4 A;  5EAP A;  4XYH A;  3RFG A;  2YNN A;  4JXM A;  4CC9 A;  2IAA A;  2H9L A;  2HKR A;  3I7K A;  5IGQ A;  5K19 A;  4LG9 A;  4J0X A;  3SXT D;  4NSX A;  4ERY A;  3FGB A;  3FM0 A;  4XEI C;  2XYI A;  4L9O A;  3ULE C;  3CFV A;  3BG1 A;  4J8B A;  2AGX A;  3I2N A;  2AGZ A;  5I5M A;  4A7J A;  2AH1 A;  5AFU 3;  4FB1 D;  1FWX A;  2W18 A;  5HYN B;  3EI4 A;  5TEF A;  5I5J A;  4D6V A;  4CI3 A;  4J8G A;  3EI3 A;  4J79 A;  2IUV A;  4CY3 A;  3I8C A;  4FA4 D;  1K32 A;  5JWZ A;  4BL0 A;  4X61 B;  4BUJ C;  4CY2 A;  4ESG A;  4PXW A;  3B7F A;  4J73 A;  1SHY B;  3JPX A;  4CY5 A;  1NEX B;  5IC7 A;  3OW8 A;  4LG8 A;  4JSV C;  4GM3 A;  3C99 A;  1U2V C;  1JMX B;  2OVR B;  3MKQ A;  2CE8 A;  1R5M A;  3GFC A;  4OWR A;  2G99 A;  3RMZ D;  1B9Y A;  5C2W B;  4J87 A;  2PBI B;  4E5Z B;  3NVN A;  4ZOV A;  2G9A A;  4IA9 A;  3RN0 D;  4A2M A;  2H9P A;  4O3U B;  4JT5 C;  3OKW A;  4XYI A;  3EG6 A; 
#chains in the Genus database with same CATH topology
 5CXB A;  3NVX A;  4Z7Q A;  5CYK B;  2OK4 A;  4BP9 A;  3OF7 A;  5FLX g;  2VC2 A;  2GNQ A;  5K1C C;  1OLZ A;  2J57 G;  4G1E A;  4NAA A;  2IUR A;  5SXM A;  3I8E A;  3IJ0 A;  2EIC A;  1L0Q A;  3IUJ A;  4DNV A;  2B5N A;  4IRZ A;  5B4W A;  2HKM A;  5I5I A;  3A0F A;  4PNK B;  5GXH A;  3NID A;  5M5U A;  4A09 B;  2CO0 C;  2P9N C;  4FA9 D;  3IUR A;  1O6G A;  5IGO A;  3RLM D;  2B5L A;  2HES X;  1TYE A;  4JHN A;  4GM8 A;  1E5T A;  5IT9 g;  4UI9 R;  2AGY A;  2VZ3 A;  3C5M A;  5HDB A;  4UM8 A;  4AMY A;  5H1M A;  3EQ9 A;  4A2L A;  4WK4 A;  4GQ2 P;  2UZY B;  2YMU A;  3SJL D;  3J81 g;  2O9K A;  3FCU A;  4PSW B;  2GC4 A;  2GC7 A;  4E54 A;  3I7P A;  2H6N A;  3KRW B;  2CE9 A;  1VE6 A;  3V4V A;  4PBZ A;  3I7H A;  1PBY B;  3BG0 A;  4J82 A;  3ZDX A;  2I3T A;  5FFG A;  3O4J A;  2HU5 A;  1A0R B;  1PGU A;  3IUN A;  4AOW A;  4O3T B;  4BCB A;  1TYQ C;  5EML B;  4O02 A;  1SQJ A;  1N6E A;  4L1Q D;  5EMK B;  3JAM g;  4FAN D;  4D9S A;  4AX4 A;  1O6F A;  4GGD A;  4X3E A;  1OMW B;  3I7N A;  4CI8 A;  2HU7 A;  2I0T A;  3NVQ A;  3PVW B;  4A0B B;  2PM6 B;  3EQ7 A;  1K8K C;  2AQ5 A;  4J0W A;  2VDK A;  2Z2O A;  4OZU A;  3JZG A;  1N6D A;  3MKS B;  3MXX A;  5CYK A;  3MZL A;  3V7D B;  3SBR A;  3JRO A;  2XE4 A;  2XZG A;  2VDM A;  4WK2 A;  5AMS A;  1MG3 A;  2HJB A;  4N14 A;  5FKR A;  5FKQ A;  4A11 B;  4O1Q D;  1UOQ A;  5FKS A;  2H14 A;  4FWW A;  4X60 B;  5EM2 A;  4O45 A;  3GRE A;  3AL9 A;  3JRP A;  3I7L A;  1JJU B;  5CXC B;  1GOT B;  2PM9 A;  5HE3 B;  1S4U X;  3EU7 A;  4A0A A;  1GXR A;  2CN2 A;  3C9C A;  3PXT D;  4J77 A;  3SLE D;  2XDW A;  1VYH C;  3HFQ A;  4L3G D;  2B5M A;  3JB9 L;  2AH0 A;  4A08 A;  3K27 A;  1P22 A;  3RRM C;  4U7A A;  1YR2 A;  4X63 B;  1PEV A;  4BCC A;  2I0S A;  3K26 A;  2OIZ A;  3PE7 A;  4GQ1 A;  3AL8 B;  3FRX A;  3EI2 A;  3IUL A;  3PSL A;  2I3S A;  1UOP A;  3T3P A;  2MTA H;  5GSA A;  4AN0 A;  2XU7 A;  5EAR A;  3PSC B;  5HQG A;  1L5G A;  3EI4 B;  3I89 A;  2BCJ B;  5THA A;  4CZX A;  4QL1 A;  4CZV A;  4K3J B;  2QXV A;  4JT6 C;  3ZWL B;  3K71 A;  3VA6 A;  2B4E A;  3EI3 B;  3C75 H;  2H3X A;  1C9I A;  5M5R A;  1MG2 A;  3O4I A;  5TF2 A;  4BCD A;  4FA5 D;  3QI0 A;  4FAV D;  4GM9 A;  5TDH B;  4BP8 A;  4QT8 A;  1QFS A;  2YBA A;  4JSX C;  2EIE A;  3OKY B;  3IIY A;  1I2M B;  4MMZ A;  5C86 A;  4CI1 A;  2IUP A;  2AGW A;  3SCY A;  4NEN A;  5M5T A;  1H2Z A;  4YVD A;  1N6F A;  2H68 A;  4RE6 A;  2YNO A;  1NR0 A;  3DXK C;  3JZH A;  4AMZ A;  4PSX B;  2OVQ B;  3EMH A;  3RFH A;  3EI1 B;  2Q7Q A;  4QRJ A;  3F3F A;  2CO0 A;  5FFO A;  2JKX A;  2OK6 A;  2VZ1 A;  4IMM A;  4ZN4 A;  2H6K A;  3SVW D;  4Z7N A;  4D0K A;  2EBS A;  3UR4 A;  3L4O D;  2H9N A;  3ZE1 A;  2H13 A;  5TEE A;  3V9F A;  3PVU B;  2P9L C;  3I7O A;  4PC0 A;  3N0D A;  5KDO B;  4A11 A;  3ODT A;  2OJY A;  5EMM B;  4FA1 D;  3PXW D;  3OL2 B;  3DDU A;  3SBP A;  3IJ1 A;  1H2W A;  1GG2 B;  4JD2 C;  5CXC A;  5CXB B;  4G1M A;  3MVD K;  5H17 A;  4QAM A;  4Z8L A;  3BWS A;  1YFQ A;  3CIK B;  3DXM C;  5AJA A;  2H47 A;  4UM9 A;  3GD1 I;  4JHP C;  4MK0 B;  2QC5 A;  2TRC B;  2VDQ A;  4H5J A;  4BH6 A;  4E5Z A;  1K3I A;  4PBY A;  2YB8 B;  4EWR A;  3KRX B;  4ERZ A;  4H5I A;  3IIW A;  2EID A;  4ZOY A;  4QQE A;  3AL8 A;  1JMZ B;  2J55 H;  1XIP A;  3SWS D;  3UVL A;  1JV2 A;  3O4H A;  5GXI A;  4GMB A;  1GOG A;  5FA5 B;  2P9S C;  2YNP A;  4MMY A;  4RE5 A;  3UKR C;  1RI6 A;  1U4C A;  2WQ8 A;  3T3M A;  5IJ8 E;  2QR5 A;  4J78 A;  2BKL A;  3ZE2 A;  1QFM A;  3UVM A;  2CN3 A;  1U8C A;  3K72 A;  2P9U C;  5EMJ B;  2VDR A;  3OKT A;  4GGC A;  1UOO A;  3V5W B;  3EWE A;  4DNW A;  2H9M A;  2XL3 A;  4A09 A;  3GC3 B;  5M61 A;  3L4M D;  3O4G A;  4GZ8 A;  2P9I C;  2H6Q A;  3J80 g;  4GQB B;  4E54 B;  2Z2N A;  3OKY A;  5C9Z B;  4AEZ A;  3ZDY A;  3ZDZ A;  4K3I D;  1PI6 A;  1QNI A;  4O9D A;  1XKS A;  1VZ2 A;  4Y7R A;  5M5S A;  1XHM A;  5HE0 B;  3DM0 A;  2P9P C;  2I0R A;  4CY1 A;  2XL2 A;  1H2Y A;  1Q47 A;  4U1E I;  3EI1 A;  1GP2 B;  3VGZ A;  3FCS A;  3F3P A;  3IKO A;  3SHF A;  3JZN A;  1B9X A;  5FQD A;  3UVN A;  5EAM A;  3P4F A;  5HE2 B;  3DWL C;  4J81 A;  4ZOX A;  3IVM A;  4L3H D;  4WJK A;  4G56 B;  4CZY A;  2CNX A;  3EQ8 A;  4J84 A;  3CFS B;  1A12 A;  1SQ9 A;  3SMR A;  3QHY B;  5HE1 B;  4I79 A;  3OL2 A;  1MDA H;  1TBG A;  1VE7 A;  3ORV D;  4ZOZ A;  3F3G A;  3U4Y A;  5GMK n;  5E6S A;  3OTT A;  3SN6 B;  4GGA A;  4LGN A;  2VDL A;  3PXS D;  2IWF A;  3IJC A;  1E8N A;  4L1M A;  1BPO A;  4MMX A;  4ES0 A;  1JOF A;  2VDO A;  2J56 H;  3NIG A;  2BBK H;  5IJ7 E;  4Z7O A;  3MMY A;  4TZ4 A;  5EM2 B;  4A0B A;  3MZK A;  2OVP B;  4FHL A;  3RN1 D;  1UTC A;  2VDN A;  4J86 A;  5FXY A;  5EAL A;  3SFZ A;  2PM9 B;  5C2V B;  3AFC A;  4JSP C;  2IUQ A;  2P9K C;  4Y5R D;  4A0A B;  3E0C A;  2UZX B;  4ERQ A;  4JSN C;  2AGL A;  2PM7 B;  3MUN A;  3DSM A;  4HDJ A;  3UVO A;  3NIF A;  4A08 B;  4O2W A;  3UKU C;  3N0E A;  4WK0 A;  2HU8 A;  5H14 A;  5A2Q g;  3VH0 A;  2Z2P A;  2HXC A;  3AH8 B;  4R7A B;  1C9L A;  3W15 A;  1ERJ A;  3SBQ A;  2HYE A;  4CI2 A;  3EI2 B;  3UVK A;  1H2X A;  3IUM A;  3RSE C;  2IWK A;  4KFM B;  5FKT A;  1JTD B;  1GOF A;  2HJ4 A;  5EAP A;  4XYH A;  5C92 A;  3RFG A;  2YNN A;  4JXM A;  4CC9 A;  2IAA A;  2H9L A;  3KCI A;  2HKR A;  3I7K A;  5IGQ A;  5K19 A;  4LG9 A;  4J0X A;  3SXT D;  4NSX A;  3V4P A;  4ERY A;  3FGB A;  3FM0 A;  4XEI C;  2XYI A;  4L9O A;  3ZE0 A;  3ULE C;  3CFV A;  3BG1 A;  4J8B A;  2AGX A;  3I2N A;  2AGZ A;  5I5M A;  4A7J A;  2AH1 A;  1E8M A;  5AFU 3;  4FB1 D;  2VDP A;  1FWX A;  2W18 A;  1M1X A;  5HYN B;  3EI4 A;  5TEF A;  5I5J A;  4D6V A;  4CI3 A;  4J8G A;  3EI3 A;  4J79 A;  2IUV A;  4CY3 A;  3I8C A;  1GOH A;  5E6U A;  2QZP A;  4NBM A;  3MUO A;  4FA4 D;  1K32 A;  5JWZ A;  3VI4 A;  4BL0 A;  4X61 B;  4BUJ C;  4G55 A;  4CY2 A;  4ESG A;  4PXW A;  3B7F A;  4J73 A;  1SHY B;  1VZ3 A;  3JPX A;  5M5V A;  4CY5 A;  1NEX B;  5IC7 A;  3VI3 A;  3OW8 A;  4JSV C;  4LG8 A;  4GM3 A;  3C99 A;  1U2V C;  1JMX B;  2OVR B;  3MKQ A;  4AN1 A;  2CE8 A;  3IJE A;  1R5M A;  3GFC A;  4OWR A;  2G99 A;  3RMZ D;  1B9Y A;  5C2W B;  4J87 A;  2PBI B;  5E6R A;  1T2X A;  4E5Z B;  3K6S A;  3NVN A;  4ZOV A;  2G9A A;  2EIB A;  4IA9 A;  3RN0 D;  4A2M A;  2H9P A;  4O3U B;  4DNU A;  4JT5 C;  3OKW A;  3IUQ A;  4XYI A;  3EG6 A;  4NC4 A; 
#chains in the Genus database with same CATH homology
 5CXB A;  3NVX A;  5CYK B;  2OK4 A;  5FLX g;  2GNQ A;  5K1C C;  1OLZ A;  2J57 G;  2IUR A;  5SXM A;  3I8E A;  3IJ0 A;  1L0Q A;  2B5N A;  5B4W A;  2HKM A;  5I5I A;  3A0F A;  4PNK B;  5GXH A;  4A09 B;  2CO0 C;  2P9N C;  4FA9 D;  5IGO A;  3RLM D;  2B5L A;  2HES X;  4GM8 A;  5IT9 g;  4UI9 R;  2AGY A;  3C5M A;  5H1M A;  4A2L A;  4GQ2 P;  2UZY B;  2YMU A;  3SJL D;  3J81 g;  2O9K A;  4PSW B;  2GC4 A;  2GC7 A;  4E54 A;  3I7P A;  2H6N A;  3KRW B;  2CE9 A;  4PBZ A;  3I7H A;  1PBY B;  3BG0 A;  4J82 A;  2I3T A;  1A0R B;  1PGU A;  4AOW A;  4O3T B;  1TYQ C;  5EML B;  1SQJ A;  1N6E A;  4L1Q D;  5EMK B;  3JAM g;  4FAN D;  4GGD A;  4X3E A;  1OMW B;  3I7N A;  4CI8 A;  3NVQ A;  2I0T A;  3PVW B;  4A0B B;  2PM6 B;  1K8K C;  2AQ5 A;  4J0W A;  2Z2O A;  4OZU A;  3JZG A;  1N6D A;  3MKS B;  3MXX A;  5CYK A;  3MZL A;  3V7D B;  3SBR A;  3JRO A;  5AMS A;  1MG3 A;  2HJB A;  4N14 A;  5FKR A;  5FKQ A;  4A11 B;  4O1Q D;  5FKS A;  2H14 A;  4FWW A;  4X60 B;  5EM2 A;  4O45 A;  3GRE A;  3AL9 A;  3JRP A;  3I7L A;  1JJU B;  5CXC B;  1GOT B;  2PM9 A;  5HE3 B;  1S4U X;  3EU7 A;  4A0A A;  1GXR A;  2CN2 A;  3C9C A;  3PXT D;  4J77 A;  3SLE D;  1VYH C;  3HFQ A;  4L3G D;  2B5M A;  3JB9 L;  2AH0 A;  4A08 A;  3K27 A;  1P22 A;  3RRM C;  4U7A A;  4X63 B;  1PEV A;  2I0S A;  3K26 A;  2OIZ A;  3PE7 A;  4GQ1 A;  3AL8 B;  3FRX A;  3EI2 A;  3PSL A;  2I3S A;  2MTA H;  5GSA A;  2XU7 A;  5EAR A;  3PSC B;  5HQG A;  3EI4 B;  3I89 A;  2BCJ B;  5THA A;  4CZX A;  4QL1 A;  4CZV A;  4K3J B;  2QXV A;  4JT6 C;  3ZWL B;  3VA6 A;  2B4E A;  3EI3 B;  3C75 H;  2H3X A;  1MG2 A;  4FA5 D;  5TF2 A;  4FAV D;  4GM9 A;  5TDH B;  4QT8 A;  2YBA A;  4JSX C;  3OKY B;  3IIY A;  4CI1 A;  2IUP A;  2AGW A;  3SCY A;  4YVD A;  1N6F A;  2H68 A;  2YNO A;  1NR0 A;  3DXK C;  3JZH A;  4PSX B;  2OVQ B;  3EMH A;  3RFH A;  3EI1 B;  2Q7Q A;  4QRJ A;  3F3F A;  2CO0 A;  2OK6 A;  4IMM A;  4ZN4 A;  2H6K A;  3SVW D;  4D0K A;  2EBS A;  3UR4 A;  3L4O D;  2H9N A;  2H13 A;  5TEE A;  3V9F A;  3PVU B;  2P9L C;  3I7O A;  4PC0 A;  3N0D A;  5KDO B;  4A11 A;  3ODT A;  2OJY A;  5EMM B;  4FA1 D;  3PXW D;  3OL2 B;  3SBP A;  3IJ1 A;  1GG2 B;  4JD2 C;  5CXC A;  5CXB B;  5H17 A;  4Z8L A;  3BWS A;  1YFQ A;  3CIK B;  3DXM C;  5AJA A;  2H47 A;  4MK0 B;  2QC5 A;  2TRC B;  4H5J A;  4BH6 A;  4E5Z A;  4PBY A;  2YB8 B;  4EWR A;  3KRX B;  4ERZ A;  4H5I A;  3IIW A;  4ZOY A;  4QQE A;  3AL8 A;  1JMZ B;  2J55 H;  1XIP A;  3SWS D;  3UVL A;  5GXI A;  4GMB A;  5FA5 B;  2P9S C;  2YNP A;  3UKR C;  1RI6 A;  1U4C A;  5IJ8 E;  4J78 A;  3UVM A;  2CN3 A;  2P9U C;  5EMJ B;  3OKT A;  4GGC A;  3V5W B;  3EWE A;  2H9M A;  2XL3 A;  4A09 A;  3L4M D;  4GZ8 A;  2P9I C;  2H6Q A;  3J80 g;  4GQB B;  4E54 B;  2Z2N A;  3OKY A;  5C9Z B;  4AEZ A;  4K3I D;  1PI6 A;  1QNI A;  4O9D A;  1XKS A;  4Y7R A;  1XHM A;  5HE0 B;  3DM0 A;  2P9P C;  2I0R A;  4CY1 A;  2XL2 A;  4U1E I;  1Q47 A;  3EI1 A;  1GP2 B;  3VGZ A;  3F3P A;  3IKO A;  3SHF A;  3JZN A;  1B9X A;  5FQD A;  3UVN A;  5EAM A;  3P4F A;  5HE2 B;  3DWL C;  4J81 A;  4ZOX A;  4L3H D;  4G56 B;  4CZY A;  2CNX A;  4J84 A;  3CFS B;  1SQ9 A;  3SMR A;  5HE1 B;  4I79 A;  3OL2 A;  1MDA H;  1TBG A;  3ORV D;  4ZOZ A;  3F3G A;  3U4Y A;  5GMK n;  3OTT A;  3SN6 B;  4GGA A;  4LGN A;  3PXS D;  2IWF A;  3IJC A;  4ES0 A;  1JOF A;  2J56 H;  2BBK H;  5IJ7 E;  3MMY A;  4TZ4 A;  5EM2 B;  4A0B A;  3MZK A;  2OVP B;  4FHL A;  3RN1 D;  4J86 A;  5FXY A;  5EAL A;  3SFZ A;  2PM9 B;  5C2V B;  3AFC A;  4JSP C;  2IUQ A;  2P9K C;  4Y5R D;  4A0A B;  3E0C A;  2UZX B;  4ERQ A;  4JSN C;  2AGL A;  2PM7 B;  4HDJ A;  3DSM A;  3UVO A;  4A08 B;  3UKU C;  3N0E A;  5H14 A;  5A2Q g;  3VH0 A;  2Z2P A;  2HXC A;  3AH8 B;  4R7A B;  3W15 A;  1ERJ A;  3SBQ A;  2HYE A;  4CI2 A;  3EI2 B;  3UVK A;  3RSE C;  2IWK A;  4KFM B;  5FKT A;  2HJ4 A;  5EAP A;  4XYH A;  3RFG A;  2YNN A;  4JXM A;  4CC9 A;  2IAA A;  2H9L A;  2HKR A;  3I7K A;  5IGQ A;  5K19 A;  4LG9 A;  4J0X A;  3SXT D;  4NSX A;  4ERY A;  3FGB A;  3FM0 A;  4XEI C;  2XYI A;  4L9O A;  3ULE C;  3CFV A;  3BG1 A;  4J8B A;  2AGX A;  3I2N A;  2AGZ A;  5I5M A;  4A7J A;  2AH1 A;  5AFU 3;  4FB1 D;  1FWX A;  2W18 A;  5HYN B;  3EI4 A;  5TEF A;  5I5J A;  4D6V A;  4CI3 A;  4J8G A;  3EI3 A;  4J79 A;  2IUV A;  4CY3 A;  3I8C A;  4FA4 D;  1K32 A;  5JWZ A;  4BL0 A;  4X61 B;  4BUJ C;  4CY2 A;  4ESG A;  4PXW A;  3B7F A;  4J73 A;  1SHY B;  3JPX A;  4CY5 A;  1NEX B;  5IC7 A;  3OW8 A;  4LG8 A;  4JSV C;  4GM3 A;  3C99 A;  1U2V C;  1JMX B;  2OVR B;  3MKQ A;  2CE8 A;  1R5M A;  3GFC A;  4OWR A;  2G99 A;  3RMZ D;  1B9Y A;  5C2W B;  4J87 A;  2PBI B;  4E5Z B;  3NVN A;  4ZOV A;  2G9A A;  4IA9 A;  3RN0 D;  4A2M A;  2H9P A;  4O3U B;  4JT5 C;  3OKW A;  4XYI A;  3EG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...