4FAVD

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 50 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4favD00
4CI8A 3ORVD 2CN3A 2J57G 3V9FA 3EI2B 2AGZA 1R5MA 2W18A 4O45A 3RSEC 4A2MA 3I2NA 3VH0A 5CYKA 3EU7A 4FAND 2H9LA 4GGAA 4X60B 4LG8A 5EMJB 5IJ7E 2IURA 3SBQA 2AGXA 3SLED 2IUVA 3IJCA 2H6QA 2GNQA 1P22A 2XYIA 3L4MD 5EMLB 3AL8A 3NVNA 5FKTA 3CFSB 5FKQA 3UVKA 5FKRA 5FKSA 3C9CA 2HJ4A 4NSXA 3SVWD 1FWXA 1OLZA 4JSNC 4J0WA 2PM9B 4ZOYA 4BUJC 4O3TB 3GFCA 5FA5B 3V7DB 5IGOA 3CIKB 3E0CA 5TEFA 1YFQA 4ERZA 4A0BB 4I79A 3UKUC 3N0EA 4N14A 4U7AA 1B9XA 4A7JA 3A0FA 4PBZA 1RI6A 2G99A 3OKYB 3ZWLB 3RFHA 4G56B 2H6NA 4PC0A 3OTTA 4CZYA 3UR4A 4LGNA 5EMMB 2O9KA 2YB8B 3FGBA 3JZNA 4FA5D 4LG9A 3J81g 2MTAH 3SWSD 4J84A 2I3TA 3SFZA 4E5ZB 3EI1A 4X3EA 1JMZB 4J79A 4ERQA 2IWFA 3I7NA 4JSPC 4CZXA 4JXMA 5AMSA 1ERJA 3EI3A 3PVWB 3I89A 3F3FA 2AQ5A 3JRPA 2CE8A 3IIWA 5FLXg 3OKWA 3SJLD 3RFGA 4PSWB 4JSVC 4L1QD 5CXCA 3EI4A 3EI1B 4GM8A 1S4UX 3RN0D 4GMBA 2IWKA 4ZOXA 5H17A 4GQ1A 4QT8A 3UVNA 2H3XA 2HESX 3PXSD 3AL9A 3V5WB 2B5LA 1OMWB 4XYHA 3EI4B 4O3UB 4A2LA 2YMUA 2GC7A 2AH1A 5EAMA 3SCYA 2P9SC 3IJ0A 4J77A 4J78A 2OVPB 4TZ4A 3RMZD 2UZXB 3K26A 5C2WB 3L4OD 4H5JA 1XIPA 2BCJB 3DXKC 3BWSA 2CO0C 3U4YA 4PNKB 2Z2NA 4A11B 3HFQA 3CFVA 4OWRA 4A08A 2P9UC 2IAAA 3PXTD 3UKRC 3RRMC 5B4WA 3FRXA 5CYKB 3IKOA 5K1CC 2OJYA 4A08B 4K3ID 5TEEA 4U1EI 4FWWA 3ULEC 4J73A 3VGZA 2B4EA 2TRCB 3AL8B 3MZKA 2IUQA 4K3JB 1TBGA 5CXBA 2P9LC 5I5MA 1SQ9A 3PSLA 4Y5RD 3VA6A 3W15A 4ZOZA 5EAPA 3SN6B 5GMKn 5AFU3 4XYIA 5THAA 2EBSA 3OKTA 2G9AA 2IUPA 3C75H 3JROA 2HKMA 3PSCB 4Z8LA 1N6DA 2H6KA 2P9KC 4A09A 1U4CA 4YVDA 3I8EA 5I5JA 5C9ZB 2I3SA 3KRWB 4FA9D 3UVMA 3SXTD 4A0AA 5EM2A 4GGCA 1PEVA 3PXWD 2P9PC 3UVLA 1B9YA 3I7PA 3MXXA 2YNOA 2GC4A 4A09B 4FA4D 3JPXA 2HXCA 3I7OA 4AOWA 4BL0A 4GZ8A 4H5IA 4CY5A 3SBPA 2H68A 4JT6C 4O1QD 4A0AB 4JT5C 4Y7RA 3DSMA 3MMYA 4CC9A 4D6VA 3EI3B 4FA1D 2OVRB 3GREA 3N0DA 5GXIA 3BG0A 4ZN4A 4CI3A 5CXCB 5TF2A 4D0KA 3NVQA 4GQ2P 5EMKB 3SHFA 1N6FA 1N6EA 3K27A 3B7FA 4J8BA 4GM9A 2XU7A 4GGDA 4J82A 4GM3A 2AH0A 4E54A 4ERYA 3I7KA 5IGQA 1NR0A 4CY1A 3RLMD 2Z2OA 3OW8A 1GXRA 3F3GA 1JJUB 5I5IA 3SMRA 2Q7QA 2YNPA 5EALA 1Q47A 2BBKH 2PM7B 3EI2A 2P9IC 1MDAH 1JMXB 4J8GA 1JOFA 3DXMC 4MK0B 2OVQB 4CY3A 2UZYB 4IMMA 1PGUA 1L0QA 3AFCA 2OK6A 5HE2B 4FHLA 5K19A 1MG3A 4J0XA 3F3PA 2J56H 3JZGA 4HDJA 2QXVA 3EMHA 3JAMg 1GP2B 4FAVD 4PSXB 1MG2A 3DWLC 4J87A 2YBAA 2AGYA 4FB1D 1QNIA 2H47A 2I0SA 3KRXB 1K32A 4EWRA 2PM9A 3OL2A 3NVXA 4X61B 3AH8B 1XHMA 4QL1A 2OK4A 1NEXB 5HYNB 4A0BA 4IA9A 3MZLA 2Z2PA 2HJBA 5HE3B 5KDOB 3OKYA 4CY2A 4OZUA 1U2VC 3OL2B 1SHYB 1K8KC 2I0TA 3C99A 5IJ8E 2PM6B 5GSAA 5GXHA 5HE1B 2XL3A 4UI9R 5CXBB 2XL2A 1PBYB 4JSXC 3EG6A 2I0RA 4J81A 4O9DA 3UVOA 5FXYA 5C2VB 2J55H 2P9NC 3P4FA 4E5ZA 5EARA 2CO0A 1GOTB 3DM0A 1A0RB 4ES0A 3IJ1A 5AJAA 3EWEA 4PXWA 3FM0A 4L9OA 5A2Qg 2HYEA 3JZHA 5IC7A 4X63B 5EM2B 2PBIB 3PE7A 3I7HA 5HE0B 1PI6A 2CNXA 4XEIC 4BH6A 2CE9A 4AEZA 4CI2A 2H13A 2OIZA 3C5MA 5FQDA 1SQJA 4J86A 1TYQC 3I7LA 2H9MA 3MKSB 5HQGA 5H14A 5IT9g 3IIYA 5JWZA 2H9PA 3MKQA 4R7AB 3I8CA 5TDHB 2CN2A 5H1MA 3SBRA 3J80g 2H14A 2HKRA 4JD2C 2AGLA 2QC5A 4KFMB 4QQEA 3PVUB 4CZVA 4E54B 1VYHC 4GQBB 3JB9L 2YNNA 4ESGA 1GG2B 4CI1A 4PBYA 5SXMA 3BG1A 4QRJA 3ODTA 2B5MA 2AGWA 4A11A 1XKSA 4L3GD 2H9NA 2B5NA 3RN1D 4L3HD 4ZOVA
chains in the Genus database with same CATH superfamily
4CI8A 3ORVD 2CN3A 2J57G 3V9FA 3ZE2A 3EI2B 2AGZA 1R5MA 2W18A 2EICA 4O45A 1E8MA 3RSEC 4A2MA 3I2NA 4O02A 3VH0A 5CYKA 3EU7A 4MMZA 4FAND 2H9LA 3O4IA 1H2ZA 4GGAA 4X60B 4LG8A 5FFGA 5EMJB 5IJ7E 2IURA 5M5RA 3ZDYA 3SBQA 2AGXA 3SLED 2IUVA 3IJCA 2H6QA 2GNQA 1P22A 2XYIA 3L4MD 5EMLB 3AL8A 1I2MB 3NVNA 4G1EA 5FKTA 3CFSB 5FKQA 3UVKA 5FKRA 5FKSA 3C9CA 3O4HA 3ZDXA 4Z7OA 2HJ4A 4NSXA 3IUMA 3SVWD 1FWXA 1OLZA 4JSNC 4J0WA 2PM9B 4ZOYA 4BUJC 4O3TB 3GFCA 5FA5B 3V7DB 5IGOA 3CIKB 3E0CA 5TEFA 1YFQA 4ERZA 4A0BB 4I79A 1L5GA 2QZPA 3IULA 3UKUC 3N0EA 4N14A 4U7AA 1B9XA 4A7JA 3A0FA 4PBZA 5FFOA 1RI6A 2G99A 3OKYB 3ZWLB 3RFHA 4G56B 2H6NA 4PC0A 3OTTA 4CZYA 3UR4A 2VDMA 4LGNA 5EMMB 2O9KA 2YB8B 3FGBA 3JZNA 2XE4A 4FA5D 4LG9A 3J81g 2MTAH 3SWSD 4J84A 2I3TA 3SFZA 4E5ZB 3EI1A 4X3EA 2EIDA 4Z7QA 1JMZB 3FCSA 4J79A 4ERQA 2IWFA 3I7NA 1GOFA 4JSPC 4CZXA 4JXMA 5AMSA 2VDOA 1ERJA 3EI3A 1C9IA 3PVWB 3I89A 3F3FA 2AQ5A 3JRPA 2CE8A 3IIWA 4BP8A 5FLXg 3OKWA 3IUQA 3SJLD 3RFGA 4PSWB 4DNUA 4JSVC 4L1QD 5CXCA 3EI4A 3EI1B 3T3MA 3O4JA 4GM8A 1S4UX 4NC4A 3RN0D 4GMBA 2IWKA 4ZOXA 5H17A 4WK0A 4UM8A 3IJEA 4GQ1A 4QT8A 2EIBA 3UVNA 2H3XA 2HESX 3PXSD 1K3IA 3AL9A 3V5WB 2B5LA 1OMWB 4XYHA 2VZ3A 3EI4B 4O3UB 4A2LA 2YMUA 2GC7A 2AH1A 5EAMA 3MVDK 3SCYA 2P9SC 3IJ0A 1BPOA 4O2WA 1QFSA 4J77A 4J78A 2OVPB 4TZ4A 3ZDZA 3RMZD 3MUNA 3ZE0A 4BCCA 2UZXB 3K26A 5C2WB 3L4OD 5C86A 4H5JA 1XIPA 2BCJB 1GOGA 3DXKC 3BWSA 4AN1A 2CO0C 1O6FA 3EQ8A 4PNKB 3U4YA 2Z2NA 4A11B 3HFQA 3MUOA 3CFVA 4OWRA 4A08A 3DDUA 2P9UC 1QFMA 3GD1I 2IAAA 2WQ8A 3PXTD 3KCIA 3UKRC 3RRMC 1VZ2A 5B4WA 4RE5A 3FRXA 5CYKB 3OF7A 1C9LA 3IKOA 1UOPA 5K1CC 2OJYA 5E6SA 4A08B 1H2WA 4AMZA 4K3ID 5TEEA 4U1EI 2VC2A 4FWWA 3ULEC 4J73A 2VDLA 2EIEA 3VGZA 2B4EA 2TRCB 3AL8B 3MZKA 2IUQA 4K3JB 1TBGA 5CXBA 2QR5A 2BKLA 2P9LC 5I5MA 1SQ9A 3PSLA 4Y5RD 1VE6A 3VA6A 3W15A 4ZOZA 5EAPA 3IVMA 3SN6B 5GMKn 5AFU3 4XYIA 5THAA 2EBSA 3OKTA 2G9AA 2IUPA 4IRZA 3C75H 3JROA 2HKMA 3PSCB 4WJKA 4Z8LA 1N6DA 2H6KA 2P9KC 4A09A 1U4CA 4YVDA 3I8EA 5I5JA 5C9ZB 3EQ7A 2I3SA 3KRWB 4AX4A 4FA9D 3K6SA 3UVMA 1H2YA 3SXTD 4A0AA 5EM2A 4GGCA 1PEVA 3PXWD 2P9PC 3UVLA 4AN0A 3VI4A 1B9YA 3I7PA 3MXXA 1UTCA 5HDBA 2HU7A 2YNOA 2GC4A 4A09B 4FA4D 3JPXA 2HXCA 3I7OA 4AOWA 4BL0A 5M5TA 4GZ8A 3GC3B 4H5IA 4CY5A 3SBPA 1JTDB 2H68A 4JT6C 4O1QD 4A0AB 4JT5C 4Y7RA 3DSMA 4BP9A 3MMYA 3EQ9A 4WK4A 4CC9A 4D6VA 3K71A 3EI3B 4FA1D 2OVRB 1T2XA 3GREA 3N0DA 5GXIA 3BG0A 4ZN4A 3K72A 4CI3A 5CXCB 5TF2A 4D0KA 3NVQA 4GQ2P 5EMKB 3SHFA 1N6FA 1N6EA 3K27A 3B7FA 4J8BA 4GM9A 2XU7A 4GGDA 4J82A 4DNVA 4GM3A 2AH0A 4E54A 1E5TA 2VZ1A 4ERYA 3I7KA 5IGQA 1NR0A 4CY1A 5E6UA 3RLMD 4DNWA 2Z2OA 3OW8A 1GXRA 3F3GA 1JJUB 1GOHA 5I5IA 3SMRA 2HU8A 3NIGA 2Q7QA 2YNPA 4QAMA 1Q47A 2BBKH 4RE6A 2PM7B 5EALA 3QI0A 3EI2A 2P9IC 1YR2A 1MDAH 1JMXB 4J8GA 1JOFA 3DXMC 2VDQA 4MK0B 2OVQB 3IUNA 4BCDA 4CY3A 2UZYB 4IMMA 1U8CA 1PGUA 1L0QA 2XDWA 3AFCA 5M5SA 3IURA 3FCUA 2OK6A 5HE2B 1VE7A 4FHLA 5K19A 1MG3A 4J0XA 3F3PA 3JZGA 2J56H 1A12A 4HDJA 2QXVA 3EMHA 3JAMg 1GP2B 4FAVD 4PSXB 1VZ3A 1MG2A 3DWLC 4J87A 3V4VA 2YBAA 2AGYA 4JHPC 4FB1D 1QNIA 1JV2A 2H47A 2I0SA 4MMXA 3KRXB 4Z7NA 1K32A 4EWRA 2PM9A 3OL2A 3NVXA 2VDNA 4X61B 3AH8B 1XHMA 4QL1A 2OK4A 1NEXB 5HYNB 4A0BA 4IA9A 3MZLA 2Z2PA 2HJBA 5HE3B 5KDOB 3ZE1A 3OKYA 4CY2A 1O6GA 4OZUA 1U2VC 2HU5A 3OL2B 4MMYA 1SHYB 2VDRA 1K8KC 2I0TA 3C99A 5IJ8E 2PM6B 5GSAA 5GXHA 5HE1B 2XL3A 4G55A 4UI9R 5CXBB 2XL2A 3V4PA 1M1XA 1PBYB 4UM9A 4JSXC 3EG6A 2I0RA 4J81A 4O9DA 3UVOA 2VDPA 4L1MA 3NIDA 5FXYA 5C2VB 2J55H 2P9NC 3P4FA 4E5ZA 1TYEA 4JHNA 2JKXA 2XZGA 5M61A 5EARA 2CO0A 3QHYB 1GOTB 4BCBA 3DM0A 1A0RB 4ES0A 3IJ1A 3IUJA 5AJAA 3EWEA 5M5UA 4PXWA 3FM0A 4G1MA 4L9OA 5A2Qg 2HYEA 3JZHA 5IC7A 5M5VA 1UOQA 4NAAA 4X63B 3VI3A 5EM2B 2PBIB 3PE7A 3I7HA 5HE0B 4NBMA 1PI6A 2CNXA 3NIFA 4XEIC 4BH6A 2CE9A 4WK2A 4AEZA 5E6RA 4CI2A 2H13A 2OIZA 3C5MA 5FQDA 1SQJA 4J86A 1TYQC 3I7LA 2H9MA 3MKSB 5HQGA 5H14A 5IT9g 3IIYA 5JWZA 2H9PA 2VDKA 3T3PA 1UOOA 3MKQA 4D9SA 4R7AB 3I8CA 5TDHB 2CN2A 3O4GA 5H1MA 3SBRA 3J80g 2H14A 2HKRA 4JD2C 2AGLA 2QC5A 4KFMB 4QQEA 3PVUB 4NENA 4CZVA 4E54B 1VYHC 4AMYA 4GQBB 3JB9L 2YNNA 4ESGA 1GG2B 4CI1A 4PBYA 5SXMA 3BG1A 1E8NA 4QRJA 3ODTA 2B5MA 2AGWA 4A11A 1XKSA 4L3GD 2H9NA 2B5NA 3RN1D 4L3HD 4ZOVA 5C92A 1H2XA
chains in the Genus database with same CATH topology
4CI8A 3ORVD 2CN3A 2J57G 3V9FA 3EI2B 2AGZA 1R5MA 2W18A 4O45A 3RSEC 4A2MA 3I2NA 3VH0A 5CYKA 3EU7A 4FAND 2H9LA 4GGAA 4X60B 4LG8A 5EMJB 5IJ7E 2IURA 3SBQA 2AGXA 3SLED 2IUVA 3IJCA 2H6QA 2GNQA 1P22A 2XYIA 3L4MD 5EMLB 3AL8A 3NVNA 5FKTA 3CFSB 5FKQA 3UVKA 5FKRA 5FKSA 3C9CA 2HJ4A 4NSXA 3SVWD 1FWXA 1OLZA 4JSNC 4J0WA 2PM9B 4ZOYA 4BUJC 4O3TB 3GFCA 5FA5B 3V7DB 5IGOA 3CIKB 3E0CA 5TEFA 1YFQA 4ERZA 4A0BB 4I79A 3UKUC 3N0EA 4N14A 4U7AA 1B9XA 4A7JA 3A0FA 4PBZA 1RI6A 2G99A 3OKYB 3ZWLB 3RFHA 4G56B 2H6NA 4PC0A 3OTTA 4CZYA 3UR4A 4LGNA 5EMMB 2O9KA 2YB8B 3FGBA 3JZNA 4FA5D 4LG9A 3J81g 2MTAH 3SWSD 4J84A 2I3TA 3SFZA 4E5ZB 3EI1A 4X3EA 1JMZB 4J79A 4ERQA 2IWFA 3I7NA 4JSPC 4CZXA 4JXMA 5AMSA 1ERJA 3EI3A 3PVWB 3I89A 3F3FA 2AQ5A 3JRPA 2CE8A 3IIWA 5FLXg 3OKWA 3SJLD 3RFGA 4PSWB 4JSVC 4L1QD 5CXCA 3EI4A 3EI1B 4GM8A 1S4UX 3RN0D 4GMBA 2IWKA 4ZOXA 5H17A 4GQ1A 4QT8A 3UVNA 2H3XA 2HESX 3PXSD 3AL9A 3V5WB 2B5LA 1OMWB 4XYHA 3EI4B 4O3UB 4A2LA 2YMUA 2GC7A 2AH1A 5EAMA 3SCYA 2P9SC 3IJ0A 4J77A 4J78A 2OVPB 4TZ4A 3RMZD 2UZXB 3K26A 5C2WB 3L4OD 4H5JA 1XIPA 2BCJB 3DXKC 3BWSA 2CO0C 3U4YA 4PNKB 2Z2NA 4A11B 3HFQA 3CFVA 4OWRA 4A08A 2P9UC 2IAAA 3PXTD 3UKRC 3RRMC 5B4WA 3FRXA 5CYKB 3IKOA 5K1CC 2OJYA 4A08B 4K3ID 5TEEA 4U1EI 4FWWA 3ULEC 4J73A 3VGZA 2B4EA 2TRCB 3AL8B 3MZKA 2IUQA 4K3JB 1TBGA 5CXBA 2P9LC 5I5MA 1SQ9A 3PSLA 4Y5RD 3VA6A 3W15A 4ZOZA 5EAPA 3SN6B 5GMKn 5AFU3 4XYIA 5THAA 2EBSA 3OKTA 2G9AA 2IUPA 3C75H 3JROA 2HKMA 3PSCB 4Z8LA 1N6DA 2H6KA 2P9KC 4A09A 1U4CA 4YVDA 3I8EA 5I5JA 5C9ZB 2I3SA 3KRWB 4FA9D 3UVMA 3SXTD 4A0AA 5EM2A 4GGCA 1PEVA 3PXWD 2P9PC 3UVLA 1B9YA 3I7PA 3MXXA 2YNOA 2GC4A 4A09B 4FA4D 3JPXA 2HXCA 3I7OA 4AOWA 4BL0A 4GZ8A 4H5IA 4CY5A 3SBPA 2H68A 4JT6C 4O1QD 4A0AB 4JT5C 4Y7RA 3DSMA 3MMYA 4CC9A 4D6VA 3EI3B 4FA1D 2OVRB 3GREA 3N0DA 5GXIA 3BG0A 4ZN4A 4CI3A 5CXCB 5TF2A 4D0KA 3NVQA 4GQ2P 5EMKB 3SHFA 1N6FA 1N6EA 3K27A 3B7FA 4J8BA 4GM9A 2XU7A 4GGDA 4J82A 4GM3A 2AH0A 4E54A 4ERYA 3I7KA 5IGQA 1NR0A 4CY1A 3RLMD 2Z2OA 3OW8A 1GXRA 3F3GA 1JJUB 5I5IA 3SMRA 2Q7QA 2YNPA 5EALA 1Q47A 2BBKH 2PM7B 3EI2A 2P9IC 1MDAH 1JMXB 4J8GA 1JOFA 3DXMC 4MK0B 2OVQB 4CY3A 2UZYB 4IMMA 1PGUA 1L0QA 3AFCA 2OK6A 5HE2B 4FHLA 5K19A 1MG3A 4J0XA 3F3PA 2J56H 3JZGA 4HDJA 2QXVA 3EMHA 3JAMg 1GP2B 4FAVD 4PSXB 1MG2A 3DWLC 4J87A 2YBAA 2AGYA 4FB1D 1QNIA 2H47A 2I0SA 3KRXB 1K32A 4EWRA 2PM9A 3OL2A 3NVXA 4X61B 3AH8B 1XHMA 4QL1A 2OK4A 1NEXB 5HYNB 4A0BA 4IA9A 3MZLA 2Z2PA 2HJBA 5HE3B 5KDOB 3OKYA 4CY2A 4OZUA 1U2VC 3OL2B 1SHYB 1K8KC 2I0TA 3C99A 5IJ8E 2PM6B 5GSAA 5GXHA 5HE1B 2XL3A 4UI9R 5CXBB 2XL2A 1PBYB 4JSXC 3EG6A 2I0RA 4J81A 4O9DA 3UVOA 5FXYA 5C2VB 2J55H 2P9NC 3P4FA 4E5ZA 5EARA 2CO0A 1GOTB 3DM0A 1A0RB 4ES0A 3IJ1A 5AJAA 3EWEA 4PXWA 3FM0A 4L9OA 5A2Qg 2HYEA 3JZHA 5IC7A 4X63B 5EM2B 2PBIB 3PE7A 3I7HA 5HE0B 1PI6A 2CNXA 4XEIC 4BH6A 2CE9A 4AEZA 4CI2A 2H13A 2OIZA 3C5MA 5FQDA 1SQJA 4J86A 1TYQC 3I7LA 2H9MA 3MKSB 5HQGA 5H14A 5IT9g 3IIYA 5JWZA 2H9PA 3MKQA 4R7AB 3I8CA 5TDHB 2CN2A 5H1MA 3SBRA 3J80g 2H14A 2HKRA 4JD2C 2AGLA 2QC5A 4KFMB 4QQEA 3PVUB 4CZVA 4E54B 1VYHC 4GQBB 3JB9L 2YNNA 4ESGA 1GG2B 4CI1A 4PBYA 5SXMA 3BG1A 4QRJA 3ODTA 2B5MA 2AGWA 4A11A 1XKSA 4L3GD 2H9NA 2B5NA 3RN1D 4L3HD 4ZOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI8 A;  3ORV D;  2CN3 A;  2J57 G;  3V9F A;  3EI2 B;  2AGZ A;  1R5M A;  2W18 A;  4O45 A;  3RSE C;  4A2M A;  3I2N A;  3VH0 A;  5CYK A;  3EU7 A;  4FAN D;  2H9L A;  4GGA A;  4X60 B;  4LG8 A;  5EMJ B;  5IJ7 E;  2IUR A;  3SBQ A;  2AGX A;  3SLE D;  2IUV A;  3IJC A;  2H6Q A;  2GNQ A;  1P22 A;  2XYI A;  3L4M D;  5EML B;  3AL8 A;  3NVN A;  5FKT A;  3CFS B;  5FKQ A;  3UVK A;  5FKR A;  5FKS A;  3C9C A;  2HJ4 A;  4NSX A;  3SVW D;  1FWX A;  1OLZ A;  4JSN C;  4J0W A;  2PM9 B;  4ZOY A;  4BUJ C;  4O3T B;  3GFC A;  5FA5 B;  3V7D B;  5IGO A;  3CIK B;  3E0C A;  5TEF A;  1YFQ A;  4ERZ A;  4A0B B;  4I79 A;  3UKU C;  3N0E A;  4N14 A;  4U7A A;  1B9X A;  4A7J A;  3A0F A;  4PBZ A;  1RI6 A;  2G99 A;  3OKY B;  3ZWL B;  3RFH A;  4G56 B;  2H6N A;  4PC0 A;  3OTT A;  4CZY A;  3UR4 A;  4LGN A;  5EMM B;  2O9K A;  2YB8 B;  3FGB A;  3JZN A;  4FA5 D;  4LG9 A;  3J81 g;  2MTA H;  3SWS D;  4J84 A;  2I3T A;  3SFZ A;  4E5Z B;  3EI1 A;  4X3E A;  1JMZ B;  4J79 A;  4ERQ A;  2IWF A;  3I7N A;  4JSP C;  4CZX A;  4JXM A;  5AMS A;  1ERJ A;  3EI3 A;  3PVW B;  3I89 A;  3F3F A;  2AQ5 A;  3JRP A;  2CE8 A;  3IIW A;  5FLX g;  3OKW A;  3SJL D;  3RFG A;  4PSW B;  4JSV C;  4L1Q D;  5CXC A;  3EI4 A;  3EI1 B;  4GM8 A;  1S4U X;  3RN0 D;  4GMB A;  2IWK A;  4ZOX A;  5H17 A;  4GQ1 A;  4QT8 A;  3UVN A;  2H3X A;  2HES X;  3PXS D;  3AL9 A;  3V5W B;  2B5L A;  1OMW B;  4XYH A;  3EI4 B;  4O3U B;  4A2L A;  2YMU A;  2GC7 A;  2AH1 A;  5EAM A;  3SCY A;  2P9S C;  3IJ0 A;  4J77 A;  4J78 A;  2OVP B;  4TZ4 A;  3RMZ D;  2UZX B;  3K26 A;  5C2W B;  3L4O D;  4H5J A;  1XIP A;  2BCJ B;  3DXK C;  3BWS A;  2CO0 C;  3U4Y A;  4PNK B;  2Z2N A;  4A11 B;  3HFQ A;  3CFV A;  4OWR A;  4A08 A;  2P9U C;  2IAA A;  3PXT D;  3UKR C;  3RRM C;  5B4W A;  3FRX A;  5CYK B;  3IKO A;  5K1C C;  2OJY A;  4A08 B;  4K3I D;  5TEE A;  4U1E I;  4FWW A;  3ULE C;  4J73 A;  3VGZ A;  2B4E A;  2TRC B;  3AL8 B;  3MZK A;  2IUQ A;  4K3J B;  1TBG A;  5CXB A;  2P9L C;  5I5M A;  1SQ9 A;  3PSL A;  4Y5R D;  3VA6 A;  3W15 A;  4ZOZ A;  5EAP A;  3SN6 B;  5GMK n;  5AFU 3;  4XYI A;  5THA A;  2EBS A;  3OKT A;  2G9A A;  2IUP A;  3C75 H;  3JRO A;  2HKM A;  3PSC B;  4Z8L A;  1N6D A;  2H6K A;  2P9K C;  4A09 A;  1U4C A;  4YVD A;  3I8E A;  5I5J A;  5C9Z B;  2I3S A;  3KRW B;  4FA9 D;  3UVM A;  3SXT D;  4A0A A;  5EM2 A;  4GGC A;  1PEV A;  3PXW D;  2P9P C;  3UVL A;  1B9Y A;  3I7P A;  3MXX A;  2YNO A;  2GC4 A;  4A09 B;  4FA4 D;  3JPX A;  2HXC A;  3I7O A;  4AOW A;  4BL0 A;  4GZ8 A;  4H5I A;  4CY5 A;  3SBP A;  2H68 A;  4JT6 C;  4O1Q D;  4A0A B;  4JT5 C;  4Y7R A;  3DSM A;  3MMY A;  4CC9 A;  4D6V A;  3EI3 B;  4FA1 D;  2OVR B;  3GRE A;  3N0D A;  5GXI A;  3BG0 A;  4ZN4 A;  4CI3 A;  5CXC B;  5TF2 A;  4D0K A;  3NVQ A;  4GQ2 P;  5EMK B;  3SHF A;  1N6F A;  1N6E A;  3K27 A;  3B7F A;  4J8B A;  4GM9 A;  2XU7 A;  4GGD A;  4J82 A;  4GM3 A;  2AH0 A;  4E54 A;  4ERY A;  3I7K A;  5IGQ A;  1NR0 A;  4CY1 A;  3RLM D;  2Z2O A;  3OW8 A;  1GXR A;  3F3G A;  1JJU B;  5I5I A;  3SMR A;  2Q7Q A;  2YNP A;  5EAL A;  1Q47 A;  2BBK H;  2PM7 B;  3EI2 A;  2P9I C;  1MDA H;  1JMX B;  4J8G A;  1JOF A;  3DXM C;  4MK0 B;  2OVQ B;  4CY3 A;  2UZY B;  4IMM A;  1PGU A;  1L0Q A;  3AFC A;  2OK6 A;  5HE2 B;  4FHL A;  5K19 A;  1MG3 A;  4J0X A;  3F3P A;  2J56 H;  3JZG A;  4HDJ A;  2QXV A;  3EMH A;  3JAM g;  1GP2 B;  4FAV D;  4PSX B;  1MG2 A;  3DWL C;  4J87 A;  2YBA A;  2AGY A;  4FB1 D;  1QNI A;  2H47 A;  2I0S A;  3KRX B;  1K32 A;  4EWR A;  2PM9 A;  3OL2 A;  3NVX A;  4X61 B;  3AH8 B;  1XHM A;  4QL1 A;  2OK4 A;  1NEX B;  5HYN B;  4A0B A;  4IA9 A;  3MZL A;  2Z2P A;  2HJB A;  5HE3 B;  5KDO B;  3OKY A;  4CY2 A;  4OZU A;  1U2V C;  3OL2 B;  1SHY B;  1K8K C;  2I0T A;  3C99 A;  5IJ8 E;  2PM6 B;  5GSA A;  5GXH A;  5HE1 B;  2XL3 A;  4UI9 R;  5CXB B;  2XL2 A;  1PBY B;  4JSX C;  3EG6 A;  2I0R A;  4J81 A;  4O9D A;  3UVO A;  5FXY A;  5C2V B;  2J55 H;  2P9N C;  3P4F A;  4E5Z A;  5EAR A;  2CO0 A;  1GOT B;  3DM0 A;  1A0R B;  4ES0 A;  3IJ1 A;  5AJA A;  3EWE A;  4PXW A;  3FM0 A;  4L9O A;  5A2Q g;  2HYE A;  3JZH A;  5IC7 A;  4X63 B;  5EM2 B;  2PBI B;  3PE7 A;  3I7H A;  5HE0 B;  1PI6 A;  2CNX A;  4XEI C;  4BH6 A;  2CE9 A;  4AEZ A;  4CI2 A;  2H13 A;  2OIZ A;  3C5M A;  5FQD A;  1SQJ A;  4J86 A;  1TYQ C;  3I7L A;  2H9M A;  3MKS B;  5HQG A;  5H14 A;  5IT9 g;  3IIY A;  5JWZ A;  2H9P A;  3MKQ A;  4R7A B;  3I8C A;  5TDH B;  2CN2 A;  5H1M A;  3SBR A;  3J80 g;  2H14 A;  2HKR A;  4JD2 C;  2AGL A;  2QC5 A;  4KFM B;  4QQE A;  3PVU B;  4CZV A;  4E54 B;  1VYH C;  4GQB B;  3JB9 L;  2YNN A;  4ESG A;  1GG2 B;  4CI1 A;  4PBY A;  5SXM A;  3BG1 A;  4QRJ A;  3ODT A;  2B5M A;  2AGW A;  4A11 A;  1XKS A;  4L3G D;  2H9N A;  2B5N A;  3RN1 D;  4L3H D;  4ZOV A; 
#chains in the Genus database with same CATH topology
 4CI8 A;  3ORV D;  2CN3 A;  2J57 G;  3V9F A;  3ZE2 A;  3EI2 B;  2AGZ A;  1R5M A;  2W18 A;  2EIC A;  4O45 A;  1E8M A;  3RSE C;  4A2M A;  3I2N A;  4O02 A;  3VH0 A;  5CYK A;  3EU7 A;  4MMZ A;  4FAN D;  2H9L A;  3O4I A;  1H2Z A;  4GGA A;  4X60 B;  4LG8 A;  5FFG A;  5EMJ B;  5IJ7 E;  2IUR A;  5M5R A;  3ZDY A;  3SBQ A;  2AGX A;  3SLE D;  2IUV A;  3IJC A;  2H6Q A;  2GNQ A;  1P22 A;  2XYI A;  3L4M D;  5EML B;  3AL8 A;  1I2M B;  3NVN A;  4G1E A;  5FKT A;  3CFS B;  5FKQ A;  3UVK A;  5FKR A;  5FKS A;  3C9C A;  3O4H A;  3ZDX A;  4Z7O A;  2HJ4 A;  4NSX A;  3IUM A;  3SVW D;  1FWX A;  1OLZ A;  4JSN C;  4J0W A;  2PM9 B;  4ZOY A;  4BUJ C;  4O3T B;  3GFC A;  5FA5 B;  3V7D B;  5IGO A;  3CIK B;  3E0C A;  5TEF A;  1YFQ A;  4ERZ A;  4A0B B;  4I79 A;  1L5G A;  2QZP A;  3IUL A;  3UKU C;  3N0E A;  4N14 A;  4U7A A;  1B9X A;  4A7J A;  3A0F A;  4PBZ A;  5FFO A;  1RI6 A;  2G99 A;  3OKY B;  3ZWL B;  3RFH A;  4G56 B;  2H6N A;  4PC0 A;  3OTT A;  4CZY A;  3UR4 A;  2VDM A;  4LGN A;  5EMM B;  2O9K A;  2YB8 B;  3FGB A;  3JZN A;  2XE4 A;  4FA5 D;  4LG9 A;  3J81 g;  2MTA H;  3SWS D;  4J84 A;  2I3T A;  3SFZ A;  4E5Z B;  3EI1 A;  4X3E A;  2EID A;  4Z7Q A;  1JMZ B;  3FCS A;  4J79 A;  4ERQ A;  2IWF A;  3I7N A;  1GOF A;  4JSP C;  4CZX A;  4JXM A;  5AMS A;  2VDO A;  1ERJ A;  3EI3 A;  1C9I A;  3PVW B;  3I89 A;  3F3F A;  2AQ5 A;  3JRP A;  2CE8 A;  3IIW A;  4BP8 A;  5FLX g;  3OKW A;  3IUQ A;  3SJL D;  3RFG A;  4PSW B;  4DNU A;  4JSV C;  4L1Q D;  5CXC A;  3EI4 A;  3EI1 B;  3T3M A;  3O4J A;  4GM8 A;  1S4U X;  4NC4 A;  3RN0 D;  4GMB A;  2IWK A;  4ZOX A;  5H17 A;  4WK0 A;  4UM8 A;  3IJE A;  4GQ1 A;  4QT8 A;  2EIB A;  3UVN A;  2H3X A;  2HES X;  3PXS D;  1K3I A;  3AL9 A;  3V5W B;  2B5L A;  1OMW B;  4XYH A;  2VZ3 A;  3EI4 B;  4O3U B;  4A2L A;  2YMU A;  2GC7 A;  2AH1 A;  5EAM A;  3MVD K;  3SCY A;  2P9S C;  3IJ0 A;  1BPO A;  4O2W A;  1QFS A;  4J77 A;  4J78 A;  2OVP B;  4TZ4 A;  3ZDZ A;  3RMZ D;  3MUN A;  3ZE0 A;  4BCC A;  2UZX B;  3K26 A;  5C2W B;  3L4O D;  5C86 A;  4H5J A;  1XIP A;  2BCJ B;  1GOG A;  3DXK C;  3BWS A;  4AN1 A;  2CO0 C;  1O6F A;  3EQ8 A;  4PNK B;  3U4Y A;  2Z2N A;  4A11 B;  3HFQ A;  3MUO A;  3CFV A;  4OWR A;  4A08 A;  3DDU A;  2P9U C;  1QFM A;  3GD1 I;  2IAA A;  2WQ8 A;  3PXT D;  3KCI A;  3UKR C;  3RRM C;  1VZ2 A;  5B4W A;  4RE5 A;  3FRX A;  5CYK B;  3OF7 A;  1C9L A;  3IKO A;  1UOP A;  5K1C C;  2OJY A;  5E6S A;  4A08 B;  1H2W A;  4AMZ A;  4K3I D;  5TEE A;  4U1E I;  2VC2 A;  4FWW A;  3ULE C;  4J73 A;  2VDL A;  2EIE A;  3VGZ A;  2B4E A;  2TRC B;  3AL8 B;  3MZK A;  2IUQ A;  4K3J B;  1TBG A;  5CXB A;  2QR5 A;  2BKL A;  2P9L C;  5I5M A;  1SQ9 A;  3PSL A;  4Y5R D;  1VE6 A;  3VA6 A;  3W15 A;  4ZOZ A;  5EAP A;  3IVM A;  3SN6 B;  5GMK n;  5AFU 3;  4XYI A;  5THA A;  2EBS A;  3OKT A;  2G9A A;  2IUP A;  4IRZ A;  3C75 H;  3JRO A;  2HKM A;  3PSC B;  4WJK A;  4Z8L A;  1N6D A;  2H6K A;  2P9K C;  4A09 A;  1U4C A;  4YVD A;  3I8E A;  5I5J A;  5C9Z B;  3EQ7 A;  2I3S A;  3KRW B;  4AX4 A;  4FA9 D;  3K6S A;  3UVM A;  1H2Y A;  3SXT D;  4A0A A;  5EM2 A;  4GGC A;  1PEV A;  3PXW D;  2P9P C;  3UVL A;  4AN0 A;  3VI4 A;  1B9Y A;  3I7P A;  3MXX A;  1UTC A;  5HDB A;  2HU7 A;  2YNO A;  2GC4 A;  4A09 B;  4FA4 D;  3JPX A;  2HXC A;  3I7O A;  4AOW A;  4BL0 A;  5M5T A;  4GZ8 A;  3GC3 B;  4H5I A;  4CY5 A;  3SBP A;  1JTD B;  2H68 A;  4JT6 C;  4O1Q D;  4A0A B;  4JT5 C;  4Y7R A;  3DSM A;  4BP9 A;  3MMY A;  3EQ9 A;  4WK4 A;  4CC9 A;  4D6V A;  3K71 A;  3EI3 B;  4FA1 D;  2OVR B;  1T2X A;  3GRE A;  3N0D A;  5GXI A;  3BG0 A;  4ZN4 A;  3K72 A;  4CI3 A;  5CXC B;  5TF2 A;  4D0K A;  3NVQ A;  4GQ2 P;  5EMK B;  3SHF A;  1N6F A;  1N6E A;  3K27 A;  3B7F A;  4J8B A;  4GM9 A;  2XU7 A;  4GGD A;  4J82 A;  4DNV A;  4GM3 A;  2AH0 A;  4E54 A;  1E5T A;  2VZ1 A;  4ERY A;  3I7K A;  5IGQ A;  1NR0 A;  4CY1 A;  5E6U A;  3RLM D;  4DNW A;  2Z2O A;  3OW8 A;  1GXR A;  3F3G A;  1JJU B;  1GOH A;  5I5I A;  3SMR A;  2HU8 A;  3NIG A;  2Q7Q A;  2YNP A;  4QAM A;  1Q47 A;  2BBK H;  4RE6 A;  2PM7 B;  5EAL A;  3QI0 A;  3EI2 A;  2P9I C;  1YR2 A;  1MDA H;  1JMX B;  4J8G A;  1JOF A;  3DXM C;  2VDQ A;  4MK0 B;  2OVQ B;  3IUN A;  4BCD A;  4CY3 A;  2UZY B;  4IMM A;  1U8C A;  1PGU A;  1L0Q A;  2XDW A;  3AFC A;  5M5S A;  3IUR A;  3FCU A;  2OK6 A;  5HE2 B;  1VE7 A;  4FHL A;  5K19 A;  1MG3 A;  4J0X A;  3F3P A;  3JZG A;  2J56 H;  1A12 A;  4HDJ A;  2QXV A;  3EMH A;  3JAM g;  1GP2 B;  4FAV D;  4PSX B;  1VZ3 A;  1MG2 A;  3DWL C;  4J87 A;  3V4V A;  2YBA A;  2AGY A;  4JHP C;  4FB1 D;  1QNI A;  1JV2 A;  2H47 A;  2I0S A;  4MMX A;  3KRX B;  4Z7N A;  1K32 A;  4EWR A;  2PM9 A;  3OL2 A;  3NVX A;  2VDN A;  4X61 B;  3AH8 B;  1XHM A;  4QL1 A;  2OK4 A;  1NEX B;  5HYN B;  4A0B A;  4IA9 A;  3MZL A;  2Z2P A;  2HJB A;  5HE3 B;  5KDO B;  3ZE1 A;  3OKY A;  4CY2 A;  1O6G A;  4OZU A;  1U2V C;  2HU5 A;  3OL2 B;  4MMY A;  1SHY B;  2VDR A;  1K8K C;  2I0T A;  3C99 A;  5IJ8 E;  2PM6 B;  5GSA A;  5GXH A;  5HE1 B;  2XL3 A;  4G55 A;  4UI9 R;  5CXB B;  2XL2 A;  3V4P A;  1M1X A;  1PBY B;  4UM9 A;  4JSX C;  3EG6 A;  2I0R A;  4J81 A;  4O9D A;  3UVO A;  2VDP A;  4L1M A;  3NID A;  5FXY A;  5C2V B;  2J55 H;  2P9N C;  3P4F A;  4E5Z A;  1TYE A;  4JHN A;  2JKX A;  2XZG A;  5M61 A;  5EAR A;  2CO0 A;  3QHY B;  1GOT B;  4BCB A;  3DM0 A;  1A0R B;  4ES0 A;  3IJ1 A;  3IUJ A;  5AJA A;  3EWE A;  5M5U A;  4PXW A;  3FM0 A;  4G1M A;  4L9O A;  5A2Q g;  2HYE A;  3JZH A;  5IC7 A;  5M5V A;  1UOQ A;  4NAA A;  4X63 B;  3VI3 A;  5EM2 B;  2PBI B;  3PE7 A;  3I7H A;  5HE0 B;  4NBM A;  1PI6 A;  2CNX A;  3NIF A;  4XEI C;  4BH6 A;  2CE9 A;  4WK2 A;  4AEZ A;  5E6R A;  4CI2 A;  2H13 A;  2OIZ A;  3C5M A;  5FQD A;  1SQJ A;  4J86 A;  1TYQ C;  3I7L A;  2H9M A;  3MKS B;  5HQG A;  5H14 A;  5IT9 g;  3IIY A;  5JWZ A;  2H9P A;  2VDK A;  3T3P A;  1UOO A;  3MKQ A;  4D9S A;  4R7A B;  3I8C A;  5TDH B;  2CN2 A;  3O4G A;  5H1M A;  3SBR A;  3J80 g;  2H14 A;  2HKR A;  4JD2 C;  2AGL A;  2QC5 A;  4KFM B;  4QQE A;  3PVU B;  4NEN A;  4CZV A;  4E54 B;  1VYH C;  4AMY A;  4GQB B;  3JB9 L;  2YNN A;  4ESG A;  1GG2 B;  4CI1 A;  4PBY A;  5SXM A;  3BG1 A;  1E8N A;  4QRJ A;  3ODT A;  2B5M A;  2AGW A;  4A11 A;  1XKS A;  4L3G D;  2H9N A;  2B5N A;  3RN1 D;  4L3H D;  4ZOV A;  5C92 A;  1H2X A; 
#chains in the Genus database with same CATH homology
 4CI8 A;  3ORV D;  2CN3 A;  2J57 G;  3V9F A;  3EI2 B;  2AGZ A;  1R5M A;  2W18 A;  4O45 A;  3RSE C;  4A2M A;  3I2N A;  3VH0 A;  5CYK A;  3EU7 A;  4FAN D;  2H9L A;  4GGA A;  4X60 B;  4LG8 A;  5EMJ B;  5IJ7 E;  2IUR A;  3SBQ A;  2AGX A;  3SLE D;  2IUV A;  3IJC A;  2H6Q A;  2GNQ A;  1P22 A;  2XYI A;  3L4M D;  5EML B;  3AL8 A;  3NVN A;  5FKT A;  3CFS B;  5FKQ A;  3UVK A;  5FKR A;  5FKS A;  3C9C A;  2HJ4 A;  4NSX A;  3SVW D;  1FWX A;  1OLZ A;  4JSN C;  4J0W A;  2PM9 B;  4ZOY A;  4BUJ C;  4O3T B;  3GFC A;  5FA5 B;  3V7D B;  5IGO A;  3CIK B;  3E0C A;  5TEF A;  1YFQ A;  4ERZ A;  4A0B B;  4I79 A;  3UKU C;  3N0E A;  4N14 A;  4U7A A;  1B9X A;  4A7J A;  3A0F A;  4PBZ A;  1RI6 A;  2G99 A;  3OKY B;  3ZWL B;  3RFH A;  4G56 B;  2H6N A;  4PC0 A;  3OTT A;  4CZY A;  3UR4 A;  4LGN A;  5EMM B;  2O9K A;  2YB8 B;  3FGB A;  3JZN A;  4FA5 D;  4LG9 A;  3J81 g;  2MTA H;  3SWS D;  4J84 A;  2I3T A;  3SFZ A;  4E5Z B;  3EI1 A;  4X3E A;  1JMZ B;  4J79 A;  4ERQ A;  2IWF A;  3I7N A;  4JSP C;  4CZX A;  4JXM A;  5AMS A;  1ERJ A;  3EI3 A;  3PVW B;  3I89 A;  3F3F A;  2AQ5 A;  3JRP A;  2CE8 A;  3IIW A;  5FLX g;  3OKW A;  3SJL D;  3RFG A;  4PSW B;  4JSV C;  4L1Q D;  5CXC A;  3EI4 A;  3EI1 B;  4GM8 A;  1S4U X;  3RN0 D;  4GMB A;  2IWK A;  4ZOX A;  5H17 A;  4GQ1 A;  4QT8 A;  3UVN A;  2H3X A;  2HES X;  3PXS D;  3AL9 A;  3V5W B;  2B5L A;  1OMW B;  4XYH A;  3EI4 B;  4O3U B;  4A2L A;  2YMU A;  2GC7 A;  2AH1 A;  5EAM A;  3SCY A;  2P9S C;  3IJ0 A;  4J77 A;  4J78 A;  2OVP B;  4TZ4 A;  3RMZ D;  2UZX B;  3K26 A;  5C2W B;  3L4O D;  4H5J A;  1XIP A;  2BCJ B;  3DXK C;  3BWS A;  2CO0 C;  3U4Y A;  4PNK B;  2Z2N A;  4A11 B;  3HFQ A;  3CFV A;  4OWR A;  4A08 A;  2P9U C;  2IAA A;  3PXT D;  3UKR C;  3RRM C;  5B4W A;  3FRX A;  5CYK B;  3IKO A;  5K1C C;  2OJY A;  4A08 B;  4K3I D;  5TEE A;  4U1E I;  4FWW A;  3ULE C;  4J73 A;  3VGZ A;  2B4E A;  2TRC B;  3AL8 B;  3MZK A;  2IUQ A;  4K3J B;  1TBG A;  5CXB A;  2P9L C;  5I5M A;  1SQ9 A;  3PSL A;  4Y5R D;  3VA6 A;  3W15 A;  4ZOZ A;  5EAP A;  3SN6 B;  5GMK n;  5AFU 3;  4XYI A;  5THA A;  2EBS A;  3OKT A;  2G9A A;  2IUP A;  3C75 H;  3JRO A;  2HKM A;  3PSC B;  4Z8L A;  1N6D A;  2H6K A;  2P9K C;  4A09 A;  1U4C A;  4YVD A;  3I8E A;  5I5J A;  5C9Z B;  2I3S A;  3KRW B;  4FA9 D;  3UVM A;  3SXT D;  4A0A A;  5EM2 A;  4GGC A;  1PEV A;  3PXW D;  2P9P C;  3UVL A;  1B9Y A;  3I7P A;  3MXX A;  2YNO A;  2GC4 A;  4A09 B;  4FA4 D;  3JPX A;  2HXC A;  3I7O A;  4AOW A;  4BL0 A;  4GZ8 A;  4H5I A;  4CY5 A;  3SBP A;  2H68 A;  4JT6 C;  4O1Q D;  4A0A B;  4JT5 C;  4Y7R A;  3DSM A;  3MMY A;  4CC9 A;  4D6V A;  3EI3 B;  4FA1 D;  2OVR B;  3GRE A;  3N0D A;  5GXI A;  3BG0 A;  4ZN4 A;  4CI3 A;  5CXC B;  5TF2 A;  4D0K A;  3NVQ A;  4GQ2 P;  5EMK B;  3SHF A;  1N6F A;  1N6E A;  3K27 A;  3B7F A;  4J8B A;  4GM9 A;  2XU7 A;  4GGD A;  4J82 A;  4GM3 A;  2AH0 A;  4E54 A;  4ERY A;  3I7K A;  5IGQ A;  1NR0 A;  4CY1 A;  3RLM D;  2Z2O A;  3OW8 A;  1GXR A;  3F3G A;  1JJU B;  5I5I A;  3SMR A;  2Q7Q A;  2YNP A;  5EAL A;  1Q47 A;  2BBK H;  2PM7 B;  3EI2 A;  2P9I C;  1MDA H;  1JMX B;  4J8G A;  1JOF A;  3DXM C;  4MK0 B;  2OVQ B;  4CY3 A;  2UZY B;  4IMM A;  1PGU A;  1L0Q A;  3AFC A;  2OK6 A;  5HE2 B;  4FHL A;  5K19 A;  1MG3 A;  4J0X A;  3F3P A;  2J56 H;  3JZG A;  4HDJ A;  2QXV A;  3EMH A;  3JAM g;  1GP2 B;  4FAV D;  4PSX B;  1MG2 A;  3DWL C;  4J87 A;  2YBA A;  2AGY A;  4FB1 D;  1QNI A;  2H47 A;  2I0S A;  3KRX B;  1K32 A;  4EWR A;  2PM9 A;  3OL2 A;  3NVX A;  4X61 B;  3AH8 B;  1XHM A;  4QL1 A;  2OK4 A;  1NEX B;  5HYN B;  4A0B A;  4IA9 A;  3MZL A;  2Z2P A;  2HJB A;  5HE3 B;  5KDO B;  3OKY A;  4CY2 A;  4OZU A;  1U2V C;  3OL2 B;  1SHY B;  1K8K C;  2I0T A;  3C99 A;  5IJ8 E;  2PM6 B;  5GSA A;  5GXH A;  5HE1 B;  2XL3 A;  4UI9 R;  5CXB B;  2XL2 A;  1PBY B;  4JSX C;  3EG6 A;  2I0R A;  4J81 A;  4O9D A;  3UVO A;  5FXY A;  5C2V B;  2J55 H;  2P9N C;  3P4F A;  4E5Z A;  5EAR A;  2CO0 A;  1GOT B;  3DM0 A;  1A0R B;  4ES0 A;  3IJ1 A;  5AJA A;  3EWE A;  4PXW A;  3FM0 A;  4L9O A;  5A2Q g;  2HYE A;  3JZH A;  5IC7 A;  4X63 B;  5EM2 B;  2PBI B;  3PE7 A;  3I7H A;  5HE0 B;  1PI6 A;  2CNX A;  4XEI C;  4BH6 A;  2CE9 A;  4AEZ A;  4CI2 A;  2H13 A;  2OIZ A;  3C5M A;  5FQD A;  1SQJ A;  4J86 A;  1TYQ C;  3I7L A;  2H9M A;  3MKS B;  5HQG A;  5H14 A;  5IT9 g;  3IIY A;  5JWZ A;  2H9P A;  3MKQ A;  4R7A B;  3I8C A;  5TDH B;  2CN2 A;  5H1M A;  3SBR A;  3J80 g;  2H14 A;  2HKR A;  4JD2 C;  2AGL A;  2QC5 A;  4KFM B;  4QQE A;  3PVU B;  4CZV A;  4E54 B;  1VYH C;  4GQB B;  3JB9 L;  2YNN A;  4ESG A;  1GG2 B;  4CI1 A;  4PBY A;  5SXM A;  3BG1 A;  4QRJ A;  3ODT A;  2B5M A;  2AGW A;  4A11 A;  1XKS A;  4L3G D;  2H9N A;  2B5N A;  3RN1 D;  4L3H D;  4ZOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...