4FAVD

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 50 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4favD00
2OK4A 3I8EA 4L3GD 1FWXA 3F3PA 5I5MA 3V9FA 2XL2A 3AH8B 4JSPC 3VA6A 2PM9A 2IUVA 4QL1A 2QC5A 4FA1D 1QNIA 2I3SA 2P9SC 3A0FA 4A2LA 4BH6A 3EWEA 3RLMD 3SLED 4ZOYA 4O3UB 2B5LA 4PNKB 3JPXA 3UVNA 4XYIA 4X3EA 3BWSA 5CXBB 2PBIB 2B5NA 2B5MA 3RSEC 2H9NA 3EG6A 4J87A 1PGUA 4JXMA 1NR0A 3EI3B 3PXTD 3K26A 4J79A 3RRMC 4E54B 1OLZA 2IAAA 3ODTA 4D6VA 2H68A 1R5MA 2PM7B 5CXCB 3EI1A 4X61B 5IJ7E 1MDAH 4O9DA 4E5ZB 4ESGA 2Q7QA 3P4FA 3OKYA 4E54A 5C2VB 3MZKA 5FLXg 2GC7A 4JT6C 4FHLA 4A0AA 2OIZA 3SCYA 3JB9L 2AGZA 5HYNB 1VYHC 4E5ZA 4ZOVA 1XKSA 3FGBA 3B7FA 3JRPA 3IJ0A 3OKYB 5HE3B 3RMZD 2IUQA 3NVNA 4L3HD 3MKSB 4YVDA 2IUPA 4H5JA 4A0BB 1P22A 3I2NA 3PSLA 5I5IA 5JWZA 2CNXA 3IIWA 1RI6A 2P9IC 2G99A 3RFGA 5FQDA 4I79A 4JSNC 3SFZA 3IJCA 4PSXB 4GZ8A 4CI1A 2HKRA 5AJAA 1SQJA 5HE0B 4AOWA 2OK6A 3PE7A 3UVOA 3BG0A 3VGZA 4FA4D 5IGOA 3OKTA 2W18A 2HJ4A 1N6DA 4J82A 1MG3A 4J77A 5TEEA 3KRWB 4GQ2P 3EMHA 4K3ID 3UKUC 4CZVA 4FAVD 2CN3A 3VH0A 3SXTD 3EI2A 4O1QD 4R7AB 2HXCA 2YNOA 4BL0A 4AEZA 3EI3A 4PBYA 3SMRA 3V5WB 3AFCA 4J84A 5FA5B 5SXMA 5TDHB 2AQ5A 1XHMA 4X60B 3I7OA 5CXCA 3EI4A 3EI1B 2QXVA 2J57G 2XYIA 4G56B 3N0EA 4JT5C 1PI6A 2P9LC 3FM0A 5EALA 3UVMA 4FWWA 1L0QA 2OVPB 5C2WB 4Y7RA 3IJ1A 3F3FA 5H17A 3IKOA 3J81g 5C9ZB 5FKTA 4ZN4A 2HYEA 5AFU3 3JZNA 3I8CA 4J86A 5EMJB 4CY5A 4A0BA 4X63B 2YB8B 3MXXA 4A11B 3JAMg 3ORVD 4GQBB 4LGNA 4GMBA 2P9UC 5FKRA 4J0XA 4OWRA 4N14A 3MMYA 3SJLD 1GOTB 4ZOXA 4PSWB 5TEFA 2OJYA 5GXHA 4L1QD 3SVWD 4BUJC 1JMZB 4A11A 4ZOZA 2Z2PA 1N6EA 4A2MA 4A7JA 4CI8A 4ERYA 2IWFA 4CC9A 4IA9A 4QRJA 3E0CA 5K1CC 5IC7A 4O45A 3EI2B 3L4MD 1TYQC 3I7KA 5FXYA 4Y5RD 2AH0A 2AH1A 1Q47A 3SBQA 2H3XA 3SHFA 1SQ9A 3ULEC 2H9LA 4CI2A 3EI4B 3ZWLB 5GXIA 2OVRB 5AMSA 2CE9A 2H9MA 5H14A 3RN0D 5A2Qg 3DXMC 1SHYB 2IWKA 2I0SA 2AGYA 3C99A 1XIPA 2CN2A 4FA5D 1JJUB 3SBRA 1S4UX 3MKQA 2AGLA 2YMUA 4QQEA 5CYKB 2H13A 3I7NA 3F3GA 5H1MA 3BG1A 2H6KA 3AL9A 4ES0A 5EARA 1GG2B 3UVLA 4J8GA 4FA9D 4CZXA 5CYKA 3IIYA 5EMMB 2OVQB 4KFMB 4GM9A 1PBYB 3FRXA 1JOFA 5FKQA 5HQGA 2Z2OA 3NVQA 4D0KA 2O9KA 4J0WA 2PM6B 4OZUA 1JMXB 5FKSA 4A08B 3PXWD 3UR4A 3UKRC 1ERJA 2P9NC 2UZYB 2EBSA 4EWRA 3SWSD 4MK0B 4UI9R 4PBZA 4GGCA 5I5JA 3I7PA 3HFQA 5IGQA 3C9CA 2HKMA 5EMLB 4CI3A 2CE8A 2MTAH 4U7AA 3V7DB 4J73A 4CY1A 1GP2B 3C75H 4CY3A 4IMMA 3DM0A 3GREA 3OTTA 2B4EA 3K27A 3L4OD 3PSCB 4JD2C 2P9KC 5HE1B 5THAA 2IURA 3KRXB 4QT8A 4A09A 4GM8A 1TBGA 1PEVA 2H47A 2H6QA 3AL8A 2XL3A 2YNPA 1OMWB 2H6NA 2I3TA 5IJ8E 4JSXC 4PXWA 4A09B 3CFVA 3OW8A 3JZHA 2BBKH 3I7HA 3JZGA 5HE2B 3SBPA 1YFQA 3AL8B 3I89A 4L9OA 2XU7A 3CFSB 2CO0A 3SN6B 1U4CA 5EAMA 4GQ1A 4U1EI 1K8KC 3NVXA 3RN1D 1U2VC 2YBAA 4GGDA 5B4WA 4LG8A 4XEIC 3N0DA 5KDOB 4O3TB 4LG9A 5EAPA 1B9YA 3C5MA 4PC0A 3EU7A 4A08A 2GNQA 4J81A 2Z2NA 5EMKB 3CIKB 3PXSD 2AGWA 3U4YA 4K3JB 4CZYA 1K32A 5GSAA 4NSXA 3PVUB 3DXKC 4JSVC 5EM2B 2I0RA 2BCJB 2YNNA 3W15A 4CY2A 1GXRA 5CXBA 3JROA 2HJBA 1MG2A 4H5IA 4GGAA 2AGXA 1B9XA 5EM2A 3RFHA 2P9PC 1NEXB 5GMKn 5IT9g 2J55H 1N6FA 3DWLC 5TF2A 4FAND 4J8BA 2UZXB 3OL2B 3OKWA 2G9AA 2TRCB 3MZLA 2CO0C 2GC4A 2HESX 2J56H 4HDJA 4J78A 2H14A 3GFCA 4Z8LA 5K19A 4GM3A 4XYHA 4TZ4A 4A0AB 3OL2A 4FB1D 4ERZA 2I0TA 3DSMA 4ERQA 3I7LA 1A0RB 3UVKA 2PM9B 3J80g 3PVWB 2H9PA
chains in the Genus database with same CATH superfamily
2OK4A 1QFSA 3I8EA 4L3GD 1FWXA 3F3PA 3IUNA 5I5MA 3V9FA 1L5GA 4G55A 2XL2A 3AH8B 2VZ1A 4JSPC 3VA6A 2PM9A 1E8MA 2IUVA 4QL1A 2QC5A 4FA1D 4Z7OA 1QNIA 3QHYB 2I3SA 2P9SC 3A0FA 4A2LA 4BH6A 3EWEA 3RLMD 3SLED 4ZOYA 4O3UB 2B5LA 4PNKB 3JPXA 2VDQA 3UVNA 4XYIA 4WK2A 4X3EA 3GC3B 3BWSA 1GOGA 5FFGA 4BCBA 5CXBB 3MVDK 4UM9A 4AMYA 1BPOA 1UTCA 2PBIB 2B5NA 1H2XA 2B5MA 3RSEC 2H9NA 3EG6A 4J87A 1PGUA 2VDOA 3IULA 1NR0A 3EI3B 4JXMA 3PXTD 4AMZA 3K26A 4J79A 3RRMC 4E54B 1O6GA 1OLZA 2IAAA 3ODTA 4D6VA 2H68A 1R5MA 2PM7B 5CXCB 3EI1A 4X61B 5IJ7E 1MDAH 4O9DA 4E5ZB 4ESGA 2Q7QA 3P4FA 3OKYA 4E54A 5C2VB 3MZKA 5FLXg 4QAMA 2GC7A 3V4PA 4RE5A 4JT6C 4FHLA 2VDRA 4A0AA 2BKLA 2OIZA 3SCYA 3JB9L 2AGZA 5HYNB 1VYHC 4E5ZA 5C92A 4ZOVA 1XKSA 3FGBA 3B7FA 3JRPA 3IJ0A 3OKYB 4AN0A 5HE3B 3RMZD 2IUQA 3NVNA 1E8NA 3MKSB 4L3HD 4YVDA 2IUPA 4H5JA 4A0BB 1P22A 1JTDB 3I2NA 3KCIA 3PSLA 5I5IA 5JWZA 3K72A 2CNXA 3K71A 3IIWA 3MUOA 3GD1I 1RI6A 2P9IC 2G99A 3RFGA 5FQDA 4I79A 4JSNC 1YR2A 3SFZA 3IJCA 4PSXB 4GZ8A 3ZE1A 4CI1A 2HKRA 5AJAA 1SQJA 5HE0B 4AOWA 2OK6A 3PE7A 3UVOA 3BG0A 3VGZA 4FA4D 5IGOA 1UOOA 3OKTA 2W18A 2HJ4A 1N6DA 3ZE0A 4J82A 1VE7A 1MG3A 4J77A 3IURA 5TEEA 3KRWB 4O02A 4GQ2P 3EMHA 4K3ID 3UKUC 4L1MA 4CZVA 4FAVD 2CN3A 1UOQA 3T3PA 3SXTD 3VH0A 3EI2A 1VZ2A 3NIGA 4O1QD 4R7AB 2HXCA 2YNOA 4BL0A 3FCUA 1A12A 4AEZA 3EI3A 4PBYA 3SMRA 3V5WB 3AFCA 4IRZA 4J84A 5FA5B 5SXMA 5TDHB 2AQ5A 4BP8A 1XHMA 4X60B 4JHNA 3I7OA 1TYEA 5CXCA 3EI4A 3EI1B 3VI4A 2QXVA 2J57G 2XYIA 4G56B 3N0EA 1H2WA 2VDLA 1PI6A 4JT5C 2P9LC 5M5RA 3FM0A 4MMZA 5EALA 3UVMA 4FWWA 1L0QA 2OVPB 3T3MA 2VDMA 5M5VA 5C2WB 4Y7RA 3IJ1A 3F3FA 5H17A 2JKXA 3IKOA 1M1XA 3J81g 5C9ZB 5FKTA 4ZN4A 2HYEA 3ZDZA 5AFU3 3JZNA 3I8CA 4J86A 5EMJB 4CY5A 5M5TA 4A0BA 3IUQA 4X63B 2YB8B 3MXXA 4A11B 3JAMg 3ORVD 4GQBB 4LGNA 4GMBA 3VI3A 2P9UC 3K6SA 5FKRA 4J0XA 4OWRA 4N14A 3MMYA 5E6SA 4NAAA 3SJLD 1GOTB 4ZOXA 4PSWB 5TEFA 3NIDA 2OJYA 5GXHA 4L1QD 4WK4A 3SVWD 4BUJC 4AN1A 1JMZB 4A11A 4ZOZA 2Z2PA 1N6EA 4NC4A 4A2MA 4A7JA 4NBMA 4CI8A 4ERYA 2IWFA 4CC9A 2QZPA 3IJEA 4IA9A 4QRJA 3E0CA 5K1CC 2XE4A 5IC7A 4O45A 3EI2B 3L4MD 1TYQC 3I7KA 5FXYA 1JV2A 3ZE2A 4Y5RD 1GOHA 2AH0A 2AH1A 1Q47A 3SBQA 1VE6A 2H3XA 3IUJA 2HU8A 3SHFA 1GOFA 1SQ9A 3ULEC 2H9LA 4DNUA 3V4VA 4CI2A 3EI4B 3FCSA 3ZWLB 5GXIA 2OVRB 5AMSA 2CE9A 2H9MA 5H14A 3RN0D 4DNVA 5A2Qg 3DXMC 1SHYB 2IWKA 2I0SA 4BCCA 2AGYA 3C99A 1XIPA 2CN2A 4FA5D 2EIEA 1JJUB 3SBRA 1S4UX 3MKQA 2AGLA 1UOPA 2YMUA 4QQEA 5CYKB 2H13A 3I7NA 4AX4A 3F3GA 5H1MA 3BG1A 2H6KA 3AL9A 4ES0A 5EARA 1GG2B 3O4JA 3UVLA 4J8GA 3O4IA 4FA9D 4CZXA 4WJKA 3QI0A 5CYKA 3IIYA 5EMMB 5M5UA 2OVQB 4KFMB 4GM9A 1PBYB 3FRXA 1JOFA 5FKQA 2HU7A 5HQGA 1QFMA 2Z2OA 3NVQA 4D0KA 4UM8A 1T2XA 4MMXA 2O9KA 4J0WA 2PM6B 4OZUA 1JMXB 5FKSA 4A08B 1C9LA 3PXWD 3UR4A 3EQ9A 3UKRC 1ERJA 2P9NC 4BP9A 1H2YA 4Z7QA 2UZYB 2EBSA 4EWRA 1VZ3A 3SWSD 4MK0B 5FFOA 4UI9R 4PBZA 4GGCA 5I5JA 3I7PA 3HFQA 4JHPC 4BCDA 5M5SA 5IGQA 3C9CA 2HKMA 4RE6A 5EMLB 4CI3A 2CE8A 5C86A 2EIDA 2MTAH 4U7AA 3V7DB 4J73A 4CY1A 1GP2B 3C75H 4CY3A 4IMMA 3DM0A 3GREA 3OTTA 2B4EA 3K27A 3L4OD 3EQ7A 3PSCB 4JD2C 2P9KC 5HE1B 5THAA 2IURA 4MMYA 3KRXB 1O6FA 4QT8A 4A09A 4GM8A 1TBGA 1PEVA 2H47A 2VZ3A 2H6QA 5HDBA 3AL8A 4G1EA 2XZGA 2XL3A 2YNPA 1OMWB 2H6NA 2I3TA 3MUNA 5E6RA 5IJ8E 4JSXC 4PXWA 4A09B 3CFVA 3OW8A 3EQ8A 3JZHA 2BBKH 4D9SA 3I7HA 3O4HA 3JZGA 5HE2B 3SBPA 1YFQA 3AL8B 2VC2A 4G1MA 3I89A 4L9OA 2XU7A 3CFSB 2CO0A 3SN6B 1U4CA 5EAMA 4GQ1A 4U1EI 1K8KC 1U8CA 3NVXA 3RN1D 1U2VC 2EICA 2YBAA 1C9IA 4GGDA 5B4WA 4LG8A 4XEIC 3N0DA 1K3IA 4NENA 5KDOB 4O3TB 4LG9A 5EAPA 1B9YA 3C5MA 4PC0A 3EU7A 4O2WA 4A08A 2GNQA 4J81A 3ZDXA 2Z2NA 4WK0A 2VDNA 5EMKB 2WQ8A 2VDPA 3CIKB 3PXSD 2HU5A 2AGWA 2XDWA 3U4YA 4K3JB 4CZYA 4DNWA 1K32A 5GSAA 4NSXA 3PVUB 3DXKC 4JSVC 5EM2B 2I0RA 2BCJB 3O4GA 2YNNA 3W15A 4CY2A 3OF7A 1GXRA 5CXBA 3JROA 1E5TA 2HJBA 3NIFA 1MG2A 3DDUA 5E6UA 4H5IA 4GGAA 2AGXA 1B9XA 2QR5A 5EM2A 3RFHA 3ZDYA 2P9PC 1NEXB 5GMKn 3IUMA 5IT9g 2J55H 1N6FA 3DWLC 5TF2A 4FAND 4J8BA 2VDKA 2UZXB 3OL2B 3OKWA 2G9AA 2TRCB 3MZLA 2CO0C 2GC4A 2HESX 2J56H 4HDJA 4J78A 2H14A 3GFCA 2EIBA 4Z8LA 4Z7NA 5K19A 3IVMA 4GM3A 4XYHA 1I2MB 4TZ4A 4A0AB 3OL2A 4FB1D 4ERZA 5M61A 1H2ZA 2I0TA 3DSMA 4ERQA 3I7LA 1A0RB 3UVKA 2PM9B 3J80g 3PVWB 2H9PA
chains in the Genus database with same CATH topology
2OK4A 3I8EA 4L3GD 1FWXA 3F3PA 5I5MA 3V9FA 2XL2A 3AH8B 4JSPC 3VA6A 2PM9A 2IUVA 4QL1A 2QC5A 4FA1D 1QNIA 2I3SA 2P9SC 3A0FA 4A2LA 4BH6A 3EWEA 3RLMD 3SLED 4ZOYA 4O3UB 2B5LA 4PNKB 3JPXA 3UVNA 4XYIA 4X3EA 3BWSA 5CXBB 2PBIB 2B5NA 2B5MA 3RSEC 2H9NA 3EG6A 4J87A 1PGUA 4JXMA 1NR0A 3EI3B 3PXTD 3K26A 4J79A 3RRMC 4E54B 1OLZA 2IAAA 3ODTA 4D6VA 2H68A 1R5MA 2PM7B 5CXCB 3EI1A 4X61B 5IJ7E 1MDAH 4O9DA 4E5ZB 4ESGA 2Q7QA 3P4FA 3OKYA 4E54A 5C2VB 3MZKA 5FLXg 2GC7A 4JT6C 4FHLA 4A0AA 2OIZA 3SCYA 3JB9L 2AGZA 5HYNB 1VYHC 4E5ZA 4ZOVA 1XKSA 3FGBA 3B7FA 3JRPA 3IJ0A 3OKYB 5HE3B 3RMZD 2IUQA 3NVNA 4L3HD 3MKSB 4YVDA 2IUPA 4H5JA 4A0BB 1P22A 3I2NA 3PSLA 5I5IA 5JWZA 2CNXA 3IIWA 1RI6A 2P9IC 2G99A 3RFGA 5FQDA 4I79A 4JSNC 3SFZA 3IJCA 4PSXB 4GZ8A 4CI1A 2HKRA 5AJAA 1SQJA 5HE0B 4AOWA 2OK6A 3PE7A 3UVOA 3BG0A 3VGZA 4FA4D 5IGOA 3OKTA 2W18A 2HJ4A 1N6DA 4J82A 1MG3A 4J77A 5TEEA 3KRWB 4GQ2P 3EMHA 4K3ID 3UKUC 4CZVA 4FAVD 2CN3A 3VH0A 3SXTD 3EI2A 4O1QD 4R7AB 2HXCA 2YNOA 4BL0A 4AEZA 3EI3A 4PBYA 3SMRA 3V5WB 3AFCA 4J84A 5FA5B 5SXMA 5TDHB 2AQ5A 1XHMA 4X60B 3I7OA 5CXCA 3EI4A 3EI1B 2QXVA 2J57G 2XYIA 4G56B 3N0EA 4JT5C 1PI6A 2P9LC 3FM0A 5EALA 3UVMA 4FWWA 1L0QA 2OVPB 5C2WB 4Y7RA 3IJ1A 3F3FA 5H17A 3IKOA 3J81g 5C9ZB 5FKTA 4ZN4A 2HYEA 5AFU3 3JZNA 3I8CA 4J86A 5EMJB 4CY5A 4A0BA 4X63B 2YB8B 3MXXA 4A11B 3JAMg 3ORVD 4GQBB 4LGNA 4GMBA 2P9UC 5FKRA 4J0XA 4OWRA 4N14A 3MMYA 3SJLD 1GOTB 4ZOXA 4PSWB 5TEFA 2OJYA 5GXHA 4L1QD 3SVWD 4BUJC 1JMZB 4A11A 4ZOZA 2Z2PA 1N6EA 4A2MA 4A7JA 4CI8A 4ERYA 2IWFA 4CC9A 4IA9A 4QRJA 3E0CA 5K1CC 5IC7A 4O45A 3EI2B 3L4MD 1TYQC 3I7KA 5FXYA 4Y5RD 2AH0A 2AH1A 1Q47A 3SBQA 2H3XA 3SHFA 1SQ9A 3ULEC 2H9LA 4CI2A 3EI4B 3ZWLB 5GXIA 2OVRB 5AMSA 2CE9A 2H9MA 5H14A 3RN0D 5A2Qg 3DXMC 1SHYB 2IWKA 2I0SA 2AGYA 3C99A 1XIPA 2CN2A 4FA5D 1JJUB 3SBRA 1S4UX 3MKQA 2AGLA 2YMUA 4QQEA 5CYKB 2H13A 3I7NA 3F3GA 5H1MA 3BG1A 2H6KA 3AL9A 4ES0A 5EARA 1GG2B 3UVLA 4J8GA 4FA9D 4CZXA 5CYKA 3IIYA 5EMMB 2OVQB 4KFMB 4GM9A 1PBYB 3FRXA 1JOFA 5FKQA 5HQGA 2Z2OA 3NVQA 4D0KA 2O9KA 4J0WA 2PM6B 4OZUA 1JMXB 5FKSA 4A08B 3PXWD 3UR4A 3UKRC 1ERJA 2P9NC 2UZYB 2EBSA 4EWRA 3SWSD 4MK0B 4UI9R 4PBZA 4GGCA 5I5JA 3I7PA 3HFQA 5IGQA 3C9CA 2HKMA 5EMLB 4CI3A 2CE8A 2MTAH 4U7AA 3V7DB 4J73A 4CY1A 1GP2B 3C75H 4CY3A 4IMMA 3DM0A 3GREA 3OTTA 2B4EA 3K27A 3L4OD 3PSCB 4JD2C 2P9KC 5HE1B 5THAA 2IURA 3KRXB 4QT8A 4A09A 4GM8A 1TBGA 1PEVA 2H47A 2H6QA 3AL8A 2XL3A 2YNPA 1OMWB 2H6NA 2I3TA 5IJ8E 4JSXC 4PXWA 4A09B 3CFVA 3OW8A 3JZHA 2BBKH 3I7HA 3JZGA 5HE2B 3SBPA 1YFQA 3AL8B 3I89A 4L9OA 2XU7A 3CFSB 2CO0A 3SN6B 1U4CA 5EAMA 4GQ1A 4U1EI 1K8KC 3NVXA 3RN1D 1U2VC 2YBAA 4GGDA 5B4WA 4LG8A 4XEIC 3N0DA 5KDOB 4O3TB 4LG9A 5EAPA 1B9YA 3C5MA 4PC0A 3EU7A 4A08A 2GNQA 4J81A 2Z2NA 5EMKB 3CIKB 3PXSD 2AGWA 3U4YA 4K3JB 4CZYA 1K32A 5GSAA 4NSXA 3PVUB 3DXKC 4JSVC 5EM2B 2I0RA 2BCJB 2YNNA 3W15A 4CY2A 1GXRA 5CXBA 3JROA 2HJBA 1MG2A 4H5IA 4GGAA 2AGXA 1B9XA 5EM2A 3RFHA 2P9PC 1NEXB 5GMKn 5IT9g 2J55H 1N6FA 3DWLC 5TF2A 4FAND 4J8BA 2UZXB 3OL2B 3OKWA 2G9AA 2TRCB 3MZLA 2CO0C 2GC4A 2HESX 2J56H 4HDJA 4J78A 2H14A 3GFCA 4Z8LA 5K19A 4GM3A 4XYHA 4TZ4A 4A0AB 3OL2A 4FB1D 4ERZA 2I0TA 3DSMA 4ERQA 3I7LA 1A0RB 3UVKA 2PM9B 3J80g 3PVWB 2H9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OK4 A;  3I8E A;  4L3G D;  1FWX A;  3F3P A;  5I5M A;  3V9F A;  2XL2 A;  3AH8 B;  4JSP C;  3VA6 A;  2PM9 A;  2IUV A;  4QL1 A;  2QC5 A;  4FA1 D;  1QNI A;  2I3S A;  2P9S C;  3A0F A;  4A2L A;  4BH6 A;  3EWE A;  3RLM D;  3SLE D;  4ZOY A;  4O3U B;  2B5L A;  4PNK B;  3JPX A;  3UVN A;  4XYI A;  4X3E A;  3BWS A;  5CXB B;  2PBI B;  2B5N A;  2B5M A;  3RSE C;  2H9N A;  3EG6 A;  4J87 A;  1PGU A;  4JXM A;  1NR0 A;  3EI3 B;  3PXT D;  3K26 A;  4J79 A;  3RRM C;  4E54 B;  1OLZ A;  2IAA A;  3ODT A;  4D6V A;  2H68 A;  1R5M A;  2PM7 B;  5CXC B;  3EI1 A;  4X61 B;  5IJ7 E;  1MDA H;  4O9D A;  4E5Z B;  4ESG A;  2Q7Q A;  3P4F A;  3OKY A;  4E54 A;  5C2V B;  3MZK A;  5FLX g;  2GC7 A;  4JT6 C;  4FHL A;  4A0A A;  2OIZ A;  3SCY A;  3JB9 L;  2AGZ A;  5HYN B;  1VYH C;  4E5Z A;  4ZOV A;  1XKS A;  3FGB A;  3B7F A;  3JRP A;  3IJ0 A;  3OKY B;  5HE3 B;  3RMZ D;  2IUQ A;  3NVN A;  4L3H D;  3MKS B;  4YVD A;  2IUP A;  4H5J A;  4A0B B;  1P22 A;  3I2N A;  3PSL A;  5I5I A;  5JWZ A;  2CNX A;  3IIW A;  1RI6 A;  2P9I C;  2G99 A;  3RFG A;  5FQD A;  4I79 A;  4JSN C;  3SFZ A;  3IJC A;  4PSX B;  4GZ8 A;  4CI1 A;  2HKR A;  5AJA A;  1SQJ A;  5HE0 B;  4AOW A;  2OK6 A;  3PE7 A;  3UVO A;  3BG0 A;  3VGZ A;  4FA4 D;  5IGO A;  3OKT A;  2W18 A;  2HJ4 A;  1N6D A;  4J82 A;  1MG3 A;  4J77 A;  5TEE A;  3KRW B;  4GQ2 P;  3EMH A;  4K3I D;  3UKU C;  4CZV A;  4FAV D;  2CN3 A;  3VH0 A;  3SXT D;  3EI2 A;  4O1Q D;  4R7A B;  2HXC A;  2YNO A;  4BL0 A;  4AEZ A;  3EI3 A;  4PBY A;  3SMR A;  3V5W B;  3AFC A;  4J84 A;  5FA5 B;  5SXM A;  5TDH B;  2AQ5 A;  1XHM A;  4X60 B;  3I7O A;  5CXC A;  3EI4 A;  3EI1 B;  2QXV A;  2J57 G;  2XYI A;  4G56 B;  3N0E A;  4JT5 C;  1PI6 A;  2P9L C;  3FM0 A;  5EAL A;  3UVM A;  4FWW A;  1L0Q A;  2OVP B;  5C2W B;  4Y7R A;  3IJ1 A;  3F3F A;  5H17 A;  3IKO A;  3J81 g;  5C9Z B;  5FKT A;  4ZN4 A;  2HYE A;  5AFU 3;  3JZN A;  3I8C A;  4J86 A;  5EMJ B;  4CY5 A;  4A0B A;  4X63 B;  2YB8 B;  3MXX A;  4A11 B;  3JAM g;  3ORV D;  4GQB B;  4LGN A;  4GMB A;  2P9U C;  5FKR A;  4J0X A;  4OWR A;  4N14 A;  3MMY A;  3SJL D;  1GOT B;  4ZOX A;  4PSW B;  5TEF A;  2OJY A;  5GXH A;  4L1Q D;  3SVW D;  4BUJ C;  1JMZ B;  4A11 A;  4ZOZ A;  2Z2P A;  1N6E A;  4A2M A;  4A7J A;  4CI8 A;  4ERY A;  2IWF A;  4CC9 A;  4IA9 A;  4QRJ A;  3E0C A;  5K1C C;  5IC7 A;  4O45 A;  3EI2 B;  3L4M D;  1TYQ C;  3I7K A;  5FXY A;  4Y5R D;  2AH0 A;  2AH1 A;  1Q47 A;  3SBQ A;  2H3X A;  3SHF A;  1SQ9 A;  3ULE C;  2H9L A;  4CI2 A;  3EI4 B;  3ZWL B;  5GXI A;  2OVR B;  5AMS A;  2CE9 A;  2H9M A;  5H14 A;  3RN0 D;  5A2Q g;  3DXM C;  1SHY B;  2IWK A;  2I0S A;  2AGY A;  3C99 A;  1XIP A;  2CN2 A;  4FA5 D;  1JJU B;  3SBR A;  1S4U X;  3MKQ A;  2AGL A;  2YMU A;  4QQE A;  5CYK B;  2H13 A;  3I7N A;  3F3G A;  5H1M A;  3BG1 A;  2H6K A;  3AL9 A;  4ES0 A;  5EAR A;  1GG2 B;  3UVL A;  4J8G A;  4FA9 D;  4CZX A;  5CYK A;  3IIY A;  5EMM B;  2OVQ B;  4KFM B;  4GM9 A;  1PBY B;  3FRX A;  1JOF A;  5FKQ A;  5HQG A;  2Z2O A;  3NVQ A;  4D0K A;  2O9K A;  4J0W A;  2PM6 B;  4OZU A;  1JMX B;  5FKS A;  4A08 B;  3PXW D;  3UR4 A;  3UKR C;  1ERJ A;  2P9N C;  2UZY B;  2EBS A;  4EWR A;  3SWS D;  4MK0 B;  4UI9 R;  4PBZ A;  4GGC A;  5I5J A;  3I7P A;  3HFQ A;  5IGQ A;  3C9C A;  2HKM A;  5EML B;  4CI3 A;  2CE8 A;  2MTA H;  4U7A A;  3V7D B;  4J73 A;  4CY1 A;  1GP2 B;  3C75 H;  4CY3 A;  4IMM A;  3DM0 A;  3GRE A;  3OTT A;  2B4E A;  3K27 A;  3L4O D;  3PSC B;  4JD2 C;  2P9K C;  5HE1 B;  5THA A;  2IUR A;  3KRX B;  4QT8 A;  4A09 A;  4GM8 A;  1TBG A;  1PEV A;  2H47 A;  2H6Q A;  3AL8 A;  2XL3 A;  2YNP A;  1OMW B;  2H6N A;  2I3T A;  5IJ8 E;  4JSX C;  4PXW A;  4A09 B;  3CFV A;  3OW8 A;  3JZH A;  2BBK H;  3I7H A;  3JZG A;  5HE2 B;  3SBP A;  1YFQ A;  3AL8 B;  3I89 A;  4L9O A;  2XU7 A;  3CFS B;  2CO0 A;  3SN6 B;  1U4C A;  5EAM A;  4GQ1 A;  4U1E I;  1K8K C;  3NVX A;  3RN1 D;  1U2V C;  2YBA A;  4GGD A;  5B4W A;  4LG8 A;  4XEI C;  3N0D A;  5KDO B;  4O3T B;  4LG9 A;  5EAP A;  1B9Y A;  3C5M A;  4PC0 A;  3EU7 A;  4A08 A;  2GNQ A;  4J81 A;  2Z2N A;  5EMK B;  3CIK B;  3PXS D;  2AGW A;  3U4Y A;  4K3J B;  4CZY A;  1K32 A;  5GSA A;  4NSX A;  3PVU B;  3DXK C;  4JSV C;  5EM2 B;  2I0R A;  2BCJ B;  2YNN A;  3W15 A;  4CY2 A;  1GXR A;  5CXB A;  3JRO A;  2HJB A;  1MG2 A;  4H5I A;  4GGA A;  2AGX A;  1B9X A;  5EM2 A;  3RFH A;  2P9P C;  1NEX B;  5GMK n;  5IT9 g;  2J55 H;  1N6F A;  3DWL C;  5TF2 A;  4FAN D;  4J8B A;  2UZX B;  3OL2 B;  3OKW A;  2G9A A;  2TRC B;  3MZL A;  2CO0 C;  2GC4 A;  2HES X;  2J56 H;  4HDJ A;  4J78 A;  2H14 A;  3GFC A;  4Z8L A;  5K19 A;  4GM3 A;  4XYH A;  4TZ4 A;  4A0A B;  3OL2 A;  4FB1 D;  4ERZ A;  2I0T A;  3DSM A;  4ERQ A;  3I7L A;  1A0R B;  3UVK A;  2PM9 B;  3J80 g;  3PVW B;  2H9P A; 
#chains in the Genus database with same CATH topology
 2OK4 A;  1QFS A;  3I8E A;  4L3G D;  1FWX A;  3F3P A;  3IUN A;  5I5M A;  3V9F A;  1L5G A;  4G55 A;  2XL2 A;  3AH8 B;  2VZ1 A;  4JSP C;  3VA6 A;  2PM9 A;  1E8M A;  2IUV A;  4QL1 A;  2QC5 A;  4FA1 D;  4Z7O A;  1QNI A;  3QHY B;  2I3S A;  2P9S C;  3A0F A;  4A2L A;  4BH6 A;  3EWE A;  3RLM D;  3SLE D;  4ZOY A;  4O3U B;  2B5L A;  4PNK B;  3JPX A;  2VDQ A;  3UVN A;  4XYI A;  4WK2 A;  4X3E A;  3GC3 B;  3BWS A;  1GOG A;  5FFG A;  4BCB A;  5CXB B;  3MVD K;  4UM9 A;  4AMY A;  1BPO A;  1UTC A;  2PBI B;  2B5N A;  1H2X A;  2B5M A;  3RSE C;  2H9N A;  3EG6 A;  4J87 A;  1PGU A;  2VDO A;  3IUL A;  1NR0 A;  3EI3 B;  4JXM A;  3PXT D;  4AMZ A;  3K26 A;  4J79 A;  3RRM C;  4E54 B;  1O6G A;  1OLZ A;  2IAA A;  3ODT A;  4D6V A;  2H68 A;  1R5M A;  2PM7 B;  5CXC B;  3EI1 A;  4X61 B;  5IJ7 E;  1MDA H;  4O9D A;  4E5Z B;  4ESG A;  2Q7Q A;  3P4F A;  3OKY A;  4E54 A;  5C2V B;  3MZK A;  5FLX g;  4QAM A;  2GC7 A;  3V4P A;  4RE5 A;  4JT6 C;  4FHL A;  2VDR A;  4A0A A;  2BKL A;  2OIZ A;  3SCY A;  3JB9 L;  2AGZ A;  5HYN B;  1VYH C;  4E5Z A;  5C92 A;  4ZOV A;  1XKS A;  3FGB A;  3B7F A;  3JRP A;  3IJ0 A;  3OKY B;  4AN0 A;  5HE3 B;  3RMZ D;  2IUQ A;  3NVN A;  1E8N A;  3MKS B;  4L3H D;  4YVD A;  2IUP A;  4H5J A;  4A0B B;  1P22 A;  1JTD B;  3I2N A;  3KCI A;  3PSL A;  5I5I A;  5JWZ A;  3K72 A;  2CNX A;  3K71 A;  3IIW A;  3MUO A;  3GD1 I;  1RI6 A;  2P9I C;  2G99 A;  3RFG A;  5FQD A;  4I79 A;  4JSN C;  1YR2 A;  3SFZ A;  3IJC A;  4PSX B;  4GZ8 A;  3ZE1 A;  4CI1 A;  2HKR A;  5AJA A;  1SQJ A;  5HE0 B;  4AOW A;  2OK6 A;  3PE7 A;  3UVO A;  3BG0 A;  3VGZ A;  4FA4 D;  5IGO A;  1UOO A;  3OKT A;  2W18 A;  2HJ4 A;  1N6D A;  3ZE0 A;  4J82 A;  1VE7 A;  1MG3 A;  4J77 A;  3IUR A;  5TEE A;  3KRW B;  4O02 A;  4GQ2 P;  3EMH A;  4K3I D;  3UKU C;  4L1M A;  4CZV A;  4FAV D;  2CN3 A;  1UOQ A;  3T3P A;  3SXT D;  3VH0 A;  3EI2 A;  1VZ2 A;  3NIG A;  4O1Q D;  4R7A B;  2HXC A;  2YNO A;  4BL0 A;  3FCU A;  1A12 A;  4AEZ A;  3EI3 A;  4PBY A;  3SMR A;  3V5W B;  3AFC A;  4IRZ A;  4J84 A;  5FA5 B;  5SXM A;  5TDH B;  2AQ5 A;  4BP8 A;  1XHM A;  4X60 B;  4JHN A;  3I7O A;  1TYE A;  5CXC A;  3EI4 A;  3EI1 B;  3VI4 A;  2QXV A;  2J57 G;  2XYI A;  4G56 B;  3N0E A;  1H2W A;  2VDL A;  1PI6 A;  4JT5 C;  2P9L C;  5M5R A;  3FM0 A;  4MMZ A;  5EAL A;  3UVM A;  4FWW A;  1L0Q A;  2OVP B;  3T3M A;  2VDM A;  5M5V A;  5C2W B;  4Y7R A;  3IJ1 A;  3F3F A;  5H17 A;  2JKX A;  3IKO A;  1M1X A;  3J81 g;  5C9Z B;  5FKT A;  4ZN4 A;  2HYE A;  3ZDZ A;  5AFU 3;  3JZN A;  3I8C A;  4J86 A;  5EMJ B;  4CY5 A;  5M5T A;  4A0B A;  3IUQ A;  4X63 B;  2YB8 B;  3MXX A;  4A11 B;  3JAM g;  3ORV D;  4GQB B;  4LGN A;  4GMB A;  3VI3 A;  2P9U C;  3K6S A;  5FKR A;  4J0X A;  4OWR A;  4N14 A;  3MMY A;  5E6S A;  4NAA A;  3SJL D;  1GOT B;  4ZOX A;  4PSW B;  5TEF A;  3NID A;  2OJY A;  5GXH A;  4L1Q D;  4WK4 A;  3SVW D;  4BUJ C;  4AN1 A;  1JMZ B;  4A11 A;  4ZOZ A;  2Z2P A;  1N6E A;  4NC4 A;  4A2M A;  4A7J A;  4NBM A;  4CI8 A;  4ERY A;  2IWF A;  4CC9 A;  2QZP A;  3IJE A;  4IA9 A;  4QRJ A;  3E0C A;  5K1C C;  2XE4 A;  5IC7 A;  4O45 A;  3EI2 B;  3L4M D;  1TYQ C;  3I7K A;  5FXY A;  1JV2 A;  3ZE2 A;  4Y5R D;  1GOH A;  2AH0 A;  2AH1 A;  1Q47 A;  3SBQ A;  1VE6 A;  2H3X A;  3IUJ A;  2HU8 A;  3SHF A;  1GOF A;  1SQ9 A;  3ULE C;  2H9L A;  4DNU A;  3V4V A;  4CI2 A;  3EI4 B;  3FCS A;  3ZWL B;  5GXI A;  2OVR B;  5AMS A;  2CE9 A;  2H9M A;  5H14 A;  3RN0 D;  4DNV A;  5A2Q g;  3DXM C;  1SHY B;  2IWK A;  2I0S A;  4BCC A;  2AGY A;  3C99 A;  1XIP A;  2CN2 A;  4FA5 D;  2EIE A;  1JJU B;  3SBR A;  1S4U X;  3MKQ A;  2AGL A;  1UOP A;  2YMU A;  4QQE A;  5CYK B;  2H13 A;  3I7N A;  4AX4 A;  3F3G A;  5H1M A;  3BG1 A;  2H6K A;  3AL9 A;  4ES0 A;  5EAR A;  1GG2 B;  3O4J A;  3UVL A;  4J8G A;  3O4I A;  4FA9 D;  4CZX A;  4WJK A;  3QI0 A;  5CYK A;  3IIY A;  5EMM B;  5M5U A;  2OVQ B;  4KFM B;  4GM9 A;  1PBY B;  3FRX A;  1JOF A;  5FKQ A;  2HU7 A;  5HQG A;  1QFM A;  2Z2O A;  3NVQ A;  4D0K A;  4UM8 A;  1T2X A;  4MMX A;  2O9K A;  4J0W A;  2PM6 B;  4OZU A;  1JMX B;  5FKS A;  4A08 B;  1C9L A;  3PXW D;  3UR4 A;  3EQ9 A;  3UKR C;  1ERJ A;  2P9N C;  4BP9 A;  1H2Y A;  4Z7Q A;  2UZY B;  2EBS A;  4EWR A;  1VZ3 A;  3SWS D;  4MK0 B;  5FFO A;  4UI9 R;  4PBZ A;  4GGC A;  5I5J A;  3I7P A;  3HFQ A;  4JHP C;  4BCD A;  5M5S A;  5IGQ A;  3C9C A;  2HKM A;  4RE6 A;  5EML B;  4CI3 A;  2CE8 A;  5C86 A;  2EID A;  2MTA H;  4U7A A;  3V7D B;  4J73 A;  4CY1 A;  1GP2 B;  3C75 H;  4CY3 A;  4IMM A;  3DM0 A;  3GRE A;  3OTT A;  2B4E A;  3K27 A;  3L4O D;  3EQ7 A;  3PSC B;  4JD2 C;  2P9K C;  5HE1 B;  5THA A;  2IUR A;  4MMY A;  3KRX B;  1O6F A;  4QT8 A;  4A09 A;  4GM8 A;  1TBG A;  1PEV A;  2H47 A;  2VZ3 A;  2H6Q A;  5HDB A;  3AL8 A;  4G1E A;  2XZG A;  2XL3 A;  2YNP A;  1OMW B;  2H6N A;  2I3T A;  3MUN A;  5E6R A;  5IJ8 E;  4JSX C;  4PXW A;  4A09 B;  3CFV A;  3OW8 A;  3EQ8 A;  3JZH A;  2BBK H;  4D9S A;  3I7H A;  3O4H A;  3JZG A;  5HE2 B;  3SBP A;  1YFQ A;  3AL8 B;  2VC2 A;  4G1M A;  3I89 A;  4L9O A;  2XU7 A;  3CFS B;  2CO0 A;  3SN6 B;  1U4C A;  5EAM A;  4GQ1 A;  4U1E I;  1K8K C;  1U8C A;  3NVX A;  3RN1 D;  1U2V C;  2EIC A;  2YBA A;  1C9I A;  4GGD A;  5B4W A;  4LG8 A;  4XEI C;  3N0D A;  1K3I A;  4NEN A;  5KDO B;  4O3T B;  4LG9 A;  5EAP A;  1B9Y A;  3C5M A;  4PC0 A;  3EU7 A;  4O2W A;  4A08 A;  2GNQ A;  4J81 A;  3ZDX A;  2Z2N A;  4WK0 A;  2VDN A;  5EMK B;  2WQ8 A;  2VDP A;  3CIK B;  3PXS D;  2HU5 A;  2AGW A;  2XDW A;  3U4Y A;  4K3J B;  4CZY A;  4DNW A;  1K32 A;  5GSA A;  4NSX A;  3PVU B;  3DXK C;  4JSV C;  5EM2 B;  2I0R A;  2BCJ B;  3O4G A;  2YNN A;  3W15 A;  4CY2 A;  3OF7 A;  1GXR A;  5CXB A;  3JRO A;  1E5T A;  2HJB A;  3NIF A;  1MG2 A;  3DDU A;  5E6U A;  4H5I A;  4GGA A;  2AGX A;  1B9X A;  2QR5 A;  5EM2 A;  3RFH A;  3ZDY A;  2P9P C;  1NEX B;  5GMK n;  3IUM A;  5IT9 g;  2J55 H;  1N6F A;  3DWL C;  5TF2 A;  4FAN D;  4J8B A;  2VDK A;  2UZX B;  3OL2 B;  3OKW A;  2G9A A;  2TRC B;  3MZL A;  2CO0 C;  2GC4 A;  2HES X;  2J56 H;  4HDJ A;  4J78 A;  2H14 A;  3GFC A;  2EIB A;  4Z8L A;  4Z7N A;  5K19 A;  3IVM A;  4GM3 A;  4XYH A;  1I2M B;  4TZ4 A;  4A0A B;  3OL2 A;  4FB1 D;  4ERZ A;  5M61 A;  1H2Z A;  2I0T A;  3DSM A;  4ERQ A;  3I7L A;  1A0R B;  3UVK A;  2PM9 B;  3J80 g;  3PVW B;  2H9P A; 
#chains in the Genus database with same CATH homology
 2OK4 A;  3I8E A;  4L3G D;  1FWX A;  3F3P A;  5I5M A;  3V9F A;  2XL2 A;  3AH8 B;  4JSP C;  3VA6 A;  2PM9 A;  2IUV A;  4QL1 A;  2QC5 A;  4FA1 D;  1QNI A;  2I3S A;  2P9S C;  3A0F A;  4A2L A;  4BH6 A;  3EWE A;  3RLM D;  3SLE D;  4ZOY A;  4O3U B;  2B5L A;  4PNK B;  3JPX A;  3UVN A;  4XYI A;  4X3E A;  3BWS A;  5CXB B;  2PBI B;  2B5N A;  2B5M A;  3RSE C;  2H9N A;  3EG6 A;  4J87 A;  1PGU A;  4JXM A;  1NR0 A;  3EI3 B;  3PXT D;  3K26 A;  4J79 A;  3RRM C;  4E54 B;  1OLZ A;  2IAA A;  3ODT A;  4D6V A;  2H68 A;  1R5M A;  2PM7 B;  5CXC B;  3EI1 A;  4X61 B;  5IJ7 E;  1MDA H;  4O9D A;  4E5Z B;  4ESG A;  2Q7Q A;  3P4F A;  3OKY A;  4E54 A;  5C2V B;  3MZK A;  5FLX g;  2GC7 A;  4JT6 C;  4FHL A;  4A0A A;  2OIZ A;  3SCY A;  3JB9 L;  2AGZ A;  5HYN B;  1VYH C;  4E5Z A;  4ZOV A;  1XKS A;  3FGB A;  3B7F A;  3JRP A;  3IJ0 A;  3OKY B;  5HE3 B;  3RMZ D;  2IUQ A;  3NVN A;  4L3H D;  3MKS B;  4YVD A;  2IUP A;  4H5J A;  4A0B B;  1P22 A;  3I2N A;  3PSL A;  5I5I A;  5JWZ A;  2CNX A;  3IIW A;  1RI6 A;  2P9I C;  2G99 A;  3RFG A;  5FQD A;  4I79 A;  4JSN C;  3SFZ A;  3IJC A;  4PSX B;  4GZ8 A;  4CI1 A;  2HKR A;  5AJA A;  1SQJ A;  5HE0 B;  4AOW A;  2OK6 A;  3PE7 A;  3UVO A;  3BG0 A;  3VGZ A;  4FA4 D;  5IGO A;  3OKT A;  2W18 A;  2HJ4 A;  1N6D A;  4J82 A;  1MG3 A;  4J77 A;  5TEE A;  3KRW B;  4GQ2 P;  3EMH A;  4K3I D;  3UKU C;  4CZV A;  4FAV D;  2CN3 A;  3VH0 A;  3SXT D;  3EI2 A;  4O1Q D;  4R7A B;  2HXC A;  2YNO A;  4BL0 A;  4AEZ A;  3EI3 A;  4PBY A;  3SMR A;  3V5W B;  3AFC A;  4J84 A;  5FA5 B;  5SXM A;  5TDH B;  2AQ5 A;  1XHM A;  4X60 B;  3I7O A;  5CXC A;  3EI4 A;  3EI1 B;  2QXV A;  2J57 G;  2XYI A;  4G56 B;  3N0E A;  4JT5 C;  1PI6 A;  2P9L C;  3FM0 A;  5EAL A;  3UVM A;  4FWW A;  1L0Q A;  2OVP B;  5C2W B;  4Y7R A;  3IJ1 A;  3F3F A;  5H17 A;  3IKO A;  3J81 g;  5C9Z B;  5FKT A;  4ZN4 A;  2HYE A;  5AFU 3;  3JZN A;  3I8C A;  4J86 A;  5EMJ B;  4CY5 A;  4A0B A;  4X63 B;  2YB8 B;  3MXX A;  4A11 B;  3JAM g;  3ORV D;  4GQB B;  4LGN A;  4GMB A;  2P9U C;  5FKR A;  4J0X A;  4OWR A;  4N14 A;  3MMY A;  3SJL D;  1GOT B;  4ZOX A;  4PSW B;  5TEF A;  2OJY A;  5GXH A;  4L1Q D;  3SVW D;  4BUJ C;  1JMZ B;  4A11 A;  4ZOZ A;  2Z2P A;  1N6E A;  4A2M A;  4A7J A;  4CI8 A;  4ERY A;  2IWF A;  4CC9 A;  4IA9 A;  4QRJ A;  3E0C A;  5K1C C;  5IC7 A;  4O45 A;  3EI2 B;  3L4M D;  1TYQ C;  3I7K A;  5FXY A;  4Y5R D;  2AH0 A;  2AH1 A;  1Q47 A;  3SBQ A;  2H3X A;  3SHF A;  1SQ9 A;  3ULE C;  2H9L A;  4CI2 A;  3EI4 B;  3ZWL B;  5GXI A;  2OVR B;  5AMS A;  2CE9 A;  2H9M A;  5H14 A;  3RN0 D;  5A2Q g;  3DXM C;  1SHY B;  2IWK A;  2I0S A;  2AGY A;  3C99 A;  1XIP A;  2CN2 A;  4FA5 D;  1JJU B;  3SBR A;  1S4U X;  3MKQ A;  2AGL A;  2YMU A;  4QQE A;  5CYK B;  2H13 A;  3I7N A;  3F3G A;  5H1M A;  3BG1 A;  2H6K A;  3AL9 A;  4ES0 A;  5EAR A;  1GG2 B;  3UVL A;  4J8G A;  4FA9 D;  4CZX A;  5CYK A;  3IIY A;  5EMM B;  2OVQ B;  4KFM B;  4GM9 A;  1PBY B;  3FRX A;  1JOF A;  5FKQ A;  5HQG A;  2Z2O A;  3NVQ A;  4D0K A;  2O9K A;  4J0W A;  2PM6 B;  4OZU A;  1JMX B;  5FKS A;  4A08 B;  3PXW D;  3UR4 A;  3UKR C;  1ERJ A;  2P9N C;  2UZY B;  2EBS A;  4EWR A;  3SWS D;  4MK0 B;  4UI9 R;  4PBZ A;  4GGC A;  5I5J A;  3I7P A;  3HFQ A;  5IGQ A;  3C9C A;  2HKM A;  5EML B;  4CI3 A;  2CE8 A;  2MTA H;  4U7A A;  3V7D B;  4J73 A;  4CY1 A;  1GP2 B;  3C75 H;  4CY3 A;  4IMM A;  3DM0 A;  3GRE A;  3OTT A;  2B4E A;  3K27 A;  3L4O D;  3PSC B;  4JD2 C;  2P9K C;  5HE1 B;  5THA A;  2IUR A;  3KRX B;  4QT8 A;  4A09 A;  4GM8 A;  1TBG A;  1PEV A;  2H47 A;  2H6Q A;  3AL8 A;  2XL3 A;  2YNP A;  1OMW B;  2H6N A;  2I3T A;  5IJ8 E;  4JSX C;  4PXW A;  4A09 B;  3CFV A;  3OW8 A;  3JZH A;  2BBK H;  3I7H A;  3JZG A;  5HE2 B;  3SBP A;  1YFQ A;  3AL8 B;  3I89 A;  4L9O A;  2XU7 A;  3CFS B;  2CO0 A;  3SN6 B;  1U4C A;  5EAM A;  4GQ1 A;  4U1E I;  1K8K C;  3NVX A;  3RN1 D;  1U2V C;  2YBA A;  4GGD A;  5B4W A;  4LG8 A;  4XEI C;  3N0D A;  5KDO B;  4O3T B;  4LG9 A;  5EAP A;  1B9Y A;  3C5M A;  4PC0 A;  3EU7 A;  4A08 A;  2GNQ A;  4J81 A;  2Z2N A;  5EMK B;  3CIK B;  3PXS D;  2AGW A;  3U4Y A;  4K3J B;  4CZY A;  1K32 A;  5GSA A;  4NSX A;  3PVU B;  3DXK C;  4JSV C;  5EM2 B;  2I0R A;  2BCJ B;  2YNN A;  3W15 A;  4CY2 A;  1GXR A;  5CXB A;  3JRO A;  2HJB A;  1MG2 A;  4H5I A;  4GGA A;  2AGX A;  1B9X A;  5EM2 A;  3RFH A;  2P9P C;  1NEX B;  5GMK n;  5IT9 g;  2J55 H;  1N6F A;  3DWL C;  5TF2 A;  4FAN D;  4J8B A;  2UZX B;  3OL2 B;  3OKW A;  2G9A A;  2TRC B;  3MZL A;  2CO0 C;  2GC4 A;  2HES X;  2J56 H;  4HDJ A;  4J78 A;  2H14 A;  3GFC A;  4Z8L A;  5K19 A;  4GM3 A;  4XYH A;  4TZ4 A;  4A0A B;  3OL2 A;  4FB1 D;  4ERZ A;  2I0T A;  3DSM A;  4ERQ A;  3I7L A;  1A0R B;  3UVK A;  2PM9 B;  3J80 g;  3PVW B;  2H9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...