2OJYA

Crystal structure of indol-3-acetaldehyde derived ttq-amide adduct of aromatic amine dehydrogenase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 99
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ojyA01
5FQDA 3JZHA 2XYIA 1GG2B 5FKTA 1ERJA 4N14A 4G56B 3CFSB 2XL2A 4GQ1A 3EI4B 4A2MA 3IKOA 5I5MA 4FAND 2P9NC 4Y7RA 2UZYB 2J55H 4CI8A 2P9UC 3N0DA 3JB9L 4H5JA 3SBRA 4H5IA 3C75H 4A2LA 4J87A 3RFHA 3SJLD 3BWSA 4J0XA 4E5ZA 2AGXA 2BBKH 2H14A 5FXYA 3UVNA 4QL1A 5EALA 5HE2B 3DXMC 2YNPA 1B9YA 2IWKA 3MMYA 4O1QD 2H68A 3EI1A 1K8KC 3SMRA 3RSEC 2HKRA 4JSNC 4JT6C 2AH0A 3OKWA 3KRXB 5C2VB 3K26A 2TRCB 4KFMB 2OK4A 4CY5A 3CFVA 1GXRA 3BG0A 2G99A 4PSWB 3VA6A 4O3TB 4K3ID 1JMZB 5FA5B 3AH8B 4X61B 3JAMg 2PM9B 4D6VA 4BL0A 4FHLA 2I0TA 3MZLA 3MXXA 2AH1A 2H47A 4L3HD 2B5MA 5IT9g 2IUPA 3SVWD 2IUVA 4O45A 1OMWB 4A09B 4O3UB 3PE7A 2CN3A 5FKRA 4Z8LA 2Q7QA 3DWLC 5CXCA 3RLMD 4J8BA 3GFCA 5IGOA 1PI6A 4JT5C 4ERQA 2HKMA 3SBQA 5I5JA 5GSAA 3DSMA 2H6KA 4J86A 4CI3A 4ZOYA 4CY1A 4A08B 5AMSA 3EI2B 2PBIB 5HQGA 5HE0B 3DM0A 4U7AA 3I7OA 4BH6A 3B7FA 1Q47A 3C99A 3MKQA 4JSVC 2Z2NA 5EM2A 2CO0C 3FGBA 1K32A 5C2WB 3I7HA 3MKSB 1A0RB 5TEEA 4GZ8A 4AEZA 4A0AA 1N6DA 3A0FA 3I2NA 2I0RA 4E5ZB 2IAAA 2IWFA 2P9IC 1JJUB 3V9FA 3UVLA 2QXVA 3OL2A 5IJ8E 4FA4D 4ZOVA 4L3GD 5THAA 4GQBB 4FA5D 2CE9A 4UI9R 3EI1B 4CI2A 3UVKA 4E54B 3PVUB 4J84A 5A2Qg 5IC7A 3JZNA 4ERZA 4BUJC 3RN1D 4JSXC 3ORVD 4TZ4A 2CE8A 4K3JB 4GGAA 3OTTA 2IURA 4GGCA 4LG9A 2I3TA 5GXIA 5H14A 2CNXA 4J73A 2XU7A 4R7AB 4GQ2P 3I8CA 3U4YA 3JROA 4CZYA 4ES0A 5GMKn 2P9KC 2H9NA 5EARA 4A11A 5AJAA 5K1CC 1YFQA 1S4UX 1NR0A 1TYQC 3UKRC 4MK0B 3IJ1A 1NEXB 4ZN4A 3SHFA 4U1EI 3V7DB 2AQ5A 3L4OD 4J8GA 3NVQA 3HFQA 5CXCB 5TEFA 2Z2OA 2GC7A 3SCYA 5HE1B 3I8EA 2H9PA 2OJYA 1L0QA 4PXWA 1MDAH 4LG8A 4L9OA 2YBAA 4ESGA 4X60B 4NSXA 3UR4A 3PXSD 2W18A 2H13A 3PXTD 3SN6B 3SLED 4FA9D 5IGQA 3ODTA 4J81A 4J77A 4JD2C 3ULEC 3SWSD 3JZGA 5EM2B 3AL8A 5CYKA 4OZUA 3F3FA 4OWRA 4A0AB 4CY3A 2GC4A 3NVXA 5HE3B 2XL3A 1XIPA 3F3GA 1JOFA 3OL2B 1PEVA 2HJ4A 1VYHC 3JRPA 1N6EA 2I3SA 2B5NA 3EI3A 3VH0A 2O9KA 1TBGA 4IMMA 3SFZA 4ZOXA 3ZWLB 5EAPA 3EWEA 3FRXA 4HDJA 4XEIC 1GOTB 3CIKB 3FM0A 4J82A 1MG3A 3C9CA 1XKSA 5TF2A 2HYEA 2H6NA 2YNNA 3PSCB 3OKTA 3IJ0A 5IJ7E 4YVDA 2YNOA 3J81g 4J79A 2YB8B 4A11B 2H6QA 3IJCA 4CC9A 5EMMB 3SBPA 4GGDA 4FA1D 3GREA 4LGNA 4XYIA 1XHMA 2B4EA 5FKSA 4ERYA 4FWWA 3OW8A 4ZOZA 1N6FA 5TDHB 4A0BA 3I7NA 4O9DA 2AGZA 3I7KA 2QC5A 4GM9A 5C9ZB 3AFCA 2G9AA 2PM7B 3UVMA 3J80g 5I5IA 3I7LA 4XYHA 5K19A 4FAVD 3I7PA 1MG2A 3RMZD 4GM8A 5CXBA 4J0WA 4JXMA 1QNIA 3PXWD 1SQ9A 4CI1A 2H9LA 5FKQA 3OKYA 3W15A 3P4FA 5KDOB 4CZXA 1B9XA 2OIZA 2P9SC 5EAMA 1SQJA 4QRJA 2B5LA 2OK6A 1GP2B 3AL8B 3EI4A 4I79A 4QT8A 3RRMC 4E54A 5CYKB 3F3PA 3RN0D 5HYNB 2GNQA 2CO0A 3K27A 1JMXB 2AGLA 2H9MA 3BG1A 1FWXA 1PBYB 2CN2A 2HESX 2EBSA 1U4CA 3MZKA 4L1QD 2OVRB 4A7JA 1SHYB 3EI3B 5B4WA 3RFGA 2UZXB 3PSLA 4D0KA 3EG6A 4CZVA 3JPXA 4X3EA 3IIWA 5JWZA 3EU7A 2I0SA 1R5MA 4GMBA 4X63B 4J78A 5EMLB 2BCJB 3E0CA 3C5MA 3IIYA 3L4MD 3V5WB 2AGWA 4IA9A 3I89A 5GXHA 2AGYA 1P22A 4PBZA 3AL9A 2PM9A 1U2VC 2H3XA 3VGZA 3SXTD 2MTAH 4AOWA 3PVWB 4A0BB 4PC0A 2HJBA 1OLZA 2IUQA 2PM6B 1PGUA 3DXKC 5EMJB 2OVPB 2J57G 4A09A 4GM3A 5EMKB 4PSXB 4Y5RD 2OVQB 2Z2PA 5FLXg 4JSPC 4EWRA 5AFU3 5H17A 4FB1D 4PBYA 4PNKB 3N0EA 2YMUA 5CXBB 3NVNA 5H1MA 2P9LC 4QQEA 3KRWB 3UKUC 3UVOA 2J56H 1RI6A 3EMHA 2P9PC 3OKYB 2HXCA 4A08A 3EI2A 5SXMA 4CY2A
chains in the Genus database with same CATH superfamily
5FQDA 2VDLA 3JZHA 3EQ8A 2XYIA 3IUJA 1GG2B 3ZE2A 1E5TA 5FKTA 1ERJA 4N14A 4G56B 3CFSB 2XL2A 4O2WA 4GQ1A 3EI4B 4A2MA 3IKOA 5I5MA 4FAND 1T2XA 2P9NC 1VZ3A 2UZYB 4Y7RA 2J55H 4CI8A 2P9UC 3N0DA 3JB9L 4H5JA 3SBRA 4H5IA 3C75H 3NIDA 4A2LA 1A12A 4J87A 1UOPA 3RFHA 4BCBA 5M61A 3SJLD 3BWSA 4J0XA 3IUNA 4E5ZA 2AGXA 2BBKH 2H14A 3OF7A 5FXYA 3UVNA 4QL1A 5EALA 1UOOA 5HE2B 3DXMC 2YNPA 1B9YA 2IWKA 3MMYA 4O1QD 2H68A 3EI1A 1K8KC 3SMRA 3RSEC 2HKRA 4JSNC 4JT6C 2AH0A 3OKWA 3KRXB 3V4PA 5C2VB 3K26A 2TRCB 4KFMB 2OK4A 4CY5A 3CFVA 2EIEA 3IUQA 2VDRA 4JHPC 3FCSA 1GXRA 3BG0A 2G99A 4PSWB 5M5UA 3VA6A 3ZDYA 2JKXA 4AN0A 4O3TB 4K3ID 1JMZB 4WJKA 5FA5B 3AH8B 4X61B 3JAMg 2PM9B 4D6VA 4BL0A 4FHLA 2I0TA 3MZLA 2VDQA 3MXXA 5FFOA 2AH1A 2H47A 1JV2A 4L3HD 2B5MA 5IT9g 2IUPA 3SVWD 2IUVA 4O45A 4DNUA 1H2XA 1OMWB 4A09B 4O3UB 3PE7A 4BCDA 2CN3A 5FKRA 4Z8LA 2VDKA 2Q7QA 3DWLC 1M1XA 2VDNA 5CXCA 3RLMD 3IVMA 4J8BA 5E6SA 5M5RA 4Z7OA 3GFCA 5IGOA 1PI6A 4JT5C 4ERQA 2HKMA 3SBQA 5I5JA 1VE7A 1VZ2A 3DSMA 5GSAA 2H6KA 4J86A 4CI3A 2VZ1A 4ZOYA 4G1EA 4CY1A 4Z7NA 4A08B 3K6SA 5AMSA 3EI2B 2PBIB 5HQGA 1BPOA 5HE0B 3DM0A 4AN1A 4U7AA 3I7OA 4BH6A 3B7FA 1Q47A 3C99A 3MKQA 4JHNA 1C9IA 1QFSA 4JSVC 2Z2NA 4BP8A 5EM2A 2CO0C 3FGBA 1K32A 4O02A 5C2WB 5M5TA 3I7HA 3MKSB 1A0RB 5TEEA 4GZ8A 4AEZA 4A0AA 1N6DA 3A0FA 3I2NA 2I0RA 4E5ZB 2IAAA 4RE5A 2IWFA 2P9IC 1JJUB 3V9FA 3UVLA 2QXVA 3OL2A 5IJ8E 4FA4D 4ZOVA 4L3GD 5THAA 4GQBB 4FA5D 2CE9A 4UI9R 3EI1B 3ZE0A 4CI2A 3UVKA 4E54B 3PVUB 4J84A 3EQ7A 5A2Qg 5IC7A 3JZNA 4ERZA 4BUJC 3RN1D 1H2YA 3IURA 4JSXC 3ORVD 2VDPA 4TZ4A 2CE8A 4K3JB 4GGAA 3OTTA 3O4HA 2IURA 4GGCA 4LG9A 2I3TA 5GXIA 5H14A 2CNXA 4J73A 2XU7A 4RE6A 3O4IA 1GOFA 4R7AB 4GQ2P 3I8CA 4UM8A 3U4YA 3JROA 1JTDB 4CZYA 4ES0A 5GMKn 2P9KC 2H9NA 4MMXA 5EARA 4A11A 5AJAA 5K1CC 1YFQA 1S4UX 2EIBA 4MMYA 1NR0A 1TYQC 3UKRC 4MK0B 5M5SA 3IJ1A 1NEXB 4ZN4A 3SHFA 1H2ZA 4U1EI 3V7DB 2AQ5A 3L4OD 4J8GA 5FFGA 3NVQA 4NC4A 3T3MA 3HFQA 5CXCB 5TEFA 2Z2OA 4QAMA 2GC7A 3GC3B 3SCYA 1U8CA 5HE1B 3I8EA 2VZ3A 2H9PA 2OJYA 1L0QA 4PXWA 3NIFA 1MDAH 4LG8A 4L9OA 2YBAA 4ESGA 4X60B 4NSXA 3UR4A 3PXSD 2EIDA 2W18A 4NBMA 2H13A 4WK4A 3PXTD 3SN6B 2VDMA 3SLED 4FA9D 5IGQA 3ODTA 4J81A 3ZDXA 4J77A 4JD2C 3ULEC 3SWSD 3JZGA 5EM2B 3AL8A 3IJEA 2HU7A 5CYKA 4OZUA 1GOGA 3F3FA 4OWRA 4A0AB 4CY3A 1GOHA 2GC4A 3NVXA 3K72A 5HE3B 2XL3A 2XDWA 1XIPA 3F3GA 1JOFA 3OL2B 3VI3A 1PEVA 2HJ4A 1VYHC 3QHYB 3JRPA 2EICA 1N6EA 2I3SA 2B5NA 3EI3A 3K71A 3VH0A 2O9KA 1L5GA 1TBGA 3QI0A 4IMMA 3SFZA 4ZOXA 4DNVA 4Z7QA 5C86A 3ZWLB 5EAPA 3EWEA 3FRXA 4HDJA 4XEIC 1GOTB 3CIKB 3FM0A 4J82A 1MG3A 1TYEA 3C9CA 1XKSA 5TF2A 2HYEA 2H6NA 2YNNA 1O6GA 3PSCB 3O4JA 3OKTA 1QFMA 3IJ0A 5IJ7E 4YVDA 2YNOA 3ZDZA 3J81g 5M5VA 2HU5A 4J79A 2YB8B 4A11B 2H6QA 3IJCA 4CC9A 5EMMB 3SBPA 4GGDA 4FA1D 3GREA 1UOQA 4LGNA 4XYIA 1XHMA 2B4EA 5FKSA 4ERYA 4FWWA 3OW8A 4ZOZA 1N6FA 5TDHB 4A0BA 3I7NA 4O9DA 2XZGA 3T3PA 2AGZA 3I7KA 2QC5A 4GM9A 5C9ZB 2WQ8A 4L1MA 3AFCA 2G9AA 2PM7B 3UVMA 3J80g 5I5IA 3I7LA 4XYHA 2BKLA 4BP9A 5K19A 4FAVD 1E8MA 3I7PA 1MG2A 2HU8A 1C9LA 3RMZD 4GM8A 5CXBA 4J0WA 4JXMA 4AX4A 5HDBA 1QNIA 3PXWD 4NENA 1SQ9A 4CI1A 2H9LA 5FKQA 4WK2A 3OKYA 3W15A 3P4FA 1H2WA 5KDOB 4NAAA 1I2MB 4CZXA 1B9XA 2OIZA 3DDUA 2P9SC 4MMZA 3EQ9A 3MVDK 5EAMA 1SQJA 4WK0A 4QRJA 2B5LA 2OK6A 1GP2B 3AL8B 3EI4A 4I79A 4QT8A 5E6UA 3RRMC 5CYKB 4E54A 3F3PA 2VC2A 3RN0D 5HYNB 2GNQA 2CO0A 3K27A 1JMXB 4G55A 3KCIA 1VE6A 2AGLA 2H9MA 3BG1A 1FWXA 4AMZA 1PBYB 2CN2A 2HESX 2EBSA 1U4CA 5E6RA 3MZKA 3NIGA 4L1QD 2OVRB 4A7JA 1SHYB 3EI3B 5B4WA 4D9SA 3RFGA 2UZXB 3PSLA 2VDOA 3V4VA 4D0KA 3MUNA 3EG6A 4CZVA 3JPXA 4X3EA 3O4GA 5C92A 3IIWA 5JWZA 3GD1I 3EU7A 2I0SA 1R5MA 4GMBA 3IULA 4X63B 4J78A 1YR2A 5EMLB 2BCJB 3E0CA 4AMYA 4BCCA 3C5MA 3IIYA 3L4MD 3V5WB 2AGWA 1O6FA 4IA9A 1UTCA 3I89A 2QZPA 5GXHA 4IRZA 2AGYA 1P22A 4PBZA 3AL9A 2PM9A 1U2VC 2XE4A 4G1MA 2H3XA 3VGZA 3SXTD 2MTAH 4AOWA 1E8NA 3PVWB 4A0BB 4PC0A 2HJBA 1OLZA 2IUQA 3DXKC 1PGUA 2PM6B 5EMJB 2OVPB 2J57G 4A09A 3ZE1A 4GM3A 5EMKB 4PSXB 4Y5RD 2OVQB 2Z2PA 4DNWA 5FLXg 4JSPC 4EWRA 5AFU3 5H17A 3VI4A 4FB1D 4PBYA 4PNKB 3N0EA 1K3IA 3FCUA 2YMUA 3IUMA 3NVNA 2QR5A 2P9LC 5CXBB 4UM9A 5H1MA 4QQEA 3KRWB 3UKUC 3UVOA 2J56H 3MUOA 1RI6A 3EMHA 2P9PC 3OKYB 2HXCA 4A08A 3EI2A 5SXMA 4CY2A
chains in the Genus database with same CATH topology
5FQDA 3JZHA 2XYIA 1GG2B 5FKTA 1ERJA 4N14A 4G56B 3CFSB 2XL2A 4GQ1A 3EI4B 4A2MA 3IKOA 5I5MA 4FAND 2P9NC 4Y7RA 2UZYB 2J55H 4CI8A 2P9UC 3N0DA 3JB9L 4H5JA 3SBRA 4H5IA 3C75H 4A2LA 4J87A 3RFHA 3SJLD 3BWSA 4J0XA 4E5ZA 2AGXA 2BBKH 2H14A 5FXYA 3UVNA 4QL1A 5EALA 5HE2B 3DXMC 2YNPA 1B9YA 2IWKA 3MMYA 4O1QD 2H68A 3EI1A 1K8KC 3SMRA 3RSEC 2HKRA 4JSNC 4JT6C 2AH0A 3OKWA 3KRXB 5C2VB 3K26A 2TRCB 4KFMB 2OK4A 4CY5A 3CFVA 1GXRA 3BG0A 2G99A 4PSWB 3VA6A 4O3TB 4K3ID 1JMZB 5FA5B 3AH8B 4X61B 3JAMg 2PM9B 4D6VA 4BL0A 4FHLA 2I0TA 3MZLA 3MXXA 2AH1A 2H47A 4L3HD 2B5MA 5IT9g 2IUPA 3SVWD 2IUVA 4O45A 1OMWB 4A09B 4O3UB 3PE7A 2CN3A 5FKRA 4Z8LA 2Q7QA 3DWLC 5CXCA 3RLMD 4J8BA 3GFCA 5IGOA 1PI6A 4JT5C 4ERQA 2HKMA 3SBQA 5I5JA 5GSAA 3DSMA 2H6KA 4J86A 4CI3A 4ZOYA 4CY1A 4A08B 5AMSA 3EI2B 2PBIB 5HQGA 5HE0B 3DM0A 4U7AA 3I7OA 4BH6A 3B7FA 1Q47A 3C99A 3MKQA 4JSVC 2Z2NA 5EM2A 2CO0C 3FGBA 1K32A 5C2WB 3I7HA 3MKSB 1A0RB 5TEEA 4GZ8A 4AEZA 4A0AA 1N6DA 3A0FA 3I2NA 2I0RA 4E5ZB 2IAAA 2IWFA 2P9IC 1JJUB 3V9FA 3UVLA 2QXVA 3OL2A 5IJ8E 4FA4D 4ZOVA 4L3GD 5THAA 4GQBB 4FA5D 2CE9A 4UI9R 3EI1B 4CI2A 3UVKA 4E54B 3PVUB 4J84A 5A2Qg 5IC7A 3JZNA 4ERZA 4BUJC 3RN1D 4JSXC 3ORVD 4TZ4A 2CE8A 4K3JB 4GGAA 3OTTA 2IURA 4GGCA 4LG9A 2I3TA 5GXIA 5H14A 2CNXA 4J73A 2XU7A 4R7AB 4GQ2P 3I8CA 3U4YA 3JROA 4CZYA 4ES0A 5GMKn 2P9KC 2H9NA 5EARA 4A11A 5AJAA 5K1CC 1YFQA 1S4UX 1NR0A 1TYQC 3UKRC 4MK0B 3IJ1A 1NEXB 4ZN4A 3SHFA 4U1EI 3V7DB 2AQ5A 3L4OD 4J8GA 3NVQA 3HFQA 5CXCB 5TEFA 2Z2OA 2GC7A 3SCYA 5HE1B 3I8EA 2H9PA 2OJYA 1L0QA 4PXWA 1MDAH 4LG8A 4L9OA 2YBAA 4ESGA 4X60B 4NSXA 3UR4A 3PXSD 2W18A 2H13A 3PXTD 3SN6B 3SLED 4FA9D 5IGQA 3ODTA 4J81A 4J77A 4JD2C 3ULEC 3SWSD 3JZGA 5EM2B 3AL8A 5CYKA 4OZUA 3F3FA 4OWRA 4A0AB 4CY3A 2GC4A 3NVXA 5HE3B 2XL3A 1XIPA 3F3GA 1JOFA 3OL2B 1PEVA 2HJ4A 1VYHC 3JRPA 1N6EA 2I3SA 2B5NA 3EI3A 3VH0A 2O9KA 1TBGA 4IMMA 3SFZA 4ZOXA 3ZWLB 5EAPA 3EWEA 3FRXA 4HDJA 4XEIC 1GOTB 3CIKB 3FM0A 4J82A 1MG3A 3C9CA 1XKSA 5TF2A 2HYEA 2H6NA 2YNNA 3PSCB 3OKTA 3IJ0A 5IJ7E 4YVDA 2YNOA 3J81g 4J79A 2YB8B 4A11B 2H6QA 3IJCA 4CC9A 5EMMB 3SBPA 4GGDA 4FA1D 3GREA 4LGNA 4XYIA 1XHMA 2B4EA 5FKSA 4ERYA 4FWWA 3OW8A 4ZOZA 1N6FA 5TDHB 4A0BA 3I7NA 4O9DA 2AGZA 3I7KA 2QC5A 4GM9A 5C9ZB 3AFCA 2G9AA 2PM7B 3UVMA 3J80g 5I5IA 3I7LA 4XYHA 5K19A 4FAVD 3I7PA 1MG2A 3RMZD 4GM8A 5CXBA 4J0WA 4JXMA 1QNIA 3PXWD 1SQ9A 4CI1A 2H9LA 5FKQA 3OKYA 3W15A 3P4FA 5KDOB 4CZXA 1B9XA 2OIZA 2P9SC 5EAMA 1SQJA 4QRJA 2B5LA 2OK6A 1GP2B 3AL8B 3EI4A 4I79A 4QT8A 3RRMC 4E54A 5CYKB 3F3PA 3RN0D 5HYNB 2GNQA 2CO0A 3K27A 1JMXB 2AGLA 2H9MA 3BG1A 1FWXA 1PBYB 2CN2A 2HESX 2EBSA 1U4CA 3MZKA 4L1QD 2OVRB 4A7JA 1SHYB 3EI3B 5B4WA 3RFGA 2UZXB 3PSLA 4D0KA 3EG6A 4CZVA 3JPXA 4X3EA 3IIWA 5JWZA 3EU7A 2I0SA 1R5MA 4GMBA 4X63B 4J78A 5EMLB 2BCJB 3E0CA 3C5MA 3IIYA 3L4MD 3V5WB 2AGWA 4IA9A 3I89A 5GXHA 2AGYA 1P22A 4PBZA 3AL9A 2PM9A 1U2VC 2H3XA 3VGZA 3SXTD 2MTAH 4AOWA 3PVWB 4A0BB 4PC0A 2HJBA 1OLZA 2IUQA 2PM6B 1PGUA 3DXKC 5EMJB 2OVPB 2J57G 4A09A 4GM3A 5EMKB 4PSXB 4Y5RD 2OVQB 2Z2PA 5FLXg 4JSPC 4EWRA 5AFU3 5H17A 4FB1D 4PBYA 4PNKB 3N0EA 2YMUA 5CXBB 3NVNA 5H1MA 2P9LC 4QQEA 3KRWB 3UKUC 3UVOA 2J56H 1RI6A 3EMHA 2P9PC 3OKYB 2HXCA 4A08A 3EI2A 5SXMA 4CY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQD A;  3JZH A;  2XYI A;  1GG2 B;  5FKT A;  1ERJ A;  4N14 A;  4G56 B;  3CFS B;  2XL2 A;  4GQ1 A;  3EI4 B;  4A2M A;  3IKO A;  5I5M A;  4FAN D;  2P9N C;  4Y7R A;  2UZY B;  2J55 H;  4CI8 A;  2P9U C;  3N0D A;  3JB9 L;  4H5J A;  3SBR A;  4H5I A;  3C75 H;  4A2L A;  4J87 A;  3RFH A;  3SJL D;  3BWS A;  4J0X A;  4E5Z A;  2AGX A;  2BBK H;  2H14 A;  5FXY A;  3UVN A;  4QL1 A;  5EAL A;  5HE2 B;  3DXM C;  2YNP A;  1B9Y A;  2IWK A;  3MMY A;  4O1Q D;  2H68 A;  3EI1 A;  1K8K C;  3SMR A;  3RSE C;  2HKR A;  4JSN C;  4JT6 C;  2AH0 A;  3OKW A;  3KRX B;  5C2V B;  3K26 A;  2TRC B;  4KFM B;  2OK4 A;  4CY5 A;  3CFV A;  1GXR A;  3BG0 A;  2G99 A;  4PSW B;  3VA6 A;  4O3T B;  4K3I D;  1JMZ B;  5FA5 B;  3AH8 B;  4X61 B;  3JAM g;  2PM9 B;  4D6V A;  4BL0 A;  4FHL A;  2I0T A;  3MZL A;  3MXX A;  2AH1 A;  2H47 A;  4L3H D;  2B5M A;  5IT9 g;  2IUP A;  3SVW D;  2IUV A;  4O45 A;  1OMW B;  4A09 B;  4O3U B;  3PE7 A;  2CN3 A;  5FKR A;  4Z8L A;  2Q7Q A;  3DWL C;  5CXC A;  3RLM D;  4J8B A;  3GFC A;  5IGO A;  1PI6 A;  4JT5 C;  4ERQ A;  2HKM A;  3SBQ A;  5I5J A;  5GSA A;  3DSM A;  2H6K A;  4J86 A;  4CI3 A;  4ZOY A;  4CY1 A;  4A08 B;  5AMS A;  3EI2 B;  2PBI B;  5HQG A;  5HE0 B;  3DM0 A;  4U7A A;  3I7O A;  4BH6 A;  3B7F A;  1Q47 A;  3C99 A;  3MKQ A;  4JSV C;  2Z2N A;  5EM2 A;  2CO0 C;  3FGB A;  1K32 A;  5C2W B;  3I7H A;  3MKS B;  1A0R B;  5TEE A;  4GZ8 A;  4AEZ A;  4A0A A;  1N6D A;  3A0F A;  3I2N A;  2I0R A;  4E5Z B;  2IAA A;  2IWF A;  2P9I C;  1JJU B;  3V9F A;  3UVL A;  2QXV A;  3OL2 A;  5IJ8 E;  4FA4 D;  4ZOV A;  4L3G D;  5THA A;  4GQB B;  4FA5 D;  2CE9 A;  4UI9 R;  3EI1 B;  4CI2 A;  3UVK A;  4E54 B;  3PVU B;  4J84 A;  5A2Q g;  5IC7 A;  3JZN A;  4ERZ A;  4BUJ C;  3RN1 D;  4JSX C;  3ORV D;  4TZ4 A;  2CE8 A;  4K3J B;  4GGA A;  3OTT A;  2IUR A;  4GGC A;  4LG9 A;  2I3T A;  5GXI A;  5H14 A;  2CNX A;  4J73 A;  2XU7 A;  4R7A B;  4GQ2 P;  3I8C A;  3U4Y A;  3JRO A;  4CZY A;  4ES0 A;  5GMK n;  2P9K C;  2H9N A;  5EAR A;  4A11 A;  5AJA A;  5K1C C;  1YFQ A;  1S4U X;  1NR0 A;  1TYQ C;  3UKR C;  4MK0 B;  3IJ1 A;  1NEX B;  4ZN4 A;  3SHF A;  4U1E I;  3V7D B;  2AQ5 A;  3L4O D;  4J8G A;  3NVQ A;  3HFQ A;  5CXC B;  5TEF A;  2Z2O A;  2GC7 A;  3SCY A;  5HE1 B;  3I8E A;  2H9P A;  2OJY A;  1L0Q A;  4PXW A;  1MDA H;  4LG8 A;  4L9O A;  2YBA A;  4ESG A;  4X60 B;  4NSX A;  3UR4 A;  3PXS D;  2W18 A;  2H13 A;  3PXT D;  3SN6 B;  3SLE D;  4FA9 D;  5IGQ A;  3ODT A;  4J81 A;  4J77 A;  4JD2 C;  3ULE C;  3SWS D;  3JZG A;  5EM2 B;  3AL8 A;  5CYK A;  4OZU A;  3F3F A;  4OWR A;  4A0A B;  4CY3 A;  2GC4 A;  3NVX A;  5HE3 B;  2XL3 A;  1XIP A;  3F3G A;  1JOF A;  3OL2 B;  1PEV A;  2HJ4 A;  1VYH C;  3JRP A;  1N6E A;  2I3S A;  2B5N A;  3EI3 A;  3VH0 A;  2O9K A;  1TBG A;  4IMM A;  3SFZ A;  4ZOX A;  3ZWL B;  5EAP A;  3EWE A;  3FRX A;  4HDJ A;  4XEI C;  1GOT B;  3CIK B;  3FM0 A;  4J82 A;  1MG3 A;  3C9C A;  1XKS A;  5TF2 A;  2HYE A;  2H6N A;  2YNN A;  3PSC B;  3OKT A;  3IJ0 A;  5IJ7 E;  4YVD A;  2YNO A;  3J81 g;  4J79 A;  2YB8 B;  4A11 B;  2H6Q A;  3IJC A;  4CC9 A;  5EMM B;  3SBP A;  4GGD A;  4FA1 D;  3GRE A;  4LGN A;  4XYI A;  1XHM A;  2B4E A;  5FKS A;  4ERY A;  4FWW A;  3OW8 A;  4ZOZ A;  1N6F A;  5TDH B;  4A0B A;  3I7N A;  4O9D A;  2AGZ A;  3I7K A;  2QC5 A;  4GM9 A;  5C9Z B;  3AFC A;  2G9A A;  2PM7 B;  3UVM A;  3J80 g;  5I5I A;  3I7L A;  4XYH A;  5K19 A;  4FAV D;  3I7P A;  1MG2 A;  3RMZ D;  4GM8 A;  5CXB A;  4J0W A;  4JXM A;  1QNI A;  3PXW D;  1SQ9 A;  4CI1 A;  2H9L A;  5FKQ A;  3OKY A;  3W15 A;  3P4F A;  5KDO B;  4CZX A;  1B9X A;  2OIZ A;  2P9S C;  5EAM A;  1SQJ A;  4QRJ A;  2B5L A;  2OK6 A;  1GP2 B;  3AL8 B;  3EI4 A;  4I79 A;  4QT8 A;  3RRM C;  4E54 A;  5CYK B;  3F3P A;  3RN0 D;  5HYN B;  2GNQ A;  2CO0 A;  3K27 A;  1JMX B;  2AGL A;  2H9M A;  3BG1 A;  1FWX A;  1PBY B;  2CN2 A;  2HES X;  2EBS A;  1U4C A;  3MZK A;  4L1Q D;  2OVR B;  4A7J A;  1SHY B;  3EI3 B;  5B4W A;  3RFG A;  2UZX B;  3PSL A;  4D0K A;  3EG6 A;  4CZV A;  3JPX A;  4X3E A;  3IIW A;  5JWZ A;  3EU7 A;  2I0S A;  1R5M A;  4GMB A;  4X63 B;  4J78 A;  5EML B;  2BCJ B;  3E0C A;  3C5M A;  3IIY A;  3L4M D;  3V5W B;  2AGW A;  4IA9 A;  3I89 A;  5GXH A;  2AGY A;  1P22 A;  4PBZ A;  3AL9 A;  2PM9 A;  1U2V C;  2H3X A;  3VGZ A;  3SXT D;  2MTA H;  4AOW A;  3PVW B;  4A0B B;  4PC0 A;  2HJB A;  1OLZ A;  2IUQ A;  2PM6 B;  1PGU A;  3DXK C;  5EMJ B;  2OVP B;  2J57 G;  4A09 A;  4GM3 A;  5EMK B;  4PSX B;  4Y5R D;  2OVQ B;  2Z2P A;  5FLX g;  4JSP C;  4EWR A;  5AFU 3;  5H17 A;  4FB1 D;  4PBY A;  4PNK B;  3N0E A;  2YMU A;  5CXB B;  3NVN A;  5H1M A;  2P9L C;  4QQE A;  3KRW B;  3UKU C;  3UVO A;  2J56 H;  1RI6 A;  3EMH A;  2P9P C;  3OKY B;  2HXC A;  4A08 A;  3EI2 A;  5SXM A;  4CY2 A; 
#chains in the Genus database with same CATH topology
 5FQD A;  2VDL A;  3JZH A;  3EQ8 A;  2XYI A;  3IUJ A;  1GG2 B;  3ZE2 A;  1E5T A;  5FKT A;  1ERJ A;  4N14 A;  4G56 B;  3CFS B;  2XL2 A;  4O2W A;  4GQ1 A;  3EI4 B;  4A2M A;  3IKO A;  5I5M A;  4FAN D;  1T2X A;  2P9N C;  1VZ3 A;  2UZY B;  4Y7R A;  2J55 H;  4CI8 A;  2P9U C;  3N0D A;  3JB9 L;  4H5J A;  3SBR A;  4H5I A;  3C75 H;  3NID A;  4A2L A;  1A12 A;  4J87 A;  1UOP A;  3RFH A;  4BCB A;  5M61 A;  3SJL D;  3BWS A;  4J0X A;  3IUN A;  4E5Z A;  2AGX A;  2BBK H;  2H14 A;  3OF7 A;  5FXY A;  3UVN A;  4QL1 A;  5EAL A;  1UOO A;  5HE2 B;  3DXM C;  2YNP A;  1B9Y A;  2IWK A;  3MMY A;  4O1Q D;  2H68 A;  3EI1 A;  1K8K C;  3SMR A;  3RSE C;  2HKR A;  4JSN C;  4JT6 C;  2AH0 A;  3OKW A;  3KRX B;  3V4P A;  5C2V B;  3K26 A;  2TRC B;  4KFM B;  2OK4 A;  4CY5 A;  3CFV A;  2EIE A;  3IUQ A;  2VDR A;  4JHP C;  3FCS A;  1GXR A;  3BG0 A;  2G99 A;  4PSW B;  5M5U A;  3VA6 A;  3ZDY A;  2JKX A;  4AN0 A;  4O3T B;  4K3I D;  1JMZ B;  4WJK A;  5FA5 B;  3AH8 B;  4X61 B;  3JAM g;  2PM9 B;  4D6V A;  4BL0 A;  4FHL A;  2I0T A;  3MZL A;  2VDQ A;  3MXX A;  5FFO A;  2AH1 A;  2H47 A;  1JV2 A;  4L3H D;  2B5M A;  5IT9 g;  2IUP A;  3SVW D;  2IUV A;  4O45 A;  4DNU A;  1H2X A;  1OMW B;  4A09 B;  4O3U B;  3PE7 A;  4BCD A;  2CN3 A;  5FKR A;  4Z8L A;  2VDK A;  2Q7Q A;  3DWL C;  1M1X A;  2VDN A;  5CXC A;  3RLM D;  3IVM A;  4J8B A;  5E6S A;  5M5R A;  4Z7O A;  3GFC A;  5IGO A;  1PI6 A;  4JT5 C;  4ERQ A;  2HKM A;  3SBQ A;  5I5J A;  1VE7 A;  1VZ2 A;  3DSM A;  5GSA A;  2H6K A;  4J86 A;  4CI3 A;  2VZ1 A;  4ZOY A;  4G1E A;  4CY1 A;  4Z7N A;  4A08 B;  3K6S A;  5AMS A;  3EI2 B;  2PBI B;  5HQG A;  1BPO A;  5HE0 B;  3DM0 A;  4AN1 A;  4U7A A;  3I7O A;  4BH6 A;  3B7F A;  1Q47 A;  3C99 A;  3MKQ A;  4JHN A;  1C9I A;  1QFS A;  4JSV C;  2Z2N A;  4BP8 A;  5EM2 A;  2CO0 C;  3FGB A;  1K32 A;  4O02 A;  5C2W B;  5M5T A;  3I7H A;  3MKS B;  1A0R B;  5TEE A;  4GZ8 A;  4AEZ A;  4A0A A;  1N6D A;  3A0F A;  3I2N A;  2I0R A;  4E5Z B;  2IAA A;  4RE5 A;  2IWF A;  2P9I C;  1JJU B;  3V9F A;  3UVL A;  2QXV A;  3OL2 A;  5IJ8 E;  4FA4 D;  4ZOV A;  4L3G D;  5THA A;  4GQB B;  4FA5 D;  2CE9 A;  4UI9 R;  3EI1 B;  3ZE0 A;  4CI2 A;  3UVK A;  4E54 B;  3PVU B;  4J84 A;  3EQ7 A;  5A2Q g;  5IC7 A;  3JZN A;  4ERZ A;  4BUJ C;  3RN1 D;  1H2Y A;  3IUR A;  4JSX C;  3ORV D;  2VDP A;  4TZ4 A;  2CE8 A;  4K3J B;  4GGA A;  3OTT A;  3O4H A;  2IUR A;  4GGC A;  4LG9 A;  2I3T A;  5GXI A;  5H14 A;  2CNX A;  4J73 A;  2XU7 A;  4RE6 A;  3O4I A;  1GOF A;  4R7A B;  4GQ2 P;  3I8C A;  4UM8 A;  3U4Y A;  3JRO A;  1JTD B;  4CZY A;  4ES0 A;  5GMK n;  2P9K C;  2H9N A;  4MMX A;  5EAR A;  4A11 A;  5AJA A;  5K1C C;  1YFQ A;  1S4U X;  2EIB A;  4MMY A;  1NR0 A;  1TYQ C;  3UKR C;  4MK0 B;  5M5S A;  3IJ1 A;  1NEX B;  4ZN4 A;  3SHF A;  1H2Z A;  4U1E I;  3V7D B;  2AQ5 A;  3L4O D;  4J8G A;  5FFG A;  3NVQ A;  4NC4 A;  3T3M A;  3HFQ A;  5CXC B;  5TEF A;  2Z2O A;  4QAM A;  2GC7 A;  3GC3 B;  3SCY A;  1U8C A;  5HE1 B;  3I8E A;  2VZ3 A;  2H9P A;  2OJY A;  1L0Q A;  4PXW A;  3NIF A;  1MDA H;  4LG8 A;  4L9O A;  2YBA A;  4ESG A;  4X60 B;  4NSX A;  3UR4 A;  3PXS D;  2EID A;  2W18 A;  4NBM A;  2H13 A;  4WK4 A;  3PXT D;  3SN6 B;  2VDM A;  3SLE D;  4FA9 D;  5IGQ A;  3ODT A;  4J81 A;  3ZDX A;  4J77 A;  4JD2 C;  3ULE C;  3SWS D;  3JZG A;  5EM2 B;  3AL8 A;  3IJE A;  2HU7 A;  5CYK A;  4OZU A;  1GOG A;  3F3F A;  4OWR A;  4A0A B;  4CY3 A;  1GOH A;  2GC4 A;  3NVX A;  3K72 A;  5HE3 B;  2XL3 A;  2XDW A;  1XIP A;  3F3G A;  1JOF A;  3OL2 B;  3VI3 A;  1PEV A;  2HJ4 A;  1VYH C;  3QHY B;  3JRP A;  2EIC A;  1N6E A;  2I3S A;  2B5N A;  3EI3 A;  3K71 A;  3VH0 A;  2O9K A;  1L5G A;  1TBG A;  3QI0 A;  4IMM A;  3SFZ A;  4ZOX A;  4DNV A;  4Z7Q A;  5C86 A;  3ZWL B;  5EAP A;  3EWE A;  3FRX A;  4HDJ A;  4XEI C;  1GOT B;  3CIK B;  3FM0 A;  4J82 A;  1MG3 A;  1TYE A;  3C9C A;  1XKS A;  5TF2 A;  2HYE A;  2H6N A;  2YNN A;  1O6G A;  3PSC B;  3O4J A;  3OKT A;  1QFM A;  3IJ0 A;  5IJ7 E;  4YVD A;  2YNO A;  3ZDZ A;  3J81 g;  5M5V A;  2HU5 A;  4J79 A;  2YB8 B;  4A11 B;  2H6Q A;  3IJC A;  4CC9 A;  5EMM B;  3SBP A;  4GGD A;  4FA1 D;  3GRE A;  1UOQ A;  4LGN A;  4XYI A;  1XHM A;  2B4E A;  5FKS A;  4ERY A;  4FWW A;  3OW8 A;  4ZOZ A;  1N6F A;  5TDH B;  4A0B A;  3I7N A;  4O9D A;  2XZG A;  3T3P A;  2AGZ A;  3I7K A;  2QC5 A;  4GM9 A;  5C9Z B;  2WQ8 A;  4L1M A;  3AFC A;  2G9A A;  2PM7 B;  3UVM A;  3J80 g;  5I5I A;  3I7L A;  4XYH A;  2BKL A;  4BP9 A;  5K19 A;  4FAV D;  1E8M A;  3I7P A;  1MG2 A;  2HU8 A;  1C9L A;  3RMZ D;  4GM8 A;  5CXB A;  4J0W A;  4JXM A;  4AX4 A;  5HDB A;  1QNI A;  3PXW D;  4NEN A;  1SQ9 A;  4CI1 A;  2H9L A;  5FKQ A;  4WK2 A;  3OKY A;  3W15 A;  3P4F A;  1H2W A;  5KDO B;  4NAA A;  1I2M B;  4CZX A;  1B9X A;  2OIZ A;  3DDU A;  2P9S C;  4MMZ A;  3EQ9 A;  3MVD K;  5EAM A;  1SQJ A;  4WK0 A;  4QRJ A;  2B5L A;  2OK6 A;  1GP2 B;  3AL8 B;  3EI4 A;  4I79 A;  4QT8 A;  5E6U A;  3RRM C;  5CYK B;  4E54 A;  3F3P A;  2VC2 A;  3RN0 D;  5HYN B;  2GNQ A;  2CO0 A;  3K27 A;  1JMX B;  4G55 A;  3KCI A;  1VE6 A;  2AGL A;  2H9M A;  3BG1 A;  1FWX A;  4AMZ A;  1PBY B;  2CN2 A;  2HES X;  2EBS A;  1U4C A;  5E6R A;  3MZK A;  3NIG A;  4L1Q D;  2OVR B;  4A7J A;  1SHY B;  3EI3 B;  5B4W A;  4D9S A;  3RFG A;  2UZX B;  3PSL A;  2VDO A;  3V4V A;  4D0K A;  3MUN A;  3EG6 A;  4CZV A;  3JPX A;  4X3E A;  3O4G A;  5C92 A;  3IIW A;  5JWZ A;  3GD1 I;  3EU7 A;  2I0S A;  1R5M A;  4GMB A;  3IUL A;  4X63 B;  4J78 A;  1YR2 A;  5EML B;  2BCJ B;  3E0C A;  4AMY A;  4BCC A;  3C5M A;  3IIY A;  3L4M D;  3V5W B;  2AGW A;  1O6F A;  4IA9 A;  1UTC A;  3I89 A;  2QZP A;  5GXH A;  4IRZ A;  2AGY A;  1P22 A;  4PBZ A;  3AL9 A;  2PM9 A;  1U2V C;  2XE4 A;  4G1M A;  2H3X A;  3VGZ A;  3SXT D;  2MTA H;  4AOW A;  1E8N A;  3PVW B;  4A0B B;  4PC0 A;  2HJB A;  1OLZ A;  2IUQ A;  3DXK C;  1PGU A;  2PM6 B;  5EMJ B;  2OVP B;  2J57 G;  4A09 A;  3ZE1 A;  4GM3 A;  5EMK B;  4PSX B;  4Y5R D;  2OVQ B;  2Z2P A;  4DNW A;  5FLX g;  4JSP C;  4EWR A;  5AFU 3;  5H17 A;  3VI4 A;  4FB1 D;  4PBY A;  4PNK B;  3N0E A;  1K3I A;  3FCU A;  2YMU A;  3IUM A;  3NVN A;  2QR5 A;  2P9L C;  5CXB B;  4UM9 A;  5H1M A;  4QQE A;  3KRW B;  3UKU C;  3UVO A;  2J56 H;  3MUO A;  1RI6 A;  3EMH A;  2P9P C;  3OKY B;  2HXC A;  4A08 A;  3EI2 A;  5SXM A;  4CY2 A; 
#chains in the Genus database with same CATH homology
 5FQD A;  3JZH A;  2XYI A;  1GG2 B;  5FKT A;  1ERJ A;  4N14 A;  4G56 B;  3CFS B;  2XL2 A;  4GQ1 A;  3EI4 B;  4A2M A;  3IKO A;  5I5M A;  4FAN D;  2P9N C;  4Y7R A;  2UZY B;  2J55 H;  4CI8 A;  2P9U C;  3N0D A;  3JB9 L;  4H5J A;  3SBR A;  4H5I A;  3C75 H;  4A2L A;  4J87 A;  3RFH A;  3SJL D;  3BWS A;  4J0X A;  4E5Z A;  2AGX A;  2BBK H;  2H14 A;  5FXY A;  3UVN A;  4QL1 A;  5EAL A;  5HE2 B;  3DXM C;  2YNP A;  1B9Y A;  2IWK A;  3MMY A;  4O1Q D;  2H68 A;  3EI1 A;  1K8K C;  3SMR A;  3RSE C;  2HKR A;  4JSN C;  4JT6 C;  2AH0 A;  3OKW A;  3KRX B;  5C2V B;  3K26 A;  2TRC B;  4KFM B;  2OK4 A;  4CY5 A;  3CFV A;  1GXR A;  3BG0 A;  2G99 A;  4PSW B;  3VA6 A;  4O3T B;  4K3I D;  1JMZ B;  5FA5 B;  3AH8 B;  4X61 B;  3JAM g;  2PM9 B;  4D6V A;  4BL0 A;  4FHL A;  2I0T A;  3MZL A;  3MXX A;  2AH1 A;  2H47 A;  4L3H D;  2B5M A;  5IT9 g;  2IUP A;  3SVW D;  2IUV A;  4O45 A;  1OMW B;  4A09 B;  4O3U B;  3PE7 A;  2CN3 A;  5FKR A;  4Z8L A;  2Q7Q A;  3DWL C;  5CXC A;  3RLM D;  4J8B A;  3GFC A;  5IGO A;  1PI6 A;  4JT5 C;  4ERQ A;  2HKM A;  3SBQ A;  5I5J A;  5GSA A;  3DSM A;  2H6K A;  4J86 A;  4CI3 A;  4ZOY A;  4CY1 A;  4A08 B;  5AMS A;  3EI2 B;  2PBI B;  5HQG A;  5HE0 B;  3DM0 A;  4U7A A;  3I7O A;  4BH6 A;  3B7F A;  1Q47 A;  3C99 A;  3MKQ A;  4JSV C;  2Z2N A;  5EM2 A;  2CO0 C;  3FGB A;  1K32 A;  5C2W B;  3I7H A;  3MKS B;  1A0R B;  5TEE A;  4GZ8 A;  4AEZ A;  4A0A A;  1N6D A;  3A0F A;  3I2N A;  2I0R A;  4E5Z B;  2IAA A;  2IWF A;  2P9I C;  1JJU B;  3V9F A;  3UVL A;  2QXV A;  3OL2 A;  5IJ8 E;  4FA4 D;  4ZOV A;  4L3G D;  5THA A;  4GQB B;  4FA5 D;  2CE9 A;  4UI9 R;  3EI1 B;  4CI2 A;  3UVK A;  4E54 B;  3PVU B;  4J84 A;  5A2Q g;  5IC7 A;  3JZN A;  4ERZ A;  4BUJ C;  3RN1 D;  4JSX C;  3ORV D;  4TZ4 A;  2CE8 A;  4K3J B;  4GGA A;  3OTT A;  2IUR A;  4GGC A;  4LG9 A;  2I3T A;  5GXI A;  5H14 A;  2CNX A;  4J73 A;  2XU7 A;  4R7A B;  4GQ2 P;  3I8C A;  3U4Y A;  3JRO A;  4CZY A;  4ES0 A;  5GMK n;  2P9K C;  2H9N A;  5EAR A;  4A11 A;  5AJA A;  5K1C C;  1YFQ A;  1S4U X;  1NR0 A;  1TYQ C;  3UKR C;  4MK0 B;  3IJ1 A;  1NEX B;  4ZN4 A;  3SHF A;  4U1E I;  3V7D B;  2AQ5 A;  3L4O D;  4J8G A;  3NVQ A;  3HFQ A;  5CXC B;  5TEF A;  2Z2O A;  2GC7 A;  3SCY A;  5HE1 B;  3I8E A;  2H9P A;  2OJY A;  1L0Q A;  4PXW A;  1MDA H;  4LG8 A;  4L9O A;  2YBA A;  4ESG A;  4X60 B;  4NSX A;  3UR4 A;  3PXS D;  2W18 A;  2H13 A;  3PXT D;  3SN6 B;  3SLE D;  4FA9 D;  5IGQ A;  3ODT A;  4J81 A;  4J77 A;  4JD2 C;  3ULE C;  3SWS D;  3JZG A;  5EM2 B;  3AL8 A;  5CYK A;  4OZU A;  3F3F A;  4OWR A;  4A0A B;  4CY3 A;  2GC4 A;  3NVX A;  5HE3 B;  2XL3 A;  1XIP A;  3F3G A;  1JOF A;  3OL2 B;  1PEV A;  2HJ4 A;  1VYH C;  3JRP A;  1N6E A;  2I3S A;  2B5N A;  3EI3 A;  3VH0 A;  2O9K A;  1TBG A;  4IMM A;  3SFZ A;  4ZOX A;  3ZWL B;  5EAP A;  3EWE A;  3FRX A;  4HDJ A;  4XEI C;  1GOT B;  3CIK B;  3FM0 A;  4J82 A;  1MG3 A;  3C9C A;  1XKS A;  5TF2 A;  2HYE A;  2H6N A;  2YNN A;  3PSC B;  3OKT A;  3IJ0 A;  5IJ7 E;  4YVD A;  2YNO A;  3J81 g;  4J79 A;  2YB8 B;  4A11 B;  2H6Q A;  3IJC A;  4CC9 A;  5EMM B;  3SBP A;  4GGD A;  4FA1 D;  3GRE A;  4LGN A;  4XYI A;  1XHM A;  2B4E A;  5FKS A;  4ERY A;  4FWW A;  3OW8 A;  4ZOZ A;  1N6F A;  5TDH B;  4A0B A;  3I7N A;  4O9D A;  2AGZ A;  3I7K A;  2QC5 A;  4GM9 A;  5C9Z B;  3AFC A;  2G9A A;  2PM7 B;  3UVM A;  3J80 g;  5I5I A;  3I7L A;  4XYH A;  5K19 A;  4FAV D;  3I7P A;  1MG2 A;  3RMZ D;  4GM8 A;  5CXB A;  4J0W A;  4JXM A;  1QNI A;  3PXW D;  1SQ9 A;  4CI1 A;  2H9L A;  5FKQ A;  3OKY A;  3W15 A;  3P4F A;  5KDO B;  4CZX A;  1B9X A;  2OIZ A;  2P9S C;  5EAM A;  1SQJ A;  4QRJ A;  2B5L A;  2OK6 A;  1GP2 B;  3AL8 B;  3EI4 A;  4I79 A;  4QT8 A;  3RRM C;  4E54 A;  5CYK B;  3F3P A;  3RN0 D;  5HYN B;  2GNQ A;  2CO0 A;  3K27 A;  1JMX B;  2AGL A;  2H9M A;  3BG1 A;  1FWX A;  1PBY B;  2CN2 A;  2HES X;  2EBS A;  1U4C A;  3MZK A;  4L1Q D;  2OVR B;  4A7J A;  1SHY B;  3EI3 B;  5B4W A;  3RFG A;  2UZX B;  3PSL A;  4D0K A;  3EG6 A;  4CZV A;  3JPX A;  4X3E A;  3IIW A;  5JWZ A;  3EU7 A;  2I0S A;  1R5M A;  4GMB A;  4X63 B;  4J78 A;  5EML B;  2BCJ B;  3E0C A;  3C5M A;  3IIY A;  3L4M D;  3V5W B;  2AGW A;  4IA9 A;  3I89 A;  5GXH A;  2AGY A;  1P22 A;  4PBZ A;  3AL9 A;  2PM9 A;  1U2V C;  2H3X A;  3VGZ A;  3SXT D;  2MTA H;  4AOW A;  3PVW B;  4A0B B;  4PC0 A;  2HJB A;  1OLZ A;  2IUQ A;  2PM6 B;  1PGU A;  3DXK C;  5EMJ B;  2OVP B;  2J57 G;  4A09 A;  4GM3 A;  5EMK B;  4PSX B;  4Y5R D;  2OVQ B;  2Z2P A;  5FLX g;  4JSP C;  4EWR A;  5AFU 3;  5H17 A;  4FB1 D;  4PBY A;  4PNK B;  3N0E A;  2YMU A;  5CXB B;  3NVN A;  5H1M A;  2P9L C;  4QQE A;  3KRW B;  3UKU C;  3UVO A;  2J56 H;  1RI6 A;  3EMH A;  2P9P C;  3OKY B;  2HXC A;  4A08 A;  3EI2 A;  5SXM A;  4CY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...