2OJYA

Crystal structure of indol-3-acetaldehyde derived ttq-amide adduct of aromatic amine dehydrogenase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
total genus 99
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ojyA01
2B4EA 4GM3A 5TF2A 2H9NA 2I0TA 3RLMD 4L3HD 5GSAA 3I2NA 4ERYA 3BG0A 2P9IC 1JMXB 4PBYA 3SBQA 1SQ9A 2OK6A 4K3JB 5TEEA 4A0BA 3NVXA 2PBIB 5AJAA 2H6QA 5EAMA 5IGQA 4J0WA 2HYEA 3I7KA 3I7LA 4BL0A 5EARA 3PVWB 5CYKB 4FA5D 5EM2B 3I7HA 3MXXA 4KFMB 1GXRA 2P9SC 2QXVA 4J77A 2AH0A 2HKRA 3N0DA 4ZOXA 5GXIA 3EI3B 3K27A 3F3GA 2PM6B 3PE7A 1MG2A 1GOTB 3BG1A 1XIPA 4ZOVA 3GFCA 3F3FA 2OIZA 4R7AB 3SWSD 3L4OD 2H68A 5K19A 4CI2A 3MZLA 4PBZA 5HYNB 3PXSD 3RN0D 3UVNA 2H6KA 3DXKC 4CY5A 5IGOA 5CYKA 3JZHA 5EM2A 2IURA 2B5MA 1MG3A 4A09A 3IKOA 4J0XA 4ES0A 2OVQB 4GQ2P 5EMJB 1RI6A 4LGNA 1N6FA 1S4UX 2YNOA 1XKSA 3JRPA 3AL8B 4Z8LA 3PXTD 4CY2A 5I5MA 2AH1A 2CNXA 3IJCA 2AGYA 2YNNA 5K1CC 3FGBA 1VYHC 2HKMA 5H1MA 4CY3A 4CI3A 5H17A 4ZOYA 2CN2A 5IT9g 4PC0A 4ESGA 1GG2B 5FA5B 3J80g 1K8KC 3JROA 2P9KC 4JSVC 2CE9A 5H14A 3JAMg 4X61B 4K3ID 3E0CA 3SFZA 1R5MA 3VA6A 5FKSA 4X63B 4XYIA 1B9YA 3I89A 4O1QD 3HFQA 4J79A 3SCYA 4EWRA 4D6VA 4FA1D 2H14A 4ZOZA 5CXCA 3I7PA 5AMSA 3C5MA 4H5JA 3UVOA 4J87A 5FXYA 4CZXA 5FLXg 4A0BB 5EAPA 3F3PA 3RRMC 2B5NA 4D0KA 3SBPA 3DM0A 3PVUB 3DWLC 4Y5RD 2I3SA 2YMUA 4GM9A 3V5WB 2GC7A 4FA9D 3N0EA 4JD2C 4HDJA 4J8BA 3SMRA 3OKWA 5HE1B 3SVWD 5C2WB 4A7JA 1A0RB 5HE3B 5HE2B 3FM0A 5I5JA 3AFCA 3V9FA 3RMZD 2H47A 2P9NC 2UZYB 3SXTD 3RN1D 4A08B 1TBGA 3DSMA 5KDOB 5FKRA 4FA4D 3MKSB 4L3GD 3EI2B 4OWRA 5TEFA 4E54B 4A09B 2YB8B 2I0SA 2TRCB 4MK0B 4L1QD 5C9ZB 3PXWD 5EMKB 3IJ0A 4FAND 3EI1B 1U4CA 3EI4B 3I8EA 2IWFA 3UVMA 2IAAA 4J86A 2H9PA 4FAVD 2EBSA 1PBYB 4O3UB 4A08A 3JZGA 2Z2NA 4JSPC 3JPXA 3I8CA 2OVPB 3EI2A 3IIWA 3OTTA 4E54A 3KRXB 1MDAH 5JWZA 3OL2B 3UKRC 2HJ4A 3SJLD 3RFGA 1N6DA 2P9LC 4PSWB 5CXCB 2PM9B 3GREA 3EI1A 4CI1A 3EI4A 1JJUB 4H5IA 2HJBA 1PGUA 2OVRB 2HESX 2AGXA 1NR0A 4CI8A 2YNPA 4A0AB 2G9AA 4BUJC 4JXMA 5IJ7E 2BBKH 3CFSB 4YVDA 1NEXB 3NVQA 3JB9L 5THAA 3OL2A 4PXWA 1ERJA 3KRWB 4GM8A 4QT8A 4XEIC 3RFHA 3VH0A 2H13A 2Z2OA 3V7DB 5C2VB 4A11B 2PM9A 1OLZA 2P9PC 5GMKn 1N6EA 4PSXB 4JT5C 4J8GA 5SXMA 2J57G 1OMWB 4A0AA 5FKQA 4GMBA 4I79A 4CY1A 2G99A 3OKTA 2HXCA 2XL2A 2O9KA 1JMZB 3K26A 3SHFA 5FQDA 4ERZA 4BH6A 2I3TA 4JT6C 4J84A 4QL1A 3OKYA 3MZKA 2IUQA 3VGZA 4CZYA 2J56H 4J73A 4A11A 2GC4A 2QC5A 3P4FA 2CO0C 3SBRA 3MMYA 2IWKA 3SN6B 2UZXB 2PM7B 3CIKB 4JSXC 1U2VC 3PSCB 5TDHB 2GNQA 4G56B 4AEZA 3EMHA 1FWXA 4NSXA 2AQ5A 4TZ4A 5CXBB 4CC9A 3CFVA 1YFQA 4GGAA 2Q7QA 4OZUA 3PSLA 3ULEC 1B9XA 5I5IA 3C75H 1K32A 4X60B 4Y7RA 2CO0A 4IA9A 3EG6A 2AGLA 4QQEA 3AL9A 4J78A 3A0FA 5IC7A 4U1EI 3I7NA 3EU7A 2B5LA 2H9MA 1JOFA 4O45A 3IJ1A 3ORVD 2XYIA 1SQJA 5CXBA 4A2LA 3BWSA 3I7OA 4O3TB 1XHMA 3J81g 5HE0B 4J82A 3L4MD 5GXHA 1PI6A 2J55H 2W18A 4GQBB 2OK4A 2IUVA 4GQ1A 4LG8A 4JSNC 3UR4A 3EI3A 1QNIA 4E5ZB 3B7FA 3EWEA 5EALA 2CN3A 3RSEC 3C9CA 2OJYA 3UVLA 4J81A 1L0QA 1Q47A 3UVKA 4GZ8A 3OKYB 4X3EA 5EMLB 1SHYB 4FWWA 4GGDA 5AFU3 3DXMC 5IJ8E 2H3XA 3FRXA 3ODTA 2XL3A 2H6NA 2P9UC 3JZNA 1TYQC 5EMMB 2AGZA 4AOWA 3U4YA 3NVNA 3OW8A 4A2MA 3MKQA 4FHLA 4O9DA 4IMMA 1PEVA 4ERQA 4FB1D 4E5ZA 2BCJB 4PNKB 4GGCA 2I0RA 3AL8A 5HQGA 4CZVA 2CE8A 3C99A 2YBAA 4L9OA 4LG9A 4QRJA 1GP2B 5A2Qg 4XYHA 3W15A 2H9LA 3SLED 4UI9R 4N14A 1P22A 3AH8B 2Z2PA 3UKUC 3ZWLB 2MTAH 5B4WA 2XU7A 5FKTA 4U7AA 4ZN4A 2IUPA 3IIYA 2AGWA
chains in the Genus database with same CATH superfamily
2B4EA 4GM3A 3K72A 5TF2A 2H9NA 2I0TA 3RLMD 4L3HD 1U8CA 5GSAA 3I2NA 4ERYA 3BG0A 2P9IC 1JMXB 4PBYA 3SBQA 3MVDK 2JKXA 1SQ9A 2OK6A 4K3JB 5TEEA 4A0BA 3NVXA 1M1XA 2PBIB 5AJAA 4DNUA 2H6QA 5EAMA 3NIFA 5IGQA 4J0WA 2HYEA 3I7KA 3I7LA 4BL0A 5EARA 3PVWB 5CYKB 5M5RA 4FA5D 5C86A 5C92A 5EM2B 1O6GA 3I7HA 3MXXA 4KFMB 1GXRA 2P9SC 2QXVA 4AX4A 4J77A 2AH0A 2HKRA 3N0DA 4ZOXA 5GXIA 3EI3B 3K27A 3O4JA 3F3GA 4G55A 2PM6B 3PE7A 1MG2A 1GOTB 3BG1A 1XIPA 4ZOVA 4BCCA 3GFCA 3F3FA 1E8MA 2OIZA 4R7AB 3SWSD 3L4OD 2H68A 3FCSA 3GD1I 5K19A 4CI2A 3MZLA 4PBZA 5HYNB 3PXSD 3RN0D 3UVNA 2H6KA 3DXKC 3ZE0A 4CY5A 5IGOA 5CYKA 3JZHA 5EM2A 2IURA 2B5MA 1MG3A 4A09A 3IKOA 4J0XA 4ES0A 2OVQB 4UM9A 4GQ2P 5EMJB 2EICA 1RI6A 4RE6A 5E6RA 5E6UA 1N6FA 4L1MA 4LGNA 1S4UX 3EQ7A 2YNOA 2HU7A 1XKSA 3JRPA 3AL8B 4Z8LA 3PXTD 4CY2A 5I5MA 4AMZA 2AH1A 4BP8A 2CNXA 3IJCA 2AGYA 2YNNA 1E5TA 5K1CC 3IULA 3FGBA 1VYHC 2HKMA 5H1MA 4CY3A 4CI3A 5H17A 4ZOYA 2CN2A 4O02A 5IT9g 4PC0A 4ESGA 4MMXA 1JTDB 1GG2B 5FA5B 3J80g 1K8KC 3JROA 2P9KC 4JSVC 2CE9A 5H14A 3JAMg 4X61B 4K3ID 3E0CA 3SFZA 1R5MA 3OF7A 4RE5A 5FKSA 3VA6A 4X63B 4XYIA 1B9YA 3I89A 4O1QD 3HFQA 4J79A 3SCYA 1T2XA 4EWRA 4D6VA 4FA1D 2H14A 4ZOZA 1QFSA 3I7PA 5CXCA 3C5MA 1JV2A 5AMSA 4H5JA 3UVOA 4J87A 5FXYA 4CZXA 5FLXg 4A0BB 5EAPA 1VE7A 3F3PA 3RRMC 2B5NA 4D0KA 3SBPA 3DM0A 2XE4A 4BCBA 4G1MA 3PVUB 1VZ3A 1C9LA 3DWLC 4Y5RD 2I3SA 2YMUA 4GM9A 3V5WB 2GC7A 4FA9D 3N0EA 4JD2C 1H2YA 4HDJA 4O2WA 4J8BA 3SMRA 3OKWA 5HE1B 3SVWD 5C2WB 3ZE1A 4A7JA 1A0RB 5HE3B 5HE2B 3FM0A 3V4PA 5I5JA 3AFCA 3V9FA 3RMZD 2H47A 1GOFA 2P9NC 2UZYB 3SXTD 2VDRA 3RN1D 4A08B 4Z7OA 1TBGA 3DSMA 5KDOB 5FKRA 4FA4D 3MKSB 4L3GD 5M5TA 3EI2B 1A12A 2QZPA 3VI4A 3KCIA 1UOPA 4OWRA 5TEFA 4E54B 4A09B 2YB8B 2EIBA 2I0SA 3NIDA 3O4GA 5M5UA 2TRCB 2VDMA 4MK0B 4AN1A 1BPOA 4L1QD 5C9ZB 3PXWD 3V4VA 5EMKB 3IJ0A 4FAND 3EI1B 2VDQA 1U4CA 3EI4B 3I8EA 1E8NA 2IWFA 3UVMA 2IAAA 4J86A 2H9PA 3IUMA 2EBSA 4FAVD 1PBYB 2VZ1A 3VI3A 4O3UB 4A08A 3JZGA 2VDNA 2Z2NA 4JSPC 5FFGA 3JPXA 1H2ZA 3I8CA 4AMYA 2OVPB 3EI2A 1GOGA 3IIWA 3OTTA 4E54A 3KRXB 4Z7NA 1O6FA 1MDAH 5JWZA 3MUNA 3OL2B 3ZDZA 3UKRC 2HJ4A 3SJLD 3IJEA 3RFGA 1N6DA 2P9LC 4PSWB 5CXCB 2PM9B 3QI0A 3GREA 3EI1A 4UM8A 4CI1A 3EI4A 1JJUB 4H5IA 2HJBA 1PGUA 2OVRB 2HESX 2AGXA 1NR0A 3T3MA 4CI8A 2YNPA 5M5SA 4A0AB 4MMYA 2G9AA 4BUJC 4JXMA 5IJ7E 2EIEA 2BBKH 3CFSB 4YVDA 2HU5A 1NEXB 3K71A 3NVQA 3JB9L 5THAA 4DNWA 3OL2A 4PXWA 5E6SA 1ERJA 3KRWB 4GM8A 4QT8A 4XEIC 3O4HA 4G1EA 3RFHA 3VH0A 2H13A 2Z2OA 5M61A 3V7DB 5C2VB 3O4IA 2PM9A 4A11B 2BKLA 1OLZA 2P9PC 2VDLA 5GMKn 1N6EA 4PSXB 4JT5C 1UOOA 4J8GA 5SXMA 2J57G 1OMWB 4A0AA 5FKQA 4GMBA 1VE6A 4I79A 4CY1A 1YR2A 2G99A 3OKTA 2HXCA 2XL2A 2O9KA 1JMZB 4WK2A 3K26A 1GOHA 3DDUA 3SHFA 4WK0A 5FQDA 2WQ8A 3GC3B 4AN0A 4D9SA 4ERZA 4BH6A 2I3TA 4JT6C 4J84A 2VZ3A 4QL1A 3OKYA 3MZKA 2IUQA 3VGZA 4CZYA 2J56H 4J73A 4A11A 2GC4A 2QC5A 3P4FA 3K6SA 2CO0C 3SBRA 3MMYA 2IWKA 3SN6B 2UZXB 2PM7B 3CIKB 4JSXC 1U2VC 3PSCB 4JHPC 5TDHB 2GNQA 2HU8A 4G56B 4IRZA 3T3PA 4AEZA 3EMHA 1H2WA 1FWXA 3EQ8A 2VC2A 4NAAA 4NBMA 4NSXA 2AQ5A 4TZ4A 5CXBB 3MUOA 4CC9A 3CFVA 1YFQA 4GGAA 1C9IA 2Q7QA 4OZUA 3PSLA 3ULEC 1B9XA 2XDWA 3IUQA 3ZE2A 5I5IA 3C75H 1K32A 1I2MB 4X60B 2CO0A 4IA9A 4Y7RA 5HDBA 3EG6A 2AGLA 4QQEA 3AL9A 2EIDA 3ZDXA 3IUNA 4J78A 1UOQA 3A0FA 5IC7A 4U1EI 3ZDYA 3I7NA 3QHYB 3EU7A 2B5LA 2H9MA 1JOFA 1QFMA 4O45A 3IJ1A 3ORVD 1VZ2A 2XYIA 1SQJA 5CXBA 3EQ9A 4A2LA 4NENA 3BWSA 3I7OA 4O3TB 1XHMA 4BCDA 3J81g 4Z7QA 5HE0B 4J82A 3L4MD 5GXHA 1PI6A 5FFOA 2J55H 3FCUA 1TYEA 2W18A 4GQBB 1UTCA 5M5VA 2OK4A 2IUVA 4GQ1A 4LG8A 4JSNC 3UR4A 3EI3A 1K3IA 4JHNA 1QNIA 4E5ZB 3B7FA 3EWEA 5EALA 4WJKA 2CN3A 4BP9A 3RSEC 3C9CA 2OJYA 3UVLA 4J81A 1L0QA 1Q47A 3NIGA 3UVKA 4GZ8A 3OKYB 4X3EA 5EMLB 1SHYB 4FWWA 4GGDA 5AFU3 3DXMC 5IJ8E 2H3XA 3FRXA 3ODTA 2XL3A 1L5GA 2H6NA 2P9UC 3JZNA 1H2XA 1TYQC 5EMMB 2AGZA 4AOWA 3U4YA 3NVNA 3OW8A 2VDOA 4A2MA 3MKQA 4FHLA 4O9DA 2QR5A 4IMMA 1PEVA 4ERQA 4DNVA 4FB1D 4E5ZA 2BCJB 4PNKB 4GGCA 2I0RA 3AL8A 5HQGA 4CZVA 2CE8A 3C99A 2YBAA 4L9OA 4LG9A 4QRJA 4NC4A 1GP2B 5A2Qg 4XYHA 2VDPA 3W15A 3IURA 3IVMA 4MMZA 2H9LA 3SLED 4UI9R 4WK4A 4N14A 2XZGA 1P22A 3AH8B 2Z2PA 3UKUC 3ZWLB 2MTAH 5B4WA 2XU7A 5FKTA 3IUJA 4U7AA 2IUPA 4QAMA 4ZN4A 3IIYA 2VDKA 2AGWA
chains in the Genus database with same CATH topology
2B4EA 4GM3A 5TF2A 2H9NA 2I0TA 3RLMD 4L3HD 5GSAA 3I2NA 4ERYA 3BG0A 2P9IC 1JMXB 4PBYA 3SBQA 1SQ9A 2OK6A 4K3JB 5TEEA 4A0BA 3NVXA 2PBIB 5AJAA 2H6QA 5EAMA 5IGQA 4J0WA 2HYEA 3I7KA 3I7LA 4BL0A 5EARA 3PVWB 5CYKB 4FA5D 5EM2B 3I7HA 3MXXA 4KFMB 1GXRA 2P9SC 2QXVA 4J77A 2AH0A 2HKRA 3N0DA 4ZOXA 5GXIA 3EI3B 3K27A 3F3GA 2PM6B 3PE7A 1MG2A 1GOTB 3BG1A 1XIPA 4ZOVA 3GFCA 3F3FA 2OIZA 4R7AB 3SWSD 3L4OD 2H68A 5K19A 4CI2A 3MZLA 4PBZA 5HYNB 3PXSD 3RN0D 3UVNA 2H6KA 3DXKC 4CY5A 5IGOA 5CYKA 3JZHA 5EM2A 2IURA 2B5MA 1MG3A 4A09A 3IKOA 4J0XA 4ES0A 2OVQB 4GQ2P 5EMJB 1RI6A 4LGNA 1N6FA 1S4UX 2YNOA 1XKSA 3JRPA 3AL8B 4Z8LA 3PXTD 4CY2A 5I5MA 2AH1A 2CNXA 3IJCA 2AGYA 2YNNA 5K1CC 3FGBA 1VYHC 2HKMA 5H1MA 4CY3A 4CI3A 5H17A 4ZOYA 2CN2A 5IT9g 4PC0A 4ESGA 1GG2B 5FA5B 3J80g 1K8KC 3JROA 2P9KC 4JSVC 2CE9A 5H14A 3JAMg 4X61B 4K3ID 3E0CA 3SFZA 1R5MA 3VA6A 5FKSA 4X63B 4XYIA 1B9YA 3I89A 4O1QD 3HFQA 4J79A 3SCYA 4EWRA 4D6VA 4FA1D 2H14A 4ZOZA 5CXCA 3I7PA 5AMSA 3C5MA 4H5JA 3UVOA 4J87A 5FXYA 4CZXA 5FLXg 4A0BB 5EAPA 3F3PA 3RRMC 2B5NA 4D0KA 3SBPA 3DM0A 3PVUB 3DWLC 4Y5RD 2I3SA 2YMUA 4GM9A 3V5WB 2GC7A 4FA9D 3N0EA 4JD2C 4HDJA 4J8BA 3SMRA 3OKWA 5HE1B 3SVWD 5C2WB 4A7JA 1A0RB 5HE3B 5HE2B 3FM0A 5I5JA 3AFCA 3V9FA 3RMZD 2H47A 2P9NC 2UZYB 3SXTD 3RN1D 4A08B 1TBGA 3DSMA 5KDOB 5FKRA 4FA4D 3MKSB 4L3GD 3EI2B 4OWRA 5TEFA 4E54B 4A09B 2YB8B 2I0SA 2TRCB 4MK0B 4L1QD 5C9ZB 3PXWD 5EMKB 3IJ0A 4FAND 3EI1B 1U4CA 3EI4B 3I8EA 2IWFA 3UVMA 2IAAA 4J86A 2H9PA 4FAVD 2EBSA 1PBYB 4O3UB 4A08A 3JZGA 2Z2NA 4JSPC 3JPXA 3I8CA 2OVPB 3EI2A 3IIWA 3OTTA 4E54A 3KRXB 1MDAH 5JWZA 3OL2B 3UKRC 2HJ4A 3SJLD 3RFGA 1N6DA 2P9LC 4PSWB 5CXCB 2PM9B 3GREA 3EI1A 4CI1A 3EI4A 1JJUB 4H5IA 2HJBA 1PGUA 2OVRB 2HESX 2AGXA 1NR0A 4CI8A 2YNPA 4A0AB 2G9AA 4BUJC 4JXMA 5IJ7E 2BBKH 3CFSB 4YVDA 1NEXB 3NVQA 3JB9L 5THAA 3OL2A 4PXWA 1ERJA 3KRWB 4GM8A 4QT8A 4XEIC 3RFHA 3VH0A 2H13A 2Z2OA 3V7DB 5C2VB 4A11B 2PM9A 1OLZA 2P9PC 5GMKn 1N6EA 4PSXB 4JT5C 4J8GA 5SXMA 2J57G 1OMWB 4A0AA 5FKQA 4GMBA 4I79A 4CY1A 2G99A 3OKTA 2HXCA 2XL2A 2O9KA 1JMZB 3K26A 3SHFA 5FQDA 4ERZA 4BH6A 2I3TA 4JT6C 4J84A 4QL1A 3OKYA 3MZKA 2IUQA 3VGZA 4CZYA 2J56H 4J73A 4A11A 2GC4A 2QC5A 3P4FA 2CO0C 3SBRA 3MMYA 2IWKA 3SN6B 2UZXB 2PM7B 3CIKB 4JSXC 1U2VC 3PSCB 5TDHB 2GNQA 4G56B 4AEZA 3EMHA 1FWXA 4NSXA 2AQ5A 4TZ4A 5CXBB 4CC9A 3CFVA 1YFQA 4GGAA 2Q7QA 4OZUA 3PSLA 3ULEC 1B9XA 5I5IA 3C75H 1K32A 4X60B 4Y7RA 2CO0A 4IA9A 3EG6A 2AGLA 4QQEA 3AL9A 4J78A 3A0FA 5IC7A 4U1EI 3I7NA 3EU7A 2B5LA 2H9MA 1JOFA 4O45A 3IJ1A 3ORVD 2XYIA 1SQJA 5CXBA 4A2LA 3BWSA 3I7OA 4O3TB 1XHMA 3J81g 5HE0B 4J82A 3L4MD 5GXHA 1PI6A 2J55H 2W18A 4GQBB 2OK4A 2IUVA 4GQ1A 4LG8A 4JSNC 3UR4A 3EI3A 1QNIA 4E5ZB 3B7FA 3EWEA 5EALA 2CN3A 3RSEC 3C9CA 2OJYA 3UVLA 4J81A 1L0QA 1Q47A 3UVKA 4GZ8A 3OKYB 4X3EA 5EMLB 1SHYB 4FWWA 4GGDA 5AFU3 3DXMC 5IJ8E 2H3XA 3FRXA 3ODTA 2XL3A 2H6NA 2P9UC 3JZNA 1TYQC 5EMMB 2AGZA 4AOWA 3U4YA 3NVNA 3OW8A 4A2MA 3MKQA 4FHLA 4O9DA 4IMMA 1PEVA 4ERQA 4FB1D 4E5ZA 2BCJB 4PNKB 4GGCA 2I0RA 3AL8A 5HQGA 4CZVA 2CE8A 3C99A 2YBAA 4L9OA 4LG9A 4QRJA 1GP2B 5A2Qg 4XYHA 3W15A 2H9LA 3SLED 4UI9R 4N14A 1P22A 3AH8B 2Z2PA 3UKUC 3ZWLB 2MTAH 5B4WA 2XU7A 5FKTA 4U7AA 4ZN4A 2IUPA 3IIYA 2AGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4E A;  4GM3 A;  5TF2 A;  2H9N A;  2I0T A;  3RLM D;  4L3H D;  5GSA A;  3I2N A;  4ERY A;  3BG0 A;  2P9I C;  1JMX B;  4PBY A;  3SBQ A;  1SQ9 A;  2OK6 A;  4K3J B;  5TEE A;  4A0B A;  3NVX A;  2PBI B;  5AJA A;  2H6Q A;  5EAM A;  5IGQ A;  4J0W A;  2HYE A;  3I7K A;  3I7L A;  4BL0 A;  5EAR A;  3PVW B;  5CYK B;  4FA5 D;  5EM2 B;  3I7H A;  3MXX A;  4KFM B;  1GXR A;  2P9S C;  2QXV A;  4J77 A;  2AH0 A;  2HKR A;  3N0D A;  4ZOX A;  5GXI A;  3EI3 B;  3K27 A;  3F3G A;  2PM6 B;  3PE7 A;  1MG2 A;  1GOT B;  3BG1 A;  1XIP A;  4ZOV A;  3GFC A;  3F3F A;  2OIZ A;  4R7A B;  3SWS D;  3L4O D;  2H68 A;  5K19 A;  4CI2 A;  3MZL A;  4PBZ A;  5HYN B;  3PXS D;  3RN0 D;  3UVN A;  2H6K A;  3DXK C;  4CY5 A;  5IGO A;  5CYK A;  3JZH A;  5EM2 A;  2IUR A;  2B5M A;  1MG3 A;  4A09 A;  3IKO A;  4J0X A;  4ES0 A;  2OVQ B;  4GQ2 P;  5EMJ B;  1RI6 A;  4LGN A;  1N6F A;  1S4U X;  2YNO A;  1XKS A;  3JRP A;  3AL8 B;  4Z8L A;  3PXT D;  4CY2 A;  5I5M A;  2AH1 A;  2CNX A;  3IJC A;  2AGY A;  2YNN A;  5K1C C;  3FGB A;  1VYH C;  2HKM A;  5H1M A;  4CY3 A;  4CI3 A;  5H17 A;  4ZOY A;  2CN2 A;  5IT9 g;  4PC0 A;  4ESG A;  1GG2 B;  5FA5 B;  3J80 g;  1K8K C;  3JRO A;  2P9K C;  4JSV C;  2CE9 A;  5H14 A;  3JAM g;  4X61 B;  4K3I D;  3E0C A;  3SFZ A;  1R5M A;  3VA6 A;  5FKS A;  4X63 B;  4XYI A;  1B9Y A;  3I89 A;  4O1Q D;  3HFQ A;  4J79 A;  3SCY A;  4EWR A;  4D6V A;  4FA1 D;  2H14 A;  4ZOZ A;  5CXC A;  3I7P A;  5AMS A;  3C5M A;  4H5J A;  3UVO A;  4J87 A;  5FXY A;  4CZX A;  5FLX g;  4A0B B;  5EAP A;  3F3P A;  3RRM C;  2B5N A;  4D0K A;  3SBP A;  3DM0 A;  3PVU B;  3DWL C;  4Y5R D;  2I3S A;  2YMU A;  4GM9 A;  3V5W B;  2GC7 A;  4FA9 D;  3N0E A;  4JD2 C;  4HDJ A;  4J8B A;  3SMR A;  3OKW A;  5HE1 B;  3SVW D;  5C2W B;  4A7J A;  1A0R B;  5HE3 B;  5HE2 B;  3FM0 A;  5I5J A;  3AFC A;  3V9F A;  3RMZ D;  2H47 A;  2P9N C;  2UZY B;  3SXT D;  3RN1 D;  4A08 B;  1TBG A;  3DSM A;  5KDO B;  5FKR A;  4FA4 D;  3MKS B;  4L3G D;  3EI2 B;  4OWR A;  5TEF A;  4E54 B;  4A09 B;  2YB8 B;  2I0S A;  2TRC B;  4MK0 B;  4L1Q D;  5C9Z B;  3PXW D;  5EMK B;  3IJ0 A;  4FAN D;  3EI1 B;  1U4C A;  3EI4 B;  3I8E A;  2IWF A;  3UVM A;  2IAA A;  4J86 A;  2H9P A;  4FAV D;  2EBS A;  1PBY B;  4O3U B;  4A08 A;  3JZG A;  2Z2N A;  4JSP C;  3JPX A;  3I8C A;  2OVP B;  3EI2 A;  3IIW A;  3OTT A;  4E54 A;  3KRX B;  1MDA H;  5JWZ A;  3OL2 B;  3UKR C;  2HJ4 A;  3SJL D;  3RFG A;  1N6D A;  2P9L C;  4PSW B;  5CXC B;  2PM9 B;  3GRE A;  3EI1 A;  4CI1 A;  3EI4 A;  1JJU B;  4H5I A;  2HJB A;  1PGU A;  2OVR B;  2HES X;  2AGX A;  1NR0 A;  4CI8 A;  2YNP A;  4A0A B;  2G9A A;  4BUJ C;  4JXM A;  5IJ7 E;  2BBK H;  3CFS B;  4YVD A;  1NEX B;  3NVQ A;  3JB9 L;  5THA A;  3OL2 A;  4PXW A;  1ERJ A;  3KRW B;  4GM8 A;  4QT8 A;  4XEI C;  3RFH A;  3VH0 A;  2H13 A;  2Z2O A;  3V7D B;  5C2V B;  4A11 B;  2PM9 A;  1OLZ A;  2P9P C;  5GMK n;  1N6E A;  4PSX B;  4JT5 C;  4J8G A;  5SXM A;  2J57 G;  1OMW B;  4A0A A;  5FKQ A;  4GMB A;  4I79 A;  4CY1 A;  2G99 A;  3OKT A;  2HXC A;  2XL2 A;  2O9K A;  1JMZ B;  3K26 A;  3SHF A;  5FQD A;  4ERZ A;  4BH6 A;  2I3T A;  4JT6 C;  4J84 A;  4QL1 A;  3OKY A;  3MZK A;  2IUQ A;  3VGZ A;  4CZY A;  2J56 H;  4J73 A;  4A11 A;  2GC4 A;  2QC5 A;  3P4F A;  2CO0 C;  3SBR A;  3MMY A;  2IWK A;  3SN6 B;  2UZX B;  2PM7 B;  3CIK B;  4JSX C;  1U2V C;  3PSC B;  5TDH B;  2GNQ A;  4G56 B;  4AEZ A;  3EMH A;  1FWX A;  4NSX A;  2AQ5 A;  4TZ4 A;  5CXB B;  4CC9 A;  3CFV A;  1YFQ A;  4GGA A;  2Q7Q A;  4OZU A;  3PSL A;  3ULE C;  1B9X A;  5I5I A;  3C75 H;  1K32 A;  4X60 B;  4Y7R A;  2CO0 A;  4IA9 A;  3EG6 A;  2AGL A;  4QQE A;  3AL9 A;  4J78 A;  3A0F A;  5IC7 A;  4U1E I;  3I7N A;  3EU7 A;  2B5L A;  2H9M A;  1JOF A;  4O45 A;  3IJ1 A;  3ORV D;  2XYI A;  1SQJ A;  5CXB A;  4A2L A;  3BWS A;  3I7O A;  4O3T B;  1XHM A;  3J81 g;  5HE0 B;  4J82 A;  3L4M D;  5GXH A;  1PI6 A;  2J55 H;  2W18 A;  4GQB B;  2OK4 A;  2IUV A;  4GQ1 A;  4LG8 A;  4JSN C;  3UR4 A;  3EI3 A;  1QNI A;  4E5Z B;  3B7F A;  3EWE A;  5EAL A;  2CN3 A;  3RSE C;  3C9C A;  2OJY A;  3UVL A;  4J81 A;  1L0Q A;  1Q47 A;  3UVK A;  4GZ8 A;  3OKY B;  4X3E A;  5EML B;  1SHY B;  4FWW A;  4GGD A;  5AFU 3;  3DXM C;  5IJ8 E;  2H3X A;  3FRX A;  3ODT A;  2XL3 A;  2H6N A;  2P9U C;  3JZN A;  1TYQ C;  5EMM B;  2AGZ A;  4AOW A;  3U4Y A;  3NVN A;  3OW8 A;  4A2M A;  3MKQ A;  4FHL A;  4O9D A;  4IMM A;  1PEV A;  4ERQ A;  4FB1 D;  4E5Z A;  2BCJ B;  4PNK B;  4GGC A;  2I0R A;  3AL8 A;  5HQG A;  4CZV A;  2CE8 A;  3C99 A;  2YBA A;  4L9O A;  4LG9 A;  4QRJ A;  1GP2 B;  5A2Q g;  4XYH A;  3W15 A;  2H9L A;  3SLE D;  4UI9 R;  4N14 A;  1P22 A;  3AH8 B;  2Z2P A;  3UKU C;  3ZWL B;  2MTA H;  5B4W A;  2XU7 A;  5FKT A;  4U7A A;  4ZN4 A;  2IUP A;  3IIY A;  2AGW A; 
#chains in the Genus database with same CATH topology
 2B4E A;  4GM3 A;  3K72 A;  5TF2 A;  2H9N A;  2I0T A;  3RLM D;  4L3H D;  1U8C A;  5GSA A;  3I2N A;  4ERY A;  3BG0 A;  2P9I C;  1JMX B;  4PBY A;  3SBQ A;  3MVD K;  2JKX A;  1SQ9 A;  2OK6 A;  4K3J B;  5TEE A;  4A0B A;  3NVX A;  1M1X A;  2PBI B;  5AJA A;  4DNU A;  2H6Q A;  5EAM A;  3NIF A;  5IGQ A;  4J0W A;  2HYE A;  3I7K A;  3I7L A;  4BL0 A;  5EAR A;  3PVW B;  5CYK B;  5M5R A;  4FA5 D;  5C86 A;  5C92 A;  5EM2 B;  1O6G A;  3I7H A;  3MXX A;  4KFM B;  1GXR A;  2P9S C;  2QXV A;  4AX4 A;  4J77 A;  2AH0 A;  2HKR A;  3N0D A;  4ZOX A;  5GXI A;  3EI3 B;  3K27 A;  3O4J A;  3F3G A;  4G55 A;  2PM6 B;  3PE7 A;  1MG2 A;  1GOT B;  3BG1 A;  1XIP A;  4ZOV A;  4BCC A;  3GFC A;  3F3F A;  1E8M A;  2OIZ A;  4R7A B;  3SWS D;  3L4O D;  2H68 A;  3FCS A;  3GD1 I;  5K19 A;  4CI2 A;  3MZL A;  4PBZ A;  5HYN B;  3PXS D;  3RN0 D;  3UVN A;  2H6K A;  3DXK C;  3ZE0 A;  4CY5 A;  5IGO A;  5CYK A;  3JZH A;  5EM2 A;  2IUR A;  2B5M A;  1MG3 A;  4A09 A;  3IKO A;  4J0X A;  4ES0 A;  2OVQ B;  4UM9 A;  4GQ2 P;  5EMJ B;  2EIC A;  1RI6 A;  4RE6 A;  5E6R A;  5E6U A;  1N6F A;  4L1M A;  4LGN A;  1S4U X;  3EQ7 A;  2YNO A;  2HU7 A;  1XKS A;  3JRP A;  3AL8 B;  4Z8L A;  3PXT D;  4CY2 A;  5I5M A;  4AMZ A;  2AH1 A;  4BP8 A;  2CNX A;  3IJC A;  2AGY A;  2YNN A;  1E5T A;  5K1C C;  3IUL A;  3FGB A;  1VYH C;  2HKM A;  5H1M A;  4CY3 A;  4CI3 A;  5H17 A;  4ZOY A;  2CN2 A;  4O02 A;  5IT9 g;  4PC0 A;  4ESG A;  4MMX A;  1JTD B;  1GG2 B;  5FA5 B;  3J80 g;  1K8K C;  3JRO A;  2P9K C;  4JSV C;  2CE9 A;  5H14 A;  3JAM g;  4X61 B;  4K3I D;  3E0C A;  3SFZ A;  1R5M A;  3OF7 A;  4RE5 A;  5FKS A;  3VA6 A;  4X63 B;  4XYI A;  1B9Y A;  3I89 A;  4O1Q D;  3HFQ A;  4J79 A;  3SCY A;  1T2X A;  4EWR A;  4D6V A;  4FA1 D;  2H14 A;  4ZOZ A;  1QFS A;  3I7P A;  5CXC A;  3C5M A;  1JV2 A;  5AMS A;  4H5J A;  3UVO A;  4J87 A;  5FXY A;  4CZX A;  5FLX g;  4A0B B;  5EAP A;  1VE7 A;  3F3P A;  3RRM C;  2B5N A;  4D0K A;  3SBP A;  3DM0 A;  2XE4 A;  4BCB A;  4G1M A;  3PVU B;  1VZ3 A;  1C9L A;  3DWL C;  4Y5R D;  2I3S A;  2YMU A;  4GM9 A;  3V5W B;  2GC7 A;  4FA9 D;  3N0E A;  4JD2 C;  1H2Y A;  4HDJ A;  4O2W A;  4J8B A;  3SMR A;  3OKW A;  5HE1 B;  3SVW D;  5C2W B;  3ZE1 A;  4A7J A;  1A0R B;  5HE3 B;  5HE2 B;  3FM0 A;  3V4P A;  5I5J A;  3AFC A;  3V9F A;  3RMZ D;  2H47 A;  1GOF A;  2P9N C;  2UZY B;  3SXT D;  2VDR A;  3RN1 D;  4A08 B;  4Z7O A;  1TBG A;  3DSM A;  5KDO B;  5FKR A;  4FA4 D;  3MKS B;  4L3G D;  5M5T A;  3EI2 B;  1A12 A;  2QZP A;  3VI4 A;  3KCI A;  1UOP A;  4OWR A;  5TEF A;  4E54 B;  4A09 B;  2YB8 B;  2EIB A;  2I0S A;  3NID A;  3O4G A;  5M5U A;  2TRC B;  2VDM A;  4MK0 B;  4AN1 A;  1BPO A;  4L1Q D;  5C9Z B;  3PXW D;  3V4V A;  5EMK B;  3IJ0 A;  4FAN D;  3EI1 B;  2VDQ A;  1U4C A;  3EI4 B;  3I8E A;  1E8N A;  2IWF A;  3UVM A;  2IAA A;  4J86 A;  2H9P A;  3IUM A;  2EBS A;  4FAV D;  1PBY B;  2VZ1 A;  3VI3 A;  4O3U B;  4A08 A;  3JZG A;  2VDN A;  2Z2N A;  4JSP C;  5FFG A;  3JPX A;  1H2Z A;  3I8C A;  4AMY A;  2OVP B;  3EI2 A;  1GOG A;  3IIW A;  3OTT A;  4E54 A;  3KRX B;  4Z7N A;  1O6F A;  1MDA H;  5JWZ A;  3MUN A;  3OL2 B;  3ZDZ A;  3UKR C;  2HJ4 A;  3SJL D;  3IJE A;  3RFG A;  1N6D A;  2P9L C;  4PSW B;  5CXC B;  2PM9 B;  3QI0 A;  3GRE A;  3EI1 A;  4UM8 A;  4CI1 A;  3EI4 A;  1JJU B;  4H5I A;  2HJB A;  1PGU A;  2OVR B;  2HES X;  2AGX A;  1NR0 A;  3T3M A;  4CI8 A;  2YNP A;  5M5S A;  4A0A B;  4MMY A;  2G9A A;  4BUJ C;  4JXM A;  5IJ7 E;  2EIE A;  2BBK H;  3CFS B;  4YVD A;  2HU5 A;  1NEX B;  3K71 A;  3NVQ A;  3JB9 L;  5THA A;  4DNW A;  3OL2 A;  4PXW A;  5E6S A;  1ERJ A;  3KRW B;  4GM8 A;  4QT8 A;  4XEI C;  3O4H A;  4G1E A;  3RFH A;  3VH0 A;  2H13 A;  2Z2O A;  5M61 A;  3V7D B;  5C2V B;  3O4I A;  2PM9 A;  4A11 B;  2BKL A;  1OLZ A;  2P9P C;  2VDL A;  5GMK n;  1N6E A;  4PSX B;  4JT5 C;  1UOO A;  4J8G A;  5SXM A;  2J57 G;  1OMW B;  4A0A A;  5FKQ A;  4GMB A;  1VE6 A;  4I79 A;  4CY1 A;  1YR2 A;  2G99 A;  3OKT A;  2HXC A;  2XL2 A;  2O9K A;  1JMZ B;  4WK2 A;  3K26 A;  1GOH A;  3DDU A;  3SHF A;  4WK0 A;  5FQD A;  2WQ8 A;  3GC3 B;  4AN0 A;  4D9S A;  4ERZ A;  4BH6 A;  2I3T A;  4JT6 C;  4J84 A;  2VZ3 A;  4QL1 A;  3OKY A;  3MZK A;  2IUQ A;  3VGZ A;  4CZY A;  2J56 H;  4J73 A;  4A11 A;  2GC4 A;  2QC5 A;  3P4F A;  3K6S A;  2CO0 C;  3SBR A;  3MMY A;  2IWK A;  3SN6 B;  2UZX B;  2PM7 B;  3CIK B;  4JSX C;  1U2V C;  3PSC B;  4JHP C;  5TDH B;  2GNQ A;  2HU8 A;  4G56 B;  4IRZ A;  3T3P A;  4AEZ A;  3EMH A;  1H2W A;  1FWX A;  3EQ8 A;  2VC2 A;  4NAA A;  4NBM A;  4NSX A;  2AQ5 A;  4TZ4 A;  5CXB B;  3MUO A;  4CC9 A;  3CFV A;  1YFQ A;  4GGA A;  1C9I A;  2Q7Q A;  4OZU A;  3PSL A;  3ULE C;  1B9X A;  2XDW A;  3IUQ A;  3ZE2 A;  5I5I A;  3C75 H;  1K32 A;  1I2M B;  4X60 B;  2CO0 A;  4IA9 A;  4Y7R A;  5HDB A;  3EG6 A;  2AGL A;  4QQE A;  3AL9 A;  2EID A;  3ZDX A;  3IUN A;  4J78 A;  1UOQ A;  3A0F A;  5IC7 A;  4U1E I;  3ZDY A;  3I7N A;  3QHY B;  3EU7 A;  2B5L A;  2H9M A;  1JOF A;  1QFM A;  4O45 A;  3IJ1 A;  3ORV D;  1VZ2 A;  2XYI A;  1SQJ A;  5CXB A;  3EQ9 A;  4A2L A;  4NEN A;  3BWS A;  3I7O A;  4O3T B;  1XHM A;  4BCD A;  3J81 g;  4Z7Q A;  5HE0 B;  4J82 A;  3L4M D;  5GXH A;  1PI6 A;  5FFO A;  2J55 H;  3FCU A;  1TYE A;  2W18 A;  4GQB B;  1UTC A;  5M5V A;  2OK4 A;  2IUV A;  4GQ1 A;  4LG8 A;  4JSN C;  3UR4 A;  3EI3 A;  1K3I A;  4JHN A;  1QNI A;  4E5Z B;  3B7F A;  3EWE A;  5EAL A;  4WJK A;  2CN3 A;  4BP9 A;  3RSE C;  3C9C A;  2OJY A;  3UVL A;  4J81 A;  1L0Q A;  1Q47 A;  3NIG A;  3UVK A;  4GZ8 A;  3OKY B;  4X3E A;  5EML B;  1SHY B;  4FWW A;  4GGD A;  5AFU 3;  3DXM C;  5IJ8 E;  2H3X A;  3FRX A;  3ODT A;  2XL3 A;  1L5G A;  2H6N A;  2P9U C;  3JZN A;  1H2X A;  1TYQ C;  5EMM B;  2AGZ A;  4AOW A;  3U4Y A;  3NVN A;  3OW8 A;  2VDO A;  4A2M A;  3MKQ A;  4FHL A;  4O9D A;  2QR5 A;  4IMM A;  1PEV A;  4ERQ A;  4DNV A;  4FB1 D;  4E5Z A;  2BCJ B;  4PNK B;  4GGC A;  2I0R A;  3AL8 A;  5HQG A;  4CZV A;  2CE8 A;  3C99 A;  2YBA A;  4L9O A;  4LG9 A;  4QRJ A;  4NC4 A;  1GP2 B;  5A2Q g;  4XYH A;  2VDP A;  3W15 A;  3IUR A;  3IVM A;  4MMZ A;  2H9L A;  3SLE D;  4UI9 R;  4WK4 A;  4N14 A;  2XZG A;  1P22 A;  3AH8 B;  2Z2P A;  3UKU C;  3ZWL B;  2MTA H;  5B4W A;  2XU7 A;  5FKT A;  3IUJ A;  4U7A A;  2IUP A;  4QAM A;  4ZN4 A;  3IIY A;  2VDK A;  2AGW A; 
#chains in the Genus database with same CATH homology
 2B4E A;  4GM3 A;  5TF2 A;  2H9N A;  2I0T A;  3RLM D;  4L3H D;  5GSA A;  3I2N A;  4ERY A;  3BG0 A;  2P9I C;  1JMX B;  4PBY A;  3SBQ A;  1SQ9 A;  2OK6 A;  4K3J B;  5TEE A;  4A0B A;  3NVX A;  2PBI B;  5AJA A;  2H6Q A;  5EAM A;  5IGQ A;  4J0W A;  2HYE A;  3I7K A;  3I7L A;  4BL0 A;  5EAR A;  3PVW B;  5CYK B;  4FA5 D;  5EM2 B;  3I7H A;  3MXX A;  4KFM B;  1GXR A;  2P9S C;  2QXV A;  4J77 A;  2AH0 A;  2HKR A;  3N0D A;  4ZOX A;  5GXI A;  3EI3 B;  3K27 A;  3F3G A;  2PM6 B;  3PE7 A;  1MG2 A;  1GOT B;  3BG1 A;  1XIP A;  4ZOV A;  3GFC A;  3F3F A;  2OIZ A;  4R7A B;  3SWS D;  3L4O D;  2H68 A;  5K19 A;  4CI2 A;  3MZL A;  4PBZ A;  5HYN B;  3PXS D;  3RN0 D;  3UVN A;  2H6K A;  3DXK C;  4CY5 A;  5IGO A;  5CYK A;  3JZH A;  5EM2 A;  2IUR A;  2B5M A;  1MG3 A;  4A09 A;  3IKO A;  4J0X A;  4ES0 A;  2OVQ B;  4GQ2 P;  5EMJ B;  1RI6 A;  4LGN A;  1N6F A;  1S4U X;  2YNO A;  1XKS A;  3JRP A;  3AL8 B;  4Z8L A;  3PXT D;  4CY2 A;  5I5M A;  2AH1 A;  2CNX A;  3IJC A;  2AGY A;  2YNN A;  5K1C C;  3FGB A;  1VYH C;  2HKM A;  5H1M A;  4CY3 A;  4CI3 A;  5H17 A;  4ZOY A;  2CN2 A;  5IT9 g;  4PC0 A;  4ESG A;  1GG2 B;  5FA5 B;  3J80 g;  1K8K C;  3JRO A;  2P9K C;  4JSV C;  2CE9 A;  5H14 A;  3JAM g;  4X61 B;  4K3I D;  3E0C A;  3SFZ A;  1R5M A;  3VA6 A;  5FKS A;  4X63 B;  4XYI A;  1B9Y A;  3I89 A;  4O1Q D;  3HFQ A;  4J79 A;  3SCY A;  4EWR A;  4D6V A;  4FA1 D;  2H14 A;  4ZOZ A;  5CXC A;  3I7P A;  5AMS A;  3C5M A;  4H5J A;  3UVO A;  4J87 A;  5FXY A;  4CZX A;  5FLX g;  4A0B B;  5EAP A;  3F3P A;  3RRM C;  2B5N A;  4D0K A;  3SBP A;  3DM0 A;  3PVU B;  3DWL C;  4Y5R D;  2I3S A;  2YMU A;  4GM9 A;  3V5W B;  2GC7 A;  4FA9 D;  3N0E A;  4JD2 C;  4HDJ A;  4J8B A;  3SMR A;  3OKW A;  5HE1 B;  3SVW D;  5C2W B;  4A7J A;  1A0R B;  5HE3 B;  5HE2 B;  3FM0 A;  5I5J A;  3AFC A;  3V9F A;  3RMZ D;  2H47 A;  2P9N C;  2UZY B;  3SXT D;  3RN1 D;  4A08 B;  1TBG A;  3DSM A;  5KDO B;  5FKR A;  4FA4 D;  3MKS B;  4L3G D;  3EI2 B;  4OWR A;  5TEF A;  4E54 B;  4A09 B;  2YB8 B;  2I0S A;  2TRC B;  4MK0 B;  4L1Q D;  5C9Z B;  3PXW D;  5EMK B;  3IJ0 A;  4FAN D;  3EI1 B;  1U4C A;  3EI4 B;  3I8E A;  2IWF A;  3UVM A;  2IAA A;  4J86 A;  2H9P A;  4FAV D;  2EBS A;  1PBY B;  4O3U B;  4A08 A;  3JZG A;  2Z2N A;  4JSP C;  3JPX A;  3I8C A;  2OVP B;  3EI2 A;  3IIW A;  3OTT A;  4E54 A;  3KRX B;  1MDA H;  5JWZ A;  3OL2 B;  3UKR C;  2HJ4 A;  3SJL D;  3RFG A;  1N6D A;  2P9L C;  4PSW B;  5CXC B;  2PM9 B;  3GRE A;  3EI1 A;  4CI1 A;  3EI4 A;  1JJU B;  4H5I A;  2HJB A;  1PGU A;  2OVR B;  2HES X;  2AGX A;  1NR0 A;  4CI8 A;  2YNP A;  4A0A B;  2G9A A;  4BUJ C;  4JXM A;  5IJ7 E;  2BBK H;  3CFS B;  4YVD A;  1NEX B;  3NVQ A;  3JB9 L;  5THA A;  3OL2 A;  4PXW A;  1ERJ A;  3KRW B;  4GM8 A;  4QT8 A;  4XEI C;  3RFH A;  3VH0 A;  2H13 A;  2Z2O A;  3V7D B;  5C2V B;  4A11 B;  2PM9 A;  1OLZ A;  2P9P C;  5GMK n;  1N6E A;  4PSX B;  4JT5 C;  4J8G A;  5SXM A;  2J57 G;  1OMW B;  4A0A A;  5FKQ A;  4GMB A;  4I79 A;  4CY1 A;  2G99 A;  3OKT A;  2HXC A;  2XL2 A;  2O9K A;  1JMZ B;  3K26 A;  3SHF A;  5FQD A;  4ERZ A;  4BH6 A;  2I3T A;  4JT6 C;  4J84 A;  4QL1 A;  3OKY A;  3MZK A;  2IUQ A;  3VGZ A;  4CZY A;  2J56 H;  4J73 A;  4A11 A;  2GC4 A;  2QC5 A;  3P4F A;  2CO0 C;  3SBR A;  3MMY A;  2IWK A;  3SN6 B;  2UZX B;  2PM7 B;  3CIK B;  4JSX C;  1U2V C;  3PSC B;  5TDH B;  2GNQ A;  4G56 B;  4AEZ A;  3EMH A;  1FWX A;  4NSX A;  2AQ5 A;  4TZ4 A;  5CXB B;  4CC9 A;  3CFV A;  1YFQ A;  4GGA A;  2Q7Q A;  4OZU A;  3PSL A;  3ULE C;  1B9X A;  5I5I A;  3C75 H;  1K32 A;  4X60 B;  4Y7R A;  2CO0 A;  4IA9 A;  3EG6 A;  2AGL A;  4QQE A;  3AL9 A;  4J78 A;  3A0F A;  5IC7 A;  4U1E I;  3I7N A;  3EU7 A;  2B5L A;  2H9M A;  1JOF A;  4O45 A;  3IJ1 A;  3ORV D;  2XYI A;  1SQJ A;  5CXB A;  4A2L A;  3BWS A;  3I7O A;  4O3T B;  1XHM A;  3J81 g;  5HE0 B;  4J82 A;  3L4M D;  5GXH A;  1PI6 A;  2J55 H;  2W18 A;  4GQB B;  2OK4 A;  2IUV A;  4GQ1 A;  4LG8 A;  4JSN C;  3UR4 A;  3EI3 A;  1QNI A;  4E5Z B;  3B7F A;  3EWE A;  5EAL A;  2CN3 A;  3RSE C;  3C9C A;  2OJY A;  3UVL A;  4J81 A;  1L0Q A;  1Q47 A;  3UVK A;  4GZ8 A;  3OKY B;  4X3E A;  5EML B;  1SHY B;  4FWW A;  4GGD A;  5AFU 3;  3DXM C;  5IJ8 E;  2H3X A;  3FRX A;  3ODT A;  2XL3 A;  2H6N A;  2P9U C;  3JZN A;  1TYQ C;  5EMM B;  2AGZ A;  4AOW A;  3U4Y A;  3NVN A;  3OW8 A;  4A2M A;  3MKQ A;  4FHL A;  4O9D A;  4IMM A;  1PEV A;  4ERQ A;  4FB1 D;  4E5Z A;  2BCJ B;  4PNK B;  4GGC A;  2I0R A;  3AL8 A;  5HQG A;  4CZV A;  2CE8 A;  3C99 A;  2YBA A;  4L9O A;  4LG9 A;  4QRJ A;  1GP2 B;  5A2Q g;  4XYH A;  3W15 A;  2H9L A;  3SLE D;  4UI9 R;  4N14 A;  1P22 A;  3AH8 B;  2Z2P A;  3UKU C;  3ZWL B;  2MTA H;  5B4W A;  2XU7 A;  5FKT A;  4U7A A;  4ZN4 A;  2IUP A;  3IIY A;  2AGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...