4FAVD

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 50 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4favD00
4CI2A 3PSCB 4MK0B 3I7PA 3JAMg 3N0EA 4O3UB 2BCJB 4GZ8A 3F3PA 5IGOA 2OK4A 5K19A 4ERQA 3OL2B 3P4FA 5H17A 2OIZA 2MTAH 4PSWB 3SJLD 3V7DB 5EM2A 4X61B 5I5IA 2OVPB 3E0CA 5FA5B 4GGDA 4A0BB 4JSVC 1MDAH 5K1CC 2CN2A 3SWSD 5IGQA 5H14A 5H1MA 5HE3B 3AL8A 3U4YA 4A11A 1Q47A 3J81g 4K3ID 5CYKB 4J0XA 4GGCA 4PBZA 2P9LC 3PVWB 2YB8B 5CXBB 1B9XA 2UZXB 3DM0A 2BBKH 4ZOVA 5I5JA 2GC4A 4X3EA 3I7LA 3C5MA 3C9CA 2P9PC 3J80g 1SQJA 3B7FA 2IUQA 4BH6A 4A08B 2H9PA 4E5ZB 5C2WB 4CY5A 1N6FA 4J77A 4GQBB 4GQ2P 3DSMA 5EALA 3DXMC 1N6EA 5FKQA 3IIYA 4FA4D 4FHLA 2HJBA 5TDHB 3OKYA 5C2VB 4GGAA 5TEEA 2I0SA 3DXKC 1B9YA 5TEFA 4PC0A 4I79A 4XEIC 3UKRC 1XHMA 3SBPA 3MZKA 4J86A 3SBRA 3I7NA 4NSXA 2O9KA 4J0WA 4JT6C 3NVNA 1QNIA 4GQ1A 5HE1B 1XKSA 3KRXB 4CC9A 2XU7A 4O9DA 3JROA 3V9FA 2IURA 3SCYA 4X63B 4J78A 1RI6A 2IUPA 3EG6A 4BUJC 4H5JA 3A0FA 2QXVA 2Z2PA 3OL2A 3C99A 3EU7A 4FAVD 3OKWA 5EMJB 2P9KC 4BL0A 5FQDA 3I7KA 1NR0A 2H13A 1GOTB 4A0BA 2OJYA 5TF2A 3MKQA 1K32A 2XYIA 4CZVA 3UVKA 4EWRA 3SLED 4L3HD 3VGZA 5GSAA 5FKTA 3ORVD 3RLMD 3ULEC 2Z2NA 4O45A 2TRCB 4ES0A 1TYQC 4PBYA 5IJ8E 3IJ1A 3ODTA 4PNKB 4D6VA 2HESX 4ESGA 4J8BA 5JWZA 3K27A 3N0DA 5CYKA 4L1QD 5THAA 3RMZD 1XIPA 3JB9L 3I7OA 4N14A 2B5LA 5HQGA 5CXBA 1JMXB 3IKOA 5EMKB 4ZN4A 1SQ9A 3JZGA 1PI6A 4CI8A 3EWEA 3PXTD 2I3TA 3VH0A 1MG2A 2XL2A 4QRJA 4A08A 3SN6B 4E5ZA 5A2Qg 4PXWA 3SXTD 4ZOYA 2IWKA 3SBQA 2H14A 4E54B 3GFCA 3HFQA 5AMSA 3MXXA 3CIKB 2H9MA 2J55H 3JZNA 3OKTA 4TZ4A 3MKSB 5HE0B 3L4OD 1FWXA 2H3XA 3NVXA 5EMLB 2YNNA 1YFQA 1N6DA 1MG3A 3RN1D 4LG9A 4JXMA 1PBYB 4QT8A 1GG2B 3JRPA 2YBAA 1PGUA 2PM7B 3IJ0A 1VYHC 4QL1A 2PM6B 3NVQA 4J8GA 3SFZA 4X60B 3UKUC 1NEXB 5IT9g 3V5WB 4K3JB 3JZHA 5CXCB 4Y7RA 2H9NA 2I0RA 4A0AB 3OW8A 4A09B 4FA5D 3EI4B 5GXIA 2G99A 3EI1B 3RRMC 4JSXC 2YNPA 4LG8A 4YVDA 2CN3A 4Z8LA 3DWLC 3MMYA 5GXHA 5FLXg 2EBSA 2G9AA 4JD2C 1PEVA 4U7AA 4ERYA 3PE7A 4FA9D 2H47A 3PXWD 1K8KC 3I2NA 5KDOB 4PSXB 4OWRA 1TBGA 3JPXA 5FKSA 3PVUB 3RSEC 4JT5C 2B5NA 5EARA 4L3GD 3VA6A 4UI9R 4JSPC 4CI1A 2H6QA 2YNOA 3PSLA 3L4MD 3IIWA 4H5IA 3AFCA 3RFGA 1GP2B 5EAMA 4HDJA 1JMZB 4J73A 2CE9A 4GM8A 2H68A 4FA1D 2Z2OA 2H6KA 3PXSD 4GM3A 4XYIA 2P9IC 3EI2B 4O1QD 2QC5A 5B4WA 2HXCA 4JSNC 3W15A 2H6NA 3UR4A 1L0QA 3RN0D 2AGLA 2UZYB 3FM0A 2IUVA 2AH1A 2GC7A 4IMMA 1U2VC 2AH0A 3UVNA 5AJAA 3FRXA 3UVLA 3CFVA 2P9SC 3F3GA 4J84A 3UVMA 4J79A 2PM9B 2AGZA 3IJCA 4KFMB 3I7HA 4J82A 3KRWB 5I5MA 2AGXA 2AQ5A 4AOWA 2OVQB 1R5MA 5CXCA 2J57G 3BG1A 1S4UX 4GMBA 4FWWA 5FKRA 4A0AA 4A09A 3EI4A 2HJ4A 3BWSA 4XYHA 2IAAA 3EI1A 3EI3B 3OTTA 4ZOZA 1A0RB 1GXRA 2I3SA 3FGBA 4OZUA 4FAND 3ZWLB 3I8EA 2W18A 2HYEA 4J81A 4CI3A 2P9NC 4ZOXA 3EMHA 4LGNA 3F3FA 4Y5RD 5IC7A 3BG0A 4A7JA 5EMMB 2OK6A 3SHFA 2CNXA 5EM2B 5FXYA 1JJUB 2XL3A 4O3TB 3RFHA 4J87A 3MZLA 5SXMA 4AEZA 1U4CA 4U1EI 3AL9A 3SVWD 3UVOA 3I8CA 3I89A 3EI2A 4GM9A 4CZYA 2AGYA 3AL8B 2OVRB 4A11B 5AFU3 2IWFA 2YMUA 3K26A 1OMWB 4ERZA 2CO0C 2P9UC 2PBIB 4FB1D 4CY3A 2Q7QA 3AH8B 4CY2A 1P22A 4CY1A 3GREA 1OLZA 4R7AB 5EAPA 4CZXA 4IA9A 3C75H 5HE2B 5IJ7E 1SHYB 3CFSB 2HKRA 2J56H 4L9OA 5HYNB 2I0TA 5C9ZB 2PM9A 4QQEA 2H9LA 2CO0A 2B5MA 4G56B 2AGWA 4D0KA 1JOFA 4E54A 3OKYB 4A2MA 2GNQA 3SMRA 4A2LA 1ERJA 2HKMA 2CE8A 2B4EA 5GMKn 3EI3A
chains in the Genus database with same CATH superfamily
4CI2A 1O6FA 3PSCB 4MK0B 3I7PA 1C9LA 3JAMg 3N0EA 4O3UB 2BCJB 3ZE2A 4WK2A 2EIEA 4GZ8A 3F3PA 5IGOA 2OK4A 3V4PA 5K19A 4ERQA 3OL2B 3P4FA 5H17A 2OIZA 4JHNA 2MTAH 1E8NA 3GC3B 4G1EA 4PSWB 3SJLD 3ZDXA 3V7DB 5EM2A 4X61B 5I5IA 2OVPB 5FFGA 3E0CA 2VZ1A 5FA5B 4GGDA 4A0BB 2VDPA 4JSVC 1UTCA 1MDAH 2QR5A 5K1CC 2HU8A 2CN2A 3SWSD 5IGQA 2HU7A 5H14A 4BCDA 5H1MA 5HE3B 3AL8A 3U4YA 5E6SA 4A11A 1Q47A 1UOOA 3J81g 4K3ID 4WK0A 1E8MA 5CYKB 4J0XA 4GGCA 2VDRA 4PBZA 2P9LC 4BP9A 3PVWB 2YB8B 5CXBB 1B9XA 2UZXB 3DM0A 2BBKH 3O4JA 4ZOVA 5I5JA 2GC4A 4X3EA 3IUQA 3I7LA 3C5MA 3C9CA 2P9PC 3J80g 1SQJA 3B7FA 2IUQA 4BH6A 4A08B 2H9PA 4E5ZB 5C2WB 2VDKA 3VI3A 4CY5A 1N6FA 2XZGA 4J77A 4GQBB 4GQ2P 3DSMA 2VDMA 3DXMC 1N6EA 5EALA 3IIYA 5FKQA 1UOQA 3T3MA 4FA4D 4FHLA 2HJBA 5TDHB 4O2WA 3OKYA 5C2VB 4GGAA 5TEEA 4DNVA 2I0SA 3DXKC 1B9YA 3IVMA 5TEFA 4PC0A 4I79A 4XEIC 3UKRC 1XHMA 3SBPA 1I2MB 3MZKA 4J86A 3SBRA 3I7NA 4NSXA 5M5UA 1TYEA 2O9KA 4DNUA 4J0WA 4JT6C 3NVNA 1QNIA 4GQ1A 5HE1B 1XKSA 3KRXB 4CC9A 2XU7A 4O9DA 3JROA 3O4HA 3V9FA 2IURA 3SCYA 4MMYA 4X63B 4J78A 1K3IA 1RI6A 2IUPA 3EG6A 3IUMA 4BUJC 4H5JA 3A0FA 2QXVA 1VE7A 2Z2PA 3OL2A 3C99A 2JKXA 3EU7A 4FAVD 3OKWA 5EMJB 2P9KC 4BL0A 5FQDA 3I7KA 1NR0A 2H13A 1GOTB 5M5SA 4A0BA 2OJYA 1YR2A 5TF2A 3MKQA 1K32A 4WK4A 2XYIA 4CZVA 3UVKA 4G55A 4EWRA 4RE5A 3SLED 4L3HD 3VGZA 5GSAA 3OF7A 5FKTA 3ORVD 3RLMD 3FCUA 2Z2NA 3O4IA 2TRCB 4O45A 3ULEC 4ES0A 1TYQC 1VZ2A 4PBYA 3IJ1A 3ODTA 5IJ8E 1H2XA 4PNKB 4D6VA 2HESX 4ESGA 4J8BA 5JWZA 3K27A 3N0DA 5CYKA 4L1QD 5THAA 3RMZD 1XIPA 3JB9L 3I7OA 4N14A 2B5LA 5HQGA 2VDQA 5CXBA 1JMXB 3IKOA 5EMKB 4ZN4A 1SQ9A 3JZGA 4AN0A 1PI6A 1VE6A 3QI0A 4CI8A 1GOFA 3EWEA 3PXTD 2I3TA 3VH0A 1MG2A 2XL2A 4QRJA 4A08A 3SN6B 4E5ZA 5A2Qg 4NAAA 4PXWA 3V4VA 3SXTD 4ZOYA 2IWKA 5C92A 3SBQA 3GD1I 4Z7OA 2H14A 4E54B 3NIGA 3GFCA 3HFQA 5AMSA 3MXXA 3CIKB 2VDLA 2H9MA 2J55H 3JZNA 3OKTA 4TZ4A 3MKSB 4UM9A 1T2XA 3IUJA 5HE0B 3L4OD 1FWXA 2H3XA 4JHPC 3NVXA 5EMLB 2YNNA 1YFQA 1N6DA 1MG3A 1E5TA 3RN1D 4LG9A 4RE6A 2EICA 4JXMA 1PBYB 4QT8A 1GG2B 3JRPA 2YBAA 1PGUA 2PM7B 3IJ0A 1VYHC 4QL1A 2VDOA 3DDUA 3MUOA 2PM6B 3NVQA 4J8GA 3SFZA 4X60B 3UKUC 1NEXB 5IT9g 3V5WB 4K3JB 3JZHA 3IJEA 5CXCB 5FFOA 4Y7RA 2H9NA 2I0RA 4A0AB 3OW8A 4NBMA 4A09B 1O6GA 4FA5D 3EI4B 5GXIA 2G99A 3EI1B 3RRMC 4JSXC 2YNPA 4LG8A 4YVDA 1GOGA 2CN3A 4Z8LA 3DWLC 3MMYA 3K72A 5GXHA 5FLXg 2EBSA 2HU5A 2G9AA 2EIBA 4JD2C 1PEVA 4U7AA 4ERYA 3PE7A 4FA9D 1A12A 2H47A 1K8KC 3I2NA 3PXWD 3O4GA 4PSXB 5KDOB 1H2ZA 4OWRA 1TBGA 3JPXA 2VZ3A 5FKSA 3PVUB 3RSEC 4JT5C 2B5NA 5EARA 4Z7QA 4L3GD 3VA6A 1C9IA 1VZ3A 4UI9R 4JSPC 4CI1A 2H6QA 2YNOA 3PSLA 3L4MD 1U8CA 3IIWA 4H5IA 3AFCA 3RFGA 1GP2B 5EAMA 4HDJA 1JMZB 1JV2A 4G1MA 3QHYB 4J73A 2CE9A 4GM8A 2H68A 4FA1D 2Z2OA 3K6SA 2H6KA 3PXSD 4L1MA 4GM3A 4XYIA 2P9IC 3EI2B 4MMXA 4O1QD 2QC5A 5B4WA 5C86A 2HXCA 4NENA 5E6RA 3T3PA 4JSNC 3W15A 2H6NA 3ZE1A 3K71A 4AX4A 3MUNA 3UR4A 1L0QA 3RN0D 2AGLA 2UZYB 3FM0A 2IUVA 2VC2A 2AH1A 2GC7A 4IMMA 1U2VC 2AH0A 3UVNA 5AJAA 3FRXA 4AMZA 4UM8A 3UVLA 3CFVA 2P9SC 3NIDA 3VI4A 3F3GA 4J84A 3UVMA 4J79A 2PM9B 4AMYA 2AGZA 3IJCA 4KFMB 4IRZA 3I7HA 4J82A 3KRWB 5E6UA 5I5MA 2AGXA 2AQ5A 4AOWA 2EIDA 4D9SA 1JTDB 2OVQB 1R5MA 5CXCA 1H2WA 2J57G 3BG1A 1S4UX 4GMBA 4FWWA 5FKRA 4A0AA 4A09A 4DNWA 3EI4A 2HJ4A 3BWSA 4XYHA 2IAAA 3EI1A 3EI3B 3OTTA 4ZOZA 1A0RB 4BCBA 1GXRA 2I3SA 3NIFA 3FGBA 3IULA 4OZUA 4FAND 3ZWLB 3I8EA 1QFSA 2W18A 2HYEA 4J81A 4CI3A 2P9NC 4ZOXA 3EMHA 4LGNA 3F3FA 1QFMA 4Y5RD 5IC7A 2XE4A 3ZDZA 3BG0A 4A7JA 5EMMB 2OK6A 3SHFA 2CNXA 5EM2B 5FXYA 1JJUB 1UOPA 2XL3A 3IURA 4O3TB 3RFHA 4J87A 2WQ8A 3MZLA 5SXMA 4AEZA 1U4CA 2QZPA 3ZE0A 4U1EI 3AL9A 4BCCA 3SVWD 3UVOA 3I8CA 3I89A 3EI2A 4GM9A 4CZYA 2AGYA 3AL8B 2OVRB 3FCSA 2BKLA 4A11B 5M5VA 5AFU3 2IWFA 2YMUA 4AN1A 3K26A 1OMWB 4ERZA 2CO0C 2P9UC 2PBIB 4NC4A 4FB1D 4CY3A 2Q7QA 3AH8B 4CY2A 1P22A 5M5RA 1M1XA 4BP8A 4CY1A 3GREA 1OLZA 4R7AB 5EAPA 4CZXA 4IA9A 3C75H 5HE2B 4MMZA 5IJ7E 4QAMA 3IUNA 1SHYB 3CFSB 2HKRA 3EQ8A 3ZDYA 2J56H 4L9OA 1GOHA 3EQ9A 5HYNB 2I0TA 5C9ZB 2VDNA 2PM9A 4QQEA 2H9LA 3MVDK 2CO0A 2B5MA 5M61A 4G56B 2AGWA 4D0KA 1JOFA 4O02A 4E54A 3OKYB 3KCIA 2XDWA 4Z7NA 5M5TA 4A2MA 2GNQA 3SMRA 4A2LA 1ERJA 3EQ7A 5HDBA 2HKMA 2CE8A 4WJKA 1BPOA 1L5GA 2B4EA 5GMKn 3EI3A 1H2YA
chains in the Genus database with same CATH topology
4CI2A 3PSCB 4MK0B 3I7PA 3JAMg 3N0EA 4O3UB 2BCJB 4GZ8A 3F3PA 5IGOA 2OK4A 5K19A 4ERQA 3OL2B 3P4FA 5H17A 2OIZA 2MTAH 4PSWB 3SJLD 3V7DB 5EM2A 4X61B 5I5IA 2OVPB 3E0CA 5FA5B 4GGDA 4A0BB 4JSVC 1MDAH 5K1CC 2CN2A 3SWSD 5IGQA 5H14A 5H1MA 5HE3B 3AL8A 3U4YA 4A11A 1Q47A 3J81g 4K3ID 5CYKB 4J0XA 4GGCA 4PBZA 2P9LC 3PVWB 2YB8B 5CXBB 1B9XA 2UZXB 3DM0A 2BBKH 4ZOVA 5I5JA 2GC4A 4X3EA 3I7LA 3C5MA 3C9CA 2P9PC 3J80g 1SQJA 3B7FA 2IUQA 4BH6A 4A08B 2H9PA 4E5ZB 5C2WB 4CY5A 1N6FA 4J77A 4GQBB 4GQ2P 3DSMA 5EALA 3DXMC 1N6EA 5FKQA 3IIYA 4FA4D 4FHLA 2HJBA 5TDHB 3OKYA 5C2VB 4GGAA 5TEEA 2I0SA 3DXKC 1B9YA 5TEFA 4PC0A 4I79A 4XEIC 3UKRC 1XHMA 3SBPA 3MZKA 4J86A 3SBRA 3I7NA 4NSXA 2O9KA 4J0WA 4JT6C 3NVNA 1QNIA 4GQ1A 5HE1B 1XKSA 3KRXB 4CC9A 2XU7A 4O9DA 3JROA 3V9FA 2IURA 3SCYA 4X63B 4J78A 1RI6A 2IUPA 3EG6A 4BUJC 4H5JA 3A0FA 2QXVA 2Z2PA 3OL2A 3C99A 3EU7A 4FAVD 3OKWA 5EMJB 2P9KC 4BL0A 5FQDA 3I7KA 1NR0A 2H13A 1GOTB 4A0BA 2OJYA 5TF2A 3MKQA 1K32A 2XYIA 4CZVA 3UVKA 4EWRA 3SLED 4L3HD 3VGZA 5GSAA 5FKTA 3ORVD 3RLMD 3ULEC 2Z2NA 4O45A 2TRCB 4ES0A 1TYQC 4PBYA 5IJ8E 3IJ1A 3ODTA 4PNKB 4D6VA 2HESX 4ESGA 4J8BA 5JWZA 3K27A 3N0DA 5CYKA 4L1QD 5THAA 3RMZD 1XIPA 3JB9L 3I7OA 4N14A 2B5LA 5HQGA 5CXBA 1JMXB 3IKOA 5EMKB 4ZN4A 1SQ9A 3JZGA 1PI6A 4CI8A 3EWEA 3PXTD 2I3TA 3VH0A 1MG2A 2XL2A 4QRJA 4A08A 3SN6B 4E5ZA 5A2Qg 4PXWA 3SXTD 4ZOYA 2IWKA 3SBQA 2H14A 4E54B 3GFCA 3HFQA 5AMSA 3MXXA 3CIKB 2H9MA 2J55H 3JZNA 3OKTA 4TZ4A 3MKSB 5HE0B 3L4OD 1FWXA 2H3XA 3NVXA 5EMLB 2YNNA 1YFQA 1N6DA 1MG3A 3RN1D 4LG9A 4JXMA 1PBYB 4QT8A 1GG2B 3JRPA 2YBAA 1PGUA 2PM7B 3IJ0A 1VYHC 4QL1A 2PM6B 3NVQA 4J8GA 3SFZA 4X60B 3UKUC 1NEXB 5IT9g 3V5WB 4K3JB 3JZHA 5CXCB 4Y7RA 2H9NA 2I0RA 4A0AB 3OW8A 4A09B 4FA5D 3EI4B 5GXIA 2G99A 3EI1B 3RRMC 4JSXC 2YNPA 4LG8A 4YVDA 2CN3A 4Z8LA 3DWLC 3MMYA 5GXHA 5FLXg 2EBSA 2G9AA 4JD2C 1PEVA 4U7AA 4ERYA 3PE7A 4FA9D 2H47A 3PXWD 1K8KC 3I2NA 5KDOB 4PSXB 4OWRA 1TBGA 3JPXA 5FKSA 3PVUB 3RSEC 4JT5C 2B5NA 5EARA 4L3GD 3VA6A 4UI9R 4JSPC 4CI1A 2H6QA 2YNOA 3PSLA 3L4MD 3IIWA 4H5IA 3AFCA 3RFGA 1GP2B 5EAMA 4HDJA 1JMZB 4J73A 2CE9A 4GM8A 2H68A 4FA1D 2Z2OA 2H6KA 3PXSD 4GM3A 4XYIA 2P9IC 3EI2B 4O1QD 2QC5A 5B4WA 2HXCA 4JSNC 3W15A 2H6NA 3UR4A 1L0QA 3RN0D 2AGLA 2UZYB 3FM0A 2IUVA 2AH1A 2GC7A 4IMMA 1U2VC 2AH0A 3UVNA 5AJAA 3FRXA 3UVLA 3CFVA 2P9SC 3F3GA 4J84A 3UVMA 4J79A 2PM9B 2AGZA 3IJCA 4KFMB 3I7HA 4J82A 3KRWB 5I5MA 2AGXA 2AQ5A 4AOWA 2OVQB 1R5MA 5CXCA 2J57G 3BG1A 1S4UX 4GMBA 4FWWA 5FKRA 4A0AA 4A09A 3EI4A 2HJ4A 3BWSA 4XYHA 2IAAA 3EI1A 3EI3B 3OTTA 4ZOZA 1A0RB 1GXRA 2I3SA 3FGBA 4OZUA 4FAND 3ZWLB 3I8EA 2W18A 2HYEA 4J81A 4CI3A 2P9NC 4ZOXA 3EMHA 4LGNA 3F3FA 4Y5RD 5IC7A 3BG0A 4A7JA 5EMMB 2OK6A 3SHFA 2CNXA 5EM2B 5FXYA 1JJUB 2XL3A 4O3TB 3RFHA 4J87A 3MZLA 5SXMA 4AEZA 1U4CA 4U1EI 3AL9A 3SVWD 3UVOA 3I8CA 3I89A 3EI2A 4GM9A 4CZYA 2AGYA 3AL8B 2OVRB 4A11B 5AFU3 2IWFA 2YMUA 3K26A 1OMWB 4ERZA 2CO0C 2P9UC 2PBIB 4FB1D 4CY3A 2Q7QA 3AH8B 4CY2A 1P22A 4CY1A 3GREA 1OLZA 4R7AB 5EAPA 4CZXA 4IA9A 3C75H 5HE2B 5IJ7E 1SHYB 3CFSB 2HKRA 2J56H 4L9OA 5HYNB 2I0TA 5C9ZB 2PM9A 4QQEA 2H9LA 2CO0A 2B5MA 4G56B 2AGWA 4D0KA 1JOFA 4E54A 3OKYB 4A2MA 2GNQA 3SMRA 4A2LA 1ERJA 2HKMA 2CE8A 2B4EA 5GMKn 3EI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI2 A;  3PSC B;  4MK0 B;  3I7P A;  3JAM g;  3N0E A;  4O3U B;  2BCJ B;  4GZ8 A;  3F3P A;  5IGO A;  2OK4 A;  5K19 A;  4ERQ A;  3OL2 B;  3P4F A;  5H17 A;  2OIZ A;  2MTA H;  4PSW B;  3SJL D;  3V7D B;  5EM2 A;  4X61 B;  5I5I A;  2OVP B;  3E0C A;  5FA5 B;  4GGD A;  4A0B B;  4JSV C;  1MDA H;  5K1C C;  2CN2 A;  3SWS D;  5IGQ A;  5H14 A;  5H1M A;  5HE3 B;  3AL8 A;  3U4Y A;  4A11 A;  1Q47 A;  3J81 g;  4K3I D;  5CYK B;  4J0X A;  4GGC A;  4PBZ A;  2P9L C;  3PVW B;  2YB8 B;  5CXB B;  1B9X A;  2UZX B;  3DM0 A;  2BBK H;  4ZOV A;  5I5J A;  2GC4 A;  4X3E A;  3I7L A;  3C5M A;  3C9C A;  2P9P C;  3J80 g;  1SQJ A;  3B7F A;  2IUQ A;  4BH6 A;  4A08 B;  2H9P A;  4E5Z B;  5C2W B;  4CY5 A;  1N6F A;  4J77 A;  4GQB B;  4GQ2 P;  3DSM A;  5EAL A;  3DXM C;  1N6E A;  5FKQ A;  3IIY A;  4FA4 D;  4FHL A;  2HJB A;  5TDH B;  3OKY A;  5C2V B;  4GGA A;  5TEE A;  2I0S A;  3DXK C;  1B9Y A;  5TEF A;  4PC0 A;  4I79 A;  4XEI C;  3UKR C;  1XHM A;  3SBP A;  3MZK A;  4J86 A;  3SBR A;  3I7N A;  4NSX A;  2O9K A;  4J0W A;  4JT6 C;  3NVN A;  1QNI A;  4GQ1 A;  5HE1 B;  1XKS A;  3KRX B;  4CC9 A;  2XU7 A;  4O9D A;  3JRO A;  3V9F A;  2IUR A;  3SCY A;  4X63 B;  4J78 A;  1RI6 A;  2IUP A;  3EG6 A;  4BUJ C;  4H5J A;  3A0F A;  2QXV A;  2Z2P A;  3OL2 A;  3C99 A;  3EU7 A;  4FAV D;  3OKW A;  5EMJ B;  2P9K C;  4BL0 A;  5FQD A;  3I7K A;  1NR0 A;  2H13 A;  1GOT B;  4A0B A;  2OJY A;  5TF2 A;  3MKQ A;  1K32 A;  2XYI A;  4CZV A;  3UVK A;  4EWR A;  3SLE D;  4L3H D;  3VGZ A;  5GSA A;  5FKT A;  3ORV D;  3RLM D;  3ULE C;  2Z2N A;  4O45 A;  2TRC B;  4ES0 A;  1TYQ C;  4PBY A;  5IJ8 E;  3IJ1 A;  3ODT A;  4PNK B;  4D6V A;  2HES X;  4ESG A;  4J8B A;  5JWZ A;  3K27 A;  3N0D A;  5CYK A;  4L1Q D;  5THA A;  3RMZ D;  1XIP A;  3JB9 L;  3I7O A;  4N14 A;  2B5L A;  5HQG A;  5CXB A;  1JMX B;  3IKO A;  5EMK B;  4ZN4 A;  1SQ9 A;  3JZG A;  1PI6 A;  4CI8 A;  3EWE A;  3PXT D;  2I3T A;  3VH0 A;  1MG2 A;  2XL2 A;  4QRJ A;  4A08 A;  3SN6 B;  4E5Z A;  5A2Q g;  4PXW A;  3SXT D;  4ZOY A;  2IWK A;  3SBQ A;  2H14 A;  4E54 B;  3GFC A;  3HFQ A;  5AMS A;  3MXX A;  3CIK B;  2H9M A;  2J55 H;  3JZN A;  3OKT A;  4TZ4 A;  3MKS B;  5HE0 B;  3L4O D;  1FWX A;  2H3X A;  3NVX A;  5EML B;  2YNN A;  1YFQ A;  1N6D A;  1MG3 A;  3RN1 D;  4LG9 A;  4JXM A;  1PBY B;  4QT8 A;  1GG2 B;  3JRP A;  2YBA A;  1PGU A;  2PM7 B;  3IJ0 A;  1VYH C;  4QL1 A;  2PM6 B;  3NVQ A;  4J8G A;  3SFZ A;  4X60 B;  3UKU C;  1NEX B;  5IT9 g;  3V5W B;  4K3J B;  3JZH A;  5CXC B;  4Y7R A;  2H9N A;  2I0R A;  4A0A B;  3OW8 A;  4A09 B;  4FA5 D;  3EI4 B;  5GXI A;  2G99 A;  3EI1 B;  3RRM C;  4JSX C;  2YNP A;  4LG8 A;  4YVD A;  2CN3 A;  4Z8L A;  3DWL C;  3MMY A;  5GXH A;  5FLX g;  2EBS A;  2G9A A;  4JD2 C;  1PEV A;  4U7A A;  4ERY A;  3PE7 A;  4FA9 D;  2H47 A;  3PXW D;  1K8K C;  3I2N A;  5KDO B;  4PSX B;  4OWR A;  1TBG A;  3JPX A;  5FKS A;  3PVU B;  3RSE C;  4JT5 C;  2B5N A;  5EAR A;  4L3G D;  3VA6 A;  4UI9 R;  4JSP C;  4CI1 A;  2H6Q A;  2YNO A;  3PSL A;  3L4M D;  3IIW A;  4H5I A;  3AFC A;  3RFG A;  1GP2 B;  5EAM A;  4HDJ A;  1JMZ B;  4J73 A;  2CE9 A;  4GM8 A;  2H68 A;  4FA1 D;  2Z2O A;  2H6K A;  3PXS D;  4GM3 A;  4XYI A;  2P9I C;  3EI2 B;  4O1Q D;  2QC5 A;  5B4W A;  2HXC A;  4JSN C;  3W15 A;  2H6N A;  3UR4 A;  1L0Q A;  3RN0 D;  2AGL A;  2UZY B;  3FM0 A;  2IUV A;  2AH1 A;  2GC7 A;  4IMM A;  1U2V C;  2AH0 A;  3UVN A;  5AJA A;  3FRX A;  3UVL A;  3CFV A;  2P9S C;  3F3G A;  4J84 A;  3UVM A;  4J79 A;  2PM9 B;  2AGZ A;  3IJC A;  4KFM B;  3I7H A;  4J82 A;  3KRW B;  5I5M A;  2AGX A;  2AQ5 A;  4AOW A;  2OVQ B;  1R5M A;  5CXC A;  2J57 G;  3BG1 A;  1S4U X;  4GMB A;  4FWW A;  5FKR A;  4A0A A;  4A09 A;  3EI4 A;  2HJ4 A;  3BWS A;  4XYH A;  2IAA A;  3EI1 A;  3EI3 B;  3OTT A;  4ZOZ A;  1A0R B;  1GXR A;  2I3S A;  3FGB A;  4OZU A;  4FAN D;  3ZWL B;  3I8E A;  2W18 A;  2HYE A;  4J81 A;  4CI3 A;  2P9N C;  4ZOX A;  3EMH A;  4LGN A;  3F3F A;  4Y5R D;  5IC7 A;  3BG0 A;  4A7J A;  5EMM B;  2OK6 A;  3SHF A;  2CNX A;  5EM2 B;  5FXY A;  1JJU B;  2XL3 A;  4O3T B;  3RFH A;  4J87 A;  3MZL A;  5SXM A;  4AEZ A;  1U4C A;  4U1E I;  3AL9 A;  3SVW D;  3UVO A;  3I8C A;  3I89 A;  3EI2 A;  4GM9 A;  4CZY A;  2AGY A;  3AL8 B;  2OVR B;  4A11 B;  5AFU 3;  2IWF A;  2YMU A;  3K26 A;  1OMW B;  4ERZ A;  2CO0 C;  2P9U C;  2PBI B;  4FB1 D;  4CY3 A;  2Q7Q A;  3AH8 B;  4CY2 A;  1P22 A;  4CY1 A;  3GRE A;  1OLZ A;  4R7A B;  5EAP A;  4CZX A;  4IA9 A;  3C75 H;  5HE2 B;  5IJ7 E;  1SHY B;  3CFS B;  2HKR A;  2J56 H;  4L9O A;  5HYN B;  2I0T A;  5C9Z B;  2PM9 A;  4QQE A;  2H9L A;  2CO0 A;  2B5M A;  4G56 B;  2AGW A;  4D0K A;  1JOF A;  4E54 A;  3OKY B;  4A2M A;  2GNQ A;  3SMR A;  4A2L A;  1ERJ A;  2HKM A;  2CE8 A;  2B4E A;  5GMK n;  3EI3 A; 
#chains in the Genus database with same CATH topology
 4CI2 A;  1O6F A;  3PSC B;  4MK0 B;  3I7P A;  1C9L A;  3JAM g;  3N0E A;  4O3U B;  2BCJ B;  3ZE2 A;  4WK2 A;  2EIE A;  4GZ8 A;  3F3P A;  5IGO A;  2OK4 A;  3V4P A;  5K19 A;  4ERQ A;  3OL2 B;  3P4F A;  5H17 A;  2OIZ A;  4JHN A;  2MTA H;  1E8N A;  3GC3 B;  4G1E A;  4PSW B;  3SJL D;  3ZDX A;  3V7D B;  5EM2 A;  4X61 B;  5I5I A;  2OVP B;  5FFG A;  3E0C A;  2VZ1 A;  5FA5 B;  4GGD A;  4A0B B;  2VDP A;  4JSV C;  1UTC A;  1MDA H;  2QR5 A;  5K1C C;  2HU8 A;  2CN2 A;  3SWS D;  5IGQ A;  2HU7 A;  5H14 A;  4BCD A;  5H1M A;  5HE3 B;  3AL8 A;  3U4Y A;  5E6S A;  4A11 A;  1Q47 A;  1UOO A;  3J81 g;  4K3I D;  4WK0 A;  1E8M A;  5CYK B;  4J0X A;  4GGC A;  2VDR A;  4PBZ A;  2P9L C;  4BP9 A;  3PVW B;  2YB8 B;  5CXB B;  1B9X A;  2UZX B;  3DM0 A;  2BBK H;  3O4J A;  4ZOV A;  5I5J A;  2GC4 A;  4X3E A;  3IUQ A;  3I7L A;  3C5M A;  3C9C A;  2P9P C;  3J80 g;  1SQJ A;  3B7F A;  2IUQ A;  4BH6 A;  4A08 B;  2H9P A;  4E5Z B;  5C2W B;  2VDK A;  3VI3 A;  4CY5 A;  1N6F A;  2XZG A;  4J77 A;  4GQB B;  4GQ2 P;  3DSM A;  2VDM A;  3DXM C;  1N6E A;  5EAL A;  3IIY A;  5FKQ A;  1UOQ A;  3T3M A;  4FA4 D;  4FHL A;  2HJB A;  5TDH B;  4O2W A;  3OKY A;  5C2V B;  4GGA A;  5TEE A;  4DNV A;  2I0S A;  3DXK C;  1B9Y A;  3IVM A;  5TEF A;  4PC0 A;  4I79 A;  4XEI C;  3UKR C;  1XHM A;  3SBP A;  1I2M B;  3MZK A;  4J86 A;  3SBR A;  3I7N A;  4NSX A;  5M5U A;  1TYE A;  2O9K A;  4DNU A;  4J0W A;  4JT6 C;  3NVN A;  1QNI A;  4GQ1 A;  5HE1 B;  1XKS A;  3KRX B;  4CC9 A;  2XU7 A;  4O9D A;  3JRO A;  3O4H A;  3V9F A;  2IUR A;  3SCY A;  4MMY A;  4X63 B;  4J78 A;  1K3I A;  1RI6 A;  2IUP A;  3EG6 A;  3IUM A;  4BUJ C;  4H5J A;  3A0F A;  2QXV A;  1VE7 A;  2Z2P A;  3OL2 A;  3C99 A;  2JKX A;  3EU7 A;  4FAV D;  3OKW A;  5EMJ B;  2P9K C;  4BL0 A;  5FQD A;  3I7K A;  1NR0 A;  2H13 A;  1GOT B;  5M5S A;  4A0B A;  2OJY A;  1YR2 A;  5TF2 A;  3MKQ A;  1K32 A;  4WK4 A;  2XYI A;  4CZV A;  3UVK A;  4G55 A;  4EWR A;  4RE5 A;  3SLE D;  4L3H D;  3VGZ A;  5GSA A;  3OF7 A;  5FKT A;  3ORV D;  3RLM D;  3FCU A;  2Z2N A;  3O4I A;  2TRC B;  4O45 A;  3ULE C;  4ES0 A;  1TYQ C;  1VZ2 A;  4PBY A;  3IJ1 A;  3ODT A;  5IJ8 E;  1H2X A;  4PNK B;  4D6V A;  2HES X;  4ESG A;  4J8B A;  5JWZ A;  3K27 A;  3N0D A;  5CYK A;  4L1Q D;  5THA A;  3RMZ D;  1XIP A;  3JB9 L;  3I7O A;  4N14 A;  2B5L A;  5HQG A;  2VDQ A;  5CXB A;  1JMX B;  3IKO A;  5EMK B;  4ZN4 A;  1SQ9 A;  3JZG A;  4AN0 A;  1PI6 A;  1VE6 A;  3QI0 A;  4CI8 A;  1GOF A;  3EWE A;  3PXT D;  2I3T A;  3VH0 A;  1MG2 A;  2XL2 A;  4QRJ A;  4A08 A;  3SN6 B;  4E5Z A;  5A2Q g;  4NAA A;  4PXW A;  3V4V A;  3SXT D;  4ZOY A;  2IWK A;  5C92 A;  3SBQ A;  3GD1 I;  4Z7O A;  2H14 A;  4E54 B;  3NIG A;  3GFC A;  3HFQ A;  5AMS A;  3MXX A;  3CIK B;  2VDL A;  2H9M A;  2J55 H;  3JZN A;  3OKT A;  4TZ4 A;  3MKS B;  4UM9 A;  1T2X A;  3IUJ A;  5HE0 B;  3L4O D;  1FWX A;  2H3X A;  4JHP C;  3NVX A;  5EML B;  2YNN A;  1YFQ A;  1N6D A;  1MG3 A;  1E5T A;  3RN1 D;  4LG9 A;  4RE6 A;  2EIC A;  4JXM A;  1PBY B;  4QT8 A;  1GG2 B;  3JRP A;  2YBA A;  1PGU A;  2PM7 B;  3IJ0 A;  1VYH C;  4QL1 A;  2VDO A;  3DDU A;  3MUO A;  2PM6 B;  3NVQ A;  4J8G A;  3SFZ A;  4X60 B;  3UKU C;  1NEX B;  5IT9 g;  3V5W B;  4K3J B;  3JZH A;  3IJE A;  5CXC B;  5FFO A;  4Y7R A;  2H9N A;  2I0R A;  4A0A B;  3OW8 A;  4NBM A;  4A09 B;  1O6G A;  4FA5 D;  3EI4 B;  5GXI A;  2G99 A;  3EI1 B;  3RRM C;  4JSX C;  2YNP A;  4LG8 A;  4YVD A;  1GOG A;  2CN3 A;  4Z8L A;  3DWL C;  3MMY A;  3K72 A;  5GXH A;  5FLX g;  2EBS A;  2HU5 A;  2G9A A;  2EIB A;  4JD2 C;  1PEV A;  4U7A A;  4ERY A;  3PE7 A;  4FA9 D;  1A12 A;  2H47 A;  1K8K C;  3I2N A;  3PXW D;  3O4G A;  4PSX B;  5KDO B;  1H2Z A;  4OWR A;  1TBG A;  3JPX A;  2VZ3 A;  5FKS A;  3PVU B;  3RSE C;  4JT5 C;  2B5N A;  5EAR A;  4Z7Q A;  4L3G D;  3VA6 A;  1C9I A;  1VZ3 A;  4UI9 R;  4JSP C;  4CI1 A;  2H6Q A;  2YNO A;  3PSL A;  3L4M D;  1U8C A;  3IIW A;  4H5I A;  3AFC A;  3RFG A;  1GP2 B;  5EAM A;  4HDJ A;  1JMZ B;  1JV2 A;  4G1M A;  3QHY B;  4J73 A;  2CE9 A;  4GM8 A;  2H68 A;  4FA1 D;  2Z2O A;  3K6S A;  2H6K A;  3PXS D;  4L1M A;  4GM3 A;  4XYI A;  2P9I C;  3EI2 B;  4MMX A;  4O1Q D;  2QC5 A;  5B4W A;  5C86 A;  2HXC A;  4NEN A;  5E6R A;  3T3P A;  4JSN C;  3W15 A;  2H6N A;  3ZE1 A;  3K71 A;  4AX4 A;  3MUN A;  3UR4 A;  1L0Q A;  3RN0 D;  2AGL A;  2UZY B;  3FM0 A;  2IUV A;  2VC2 A;  2AH1 A;  2GC7 A;  4IMM A;  1U2V C;  2AH0 A;  3UVN A;  5AJA A;  3FRX A;  4AMZ A;  4UM8 A;  3UVL A;  3CFV A;  2P9S C;  3NID A;  3VI4 A;  3F3G A;  4J84 A;  3UVM A;  4J79 A;  2PM9 B;  4AMY A;  2AGZ A;  3IJC A;  4KFM B;  4IRZ A;  3I7H A;  4J82 A;  3KRW B;  5E6U A;  5I5M A;  2AGX A;  2AQ5 A;  4AOW A;  2EID A;  4D9S A;  1JTD B;  2OVQ B;  1R5M A;  5CXC A;  1H2W A;  2J57 G;  3BG1 A;  1S4U X;  4GMB A;  4FWW A;  5FKR A;  4A0A A;  4A09 A;  4DNW A;  3EI4 A;  2HJ4 A;  3BWS A;  4XYH A;  2IAA A;  3EI1 A;  3EI3 B;  3OTT A;  4ZOZ A;  1A0R B;  4BCB A;  1GXR A;  2I3S A;  3NIF A;  3FGB A;  3IUL A;  4OZU A;  4FAN D;  3ZWL B;  3I8E A;  1QFS A;  2W18 A;  2HYE A;  4J81 A;  4CI3 A;  2P9N C;  4ZOX A;  3EMH A;  4LGN A;  3F3F A;  1QFM A;  4Y5R D;  5IC7 A;  2XE4 A;  3ZDZ A;  3BG0 A;  4A7J A;  5EMM B;  2OK6 A;  3SHF A;  2CNX A;  5EM2 B;  5FXY A;  1JJU B;  1UOP A;  2XL3 A;  3IUR A;  4O3T B;  3RFH A;  4J87 A;  2WQ8 A;  3MZL A;  5SXM A;  4AEZ A;  1U4C A;  2QZP A;  3ZE0 A;  4U1E I;  3AL9 A;  4BCC A;  3SVW D;  3UVO A;  3I8C A;  3I89 A;  3EI2 A;  4GM9 A;  4CZY A;  2AGY A;  3AL8 B;  2OVR B;  3FCS A;  2BKL A;  4A11 B;  5M5V A;  5AFU 3;  2IWF A;  2YMU A;  4AN1 A;  3K26 A;  1OMW B;  4ERZ A;  2CO0 C;  2P9U C;  2PBI B;  4NC4 A;  4FB1 D;  4CY3 A;  2Q7Q A;  3AH8 B;  4CY2 A;  1P22 A;  5M5R A;  1M1X A;  4BP8 A;  4CY1 A;  3GRE A;  1OLZ A;  4R7A B;  5EAP A;  4CZX A;  4IA9 A;  3C75 H;  5HE2 B;  4MMZ A;  5IJ7 E;  4QAM A;  3IUN A;  1SHY B;  3CFS B;  2HKR A;  3EQ8 A;  3ZDY A;  2J56 H;  4L9O A;  1GOH A;  3EQ9 A;  5HYN B;  2I0T A;  5C9Z B;  2VDN A;  2PM9 A;  4QQE A;  2H9L A;  3MVD K;  2CO0 A;  2B5M A;  5M61 A;  4G56 B;  2AGW A;  4D0K A;  1JOF A;  4O02 A;  4E54 A;  3OKY B;  3KCI A;  2XDW A;  4Z7N A;  5M5T A;  4A2M A;  2GNQ A;  3SMR A;  4A2L A;  1ERJ A;  3EQ7 A;  5HDB A;  2HKM A;  2CE8 A;  4WJK A;  1BPO A;  1L5G A;  2B4E A;  5GMK n;  3EI3 A;  1H2Y A; 
#chains in the Genus database with same CATH homology
 4CI2 A;  3PSC B;  4MK0 B;  3I7P A;  3JAM g;  3N0E A;  4O3U B;  2BCJ B;  4GZ8 A;  3F3P A;  5IGO A;  2OK4 A;  5K19 A;  4ERQ A;  3OL2 B;  3P4F A;  5H17 A;  2OIZ A;  2MTA H;  4PSW B;  3SJL D;  3V7D B;  5EM2 A;  4X61 B;  5I5I A;  2OVP B;  3E0C A;  5FA5 B;  4GGD A;  4A0B B;  4JSV C;  1MDA H;  5K1C C;  2CN2 A;  3SWS D;  5IGQ A;  5H14 A;  5H1M A;  5HE3 B;  3AL8 A;  3U4Y A;  4A11 A;  1Q47 A;  3J81 g;  4K3I D;  5CYK B;  4J0X A;  4GGC A;  4PBZ A;  2P9L C;  3PVW B;  2YB8 B;  5CXB B;  1B9X A;  2UZX B;  3DM0 A;  2BBK H;  4ZOV A;  5I5J A;  2GC4 A;  4X3E A;  3I7L A;  3C5M A;  3C9C A;  2P9P C;  3J80 g;  1SQJ A;  3B7F A;  2IUQ A;  4BH6 A;  4A08 B;  2H9P A;  4E5Z B;  5C2W B;  4CY5 A;  1N6F A;  4J77 A;  4GQB B;  4GQ2 P;  3DSM A;  5EAL A;  3DXM C;  1N6E A;  5FKQ A;  3IIY A;  4FA4 D;  4FHL A;  2HJB A;  5TDH B;  3OKY A;  5C2V B;  4GGA A;  5TEE A;  2I0S A;  3DXK C;  1B9Y A;  5TEF A;  4PC0 A;  4I79 A;  4XEI C;  3UKR C;  1XHM A;  3SBP A;  3MZK A;  4J86 A;  3SBR A;  3I7N A;  4NSX A;  2O9K A;  4J0W A;  4JT6 C;  3NVN A;  1QNI A;  4GQ1 A;  5HE1 B;  1XKS A;  3KRX B;  4CC9 A;  2XU7 A;  4O9D A;  3JRO A;  3V9F A;  2IUR A;  3SCY A;  4X63 B;  4J78 A;  1RI6 A;  2IUP A;  3EG6 A;  4BUJ C;  4H5J A;  3A0F A;  2QXV A;  2Z2P A;  3OL2 A;  3C99 A;  3EU7 A;  4FAV D;  3OKW A;  5EMJ B;  2P9K C;  4BL0 A;  5FQD A;  3I7K A;  1NR0 A;  2H13 A;  1GOT B;  4A0B A;  2OJY A;  5TF2 A;  3MKQ A;  1K32 A;  2XYI A;  4CZV A;  3UVK A;  4EWR A;  3SLE D;  4L3H D;  3VGZ A;  5GSA A;  5FKT A;  3ORV D;  3RLM D;  3ULE C;  2Z2N A;  4O45 A;  2TRC B;  4ES0 A;  1TYQ C;  4PBY A;  5IJ8 E;  3IJ1 A;  3ODT A;  4PNK B;  4D6V A;  2HES X;  4ESG A;  4J8B A;  5JWZ A;  3K27 A;  3N0D A;  5CYK A;  4L1Q D;  5THA A;  3RMZ D;  1XIP A;  3JB9 L;  3I7O A;  4N14 A;  2B5L A;  5HQG A;  5CXB A;  1JMX B;  3IKO A;  5EMK B;  4ZN4 A;  1SQ9 A;  3JZG A;  1PI6 A;  4CI8 A;  3EWE A;  3PXT D;  2I3T A;  3VH0 A;  1MG2 A;  2XL2 A;  4QRJ A;  4A08 A;  3SN6 B;  4E5Z A;  5A2Q g;  4PXW A;  3SXT D;  4ZOY A;  2IWK A;  3SBQ A;  2H14 A;  4E54 B;  3GFC A;  3HFQ A;  5AMS A;  3MXX A;  3CIK B;  2H9M A;  2J55 H;  3JZN A;  3OKT A;  4TZ4 A;  3MKS B;  5HE0 B;  3L4O D;  1FWX A;  2H3X A;  3NVX A;  5EML B;  2YNN A;  1YFQ A;  1N6D A;  1MG3 A;  3RN1 D;  4LG9 A;  4JXM A;  1PBY B;  4QT8 A;  1GG2 B;  3JRP A;  2YBA A;  1PGU A;  2PM7 B;  3IJ0 A;  1VYH C;  4QL1 A;  2PM6 B;  3NVQ A;  4J8G A;  3SFZ A;  4X60 B;  3UKU C;  1NEX B;  5IT9 g;  3V5W B;  4K3J B;  3JZH A;  5CXC B;  4Y7R A;  2H9N A;  2I0R A;  4A0A B;  3OW8 A;  4A09 B;  4FA5 D;  3EI4 B;  5GXI A;  2G99 A;  3EI1 B;  3RRM C;  4JSX C;  2YNP A;  4LG8 A;  4YVD A;  2CN3 A;  4Z8L A;  3DWL C;  3MMY A;  5GXH A;  5FLX g;  2EBS A;  2G9A A;  4JD2 C;  1PEV A;  4U7A A;  4ERY A;  3PE7 A;  4FA9 D;  2H47 A;  3PXW D;  1K8K C;  3I2N A;  5KDO B;  4PSX B;  4OWR A;  1TBG A;  3JPX A;  5FKS A;  3PVU B;  3RSE C;  4JT5 C;  2B5N A;  5EAR A;  4L3G D;  3VA6 A;  4UI9 R;  4JSP C;  4CI1 A;  2H6Q A;  2YNO A;  3PSL A;  3L4M D;  3IIW A;  4H5I A;  3AFC A;  3RFG A;  1GP2 B;  5EAM A;  4HDJ A;  1JMZ B;  4J73 A;  2CE9 A;  4GM8 A;  2H68 A;  4FA1 D;  2Z2O A;  2H6K A;  3PXS D;  4GM3 A;  4XYI A;  2P9I C;  3EI2 B;  4O1Q D;  2QC5 A;  5B4W A;  2HXC A;  4JSN C;  3W15 A;  2H6N A;  3UR4 A;  1L0Q A;  3RN0 D;  2AGL A;  2UZY B;  3FM0 A;  2IUV A;  2AH1 A;  2GC7 A;  4IMM A;  1U2V C;  2AH0 A;  3UVN A;  5AJA A;  3FRX A;  3UVL A;  3CFV A;  2P9S C;  3F3G A;  4J84 A;  3UVM A;  4J79 A;  2PM9 B;  2AGZ A;  3IJC A;  4KFM B;  3I7H A;  4J82 A;  3KRW B;  5I5M A;  2AGX A;  2AQ5 A;  4AOW A;  2OVQ B;  1R5M A;  5CXC A;  2J57 G;  3BG1 A;  1S4U X;  4GMB A;  4FWW A;  5FKR A;  4A0A A;  4A09 A;  3EI4 A;  2HJ4 A;  3BWS A;  4XYH A;  2IAA A;  3EI1 A;  3EI3 B;  3OTT A;  4ZOZ A;  1A0R B;  1GXR A;  2I3S A;  3FGB A;  4OZU A;  4FAN D;  3ZWL B;  3I8E A;  2W18 A;  2HYE A;  4J81 A;  4CI3 A;  2P9N C;  4ZOX A;  3EMH A;  4LGN A;  3F3F A;  4Y5R D;  5IC7 A;  3BG0 A;  4A7J A;  5EMM B;  2OK6 A;  3SHF A;  2CNX A;  5EM2 B;  5FXY A;  1JJU B;  2XL3 A;  4O3T B;  3RFH A;  4J87 A;  3MZL A;  5SXM A;  4AEZ A;  1U4C A;  4U1E I;  3AL9 A;  3SVW D;  3UVO A;  3I8C A;  3I89 A;  3EI2 A;  4GM9 A;  4CZY A;  2AGY A;  3AL8 B;  2OVR B;  4A11 B;  5AFU 3;  2IWF A;  2YMU A;  3K26 A;  1OMW B;  4ERZ A;  2CO0 C;  2P9U C;  2PBI B;  4FB1 D;  4CY3 A;  2Q7Q A;  3AH8 B;  4CY2 A;  1P22 A;  4CY1 A;  3GRE A;  1OLZ A;  4R7A B;  5EAP A;  4CZX A;  4IA9 A;  3C75 H;  5HE2 B;  5IJ7 E;  1SHY B;  3CFS B;  2HKR A;  2J56 H;  4L9O A;  5HYN B;  2I0T A;  5C9Z B;  2PM9 A;  4QQE A;  2H9L A;  2CO0 A;  2B5M A;  4G56 B;  2AGW A;  4D0K A;  1JOF A;  4E54 A;  3OKY B;  4A2M A;  2GNQ A;  3SMR A;  4A2L A;  1ERJ A;  2HKM A;  2CE8 A;  2B4E A;  5GMK n;  3EI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...