4BH6A

Insights into degron recognition by apc coactivators from the structure of an acm1-cdh1 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
304
structure length
304
Chain Sequence
b'RQIAKVPYRVLDAPSLADDFYYSLIDWSSTDVLAVALGKSIFLTDNNTGDVVHLCDTENEYTSLSWIGAGSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APC/C ACTIVATOR PROTEIN CDH1
publication title Insights Into Degron Recognition by Apc/C Coactivators from the Structure of an Acm1-Cdh1 Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 88
structure length 304
sequence length 304
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4bh6A00
2HYEA 3FRXA 4CI8A 5HE0B 1XKSA 3L4MD 2CO0A 5TEEA 5EARA 5JWZA 3VGZA 1XIPA 3UR4A 2XL2A 3JZHA 3FGBA 4FHLA 5CXCA 2I0TA 2B5MA 2IAAA 3MZLA 3ULEC 2UZXB 4J8GA 1OMWB 3EU7A 1N6FA 5C2WB 4ZOYA 3UVLA 1Q47A 4A2MA 3E0CA 3I7PA 3SBPA 2H13A 2TRCB 2Z2NA 3UVNA 2BCJB 3NVNA 3RFHA 3OL2B 3DSMA 4A2LA 4K3JB 3ZWLB 4X63B 4CZVA 5FLXg 4CZYA 3BG0A 5A2Qg 4GZ8A 2CE8A 3I89A 2HJ4A 3AL8B 3EI1B 3K27A 5I5JA 3VH0A 1N6EA 2OJYA 3SXTD 3RRMC 3MKQA 2AH1A 4PC0A 2G9AA 5FKRA 3SMRA 1R5MA 5AJAA 3ORVD 2GNQA 2IUQA 2H9NA 1U2VC 2O9KA 5C2VB 1K32A 3I8CA 3MKSB 4A09A 3I2NA 2AH0A 4CY2A 2P9KC 4X61B 1GG2B 2PM9A 4O3TB 4ES0A 4YVDA 4CC9A 3CFVA 4ESGA 3IJCA 3OTTA 5CXBA 5IT9g 5EMKB 5H17A 5IGOA 4J82A 4PXWA 3DXKC 1QNIA 3BWSA 2XU7A 4L9OA 5C9ZB 3EWEA 3UKUC 5GSAA 3PXWD 4L3GD 3SHFA 3F3PA 3EI3B 4GQ2P 2J57G 3IIWA 2IUVA 4BL0A 4JSXC 2OK6A 3NVQA 2Q7QA 3J80g 4H5JA 3RN1D 5FKSA 1U4CA 3I7KA 1GXRA 4OWRA 5EALA 3KRWB 1A0RB 1XHMA 3JRPA 3I7NA 3JZGA 4HDJA 3PXTD 2BBKH 2CO0C 2IWFA 3I7LA 3VA6A 3EI2A 2GC7A 3CFSB 5H14A 3KRXB 4FA9D 2CNXA 3OL2A 5FXYA 4J0WA 2I0RA 4J87A 4A0BA 1JJUB 4QT8A 2H6QA 3IJ0A 2P9LC 2B5NA 1S4UX 2OVRB 4JSVC 5H1MA 4A08A 3PVUB 2H6KA 2YNPA 3SFZA 5THAA 5TDHB 3EI1A 2YNOA 1N6DA 3I7OA 4O9DA 4Y7RA 4GM9A 2H3XA 2YMUA 3SLED 4FAND 3FM0A 2H9PA 3C9CA 3PVWB 2B4EA 3SJLD 4ZOVA 3B7FA 4O45A 5EAMA 2H68A 3HFQA 3IIYA 4PBYA 4J8BA 3OKYB 5IC7A 3RLMD 3C75H 5FKTA 1TBGA 4FA4D 5CXCB 1TYQC 4AOWA 5EMJB 5I5MA 4K3ID 4JT6C 4BH6A 4LG9A 1JMZB 5HYNB 4A7JA 5IJ8E 3EMHA 4QL1A 2G99A 1RI6A 2CE9A 5FKQA 2GC4A 3OKTA 4JSNC 4CY3A 4ZN4A 4E54A 3PSCB 5EM2B 4CI1A 4XYHA 3EI3A 4LG8A 4A11B 2EBSA 1SQ9A 3GFCA 2HESX 2OVQB 2Z2OA 1PI6A 5B4WA 3V9FA 5K19A 3SBRA 5TF2A 3RMZD 3MMYA 2P9IC 4UI9R 3W15A 4NSXA 2I3SA 4CY5A 2HKMA 4JXMA 4Y5RD 4ERYA 5AFU3 1SHYB 2AGLA 2H9MA 3ODTA 5CYKB 3JROA 4A0AB 2OVPB 4A09B 3DXMC 4CI3A 3SWSD 2P9PC 1GP2B 4IA9A 4CI2A 3NVXA 4E5ZB 4J77A 5HQGA 2IURA 4O1QD 2W18A 2AQ5A 4J0XA 3DWLC 3JAMg 4ZOXA 3AFCA 1OLZA 3RN0D 2P9NC 4TZ4A 2UZYB 3K26A 4R7AB 3EG6A 3V7DB 5EMMB 3C99A 2AGYA 4PNKB 2P9SC 3SCYA 1PBYB 2H9LA 2YBAA 2OK4A 4GGDA 2AGXA 2AGWA 4GQBB 4X60B 2B5LA 4PSWB 4CY1A 2OIZA 2H14A 1B9XA 2P9UC 4QQEA 3SVWD 3EI4B 3OW8A 2XL3A 5GXHA 3AL8A 4GGAA 1GOTB 5AMSA 4FA5D 3OKYA 4ERZA 4L1QD 4Z8LA 2I3TA 5HE2B 5IGQA 2CN3A 4G56B 4KFMB 3UVMA 2MTAH 3PXSD 3MXXA 4D6VA 1K8KC 3CIKB 4J86A 4QRJA 4OZUA 1JMXB 3IJ1A 4BUJC 3EI2B 3P4FA 1SQJA 5EM2A 3SN6B 5FA5B 2J55H 2IUPA 2QC5A 5EAPA 4J73A 2Z2PA 4A0BB 4J84A 3RSEC 4CZXA 5I5IA 1PGUA 4A11A 2IWKA 4A08B 2H47A 2YNNA 4N14A 4D0KA 3DM0A 5KDOB 3N0DA 1PEVA 5TEFA 3UKRC 4U1EI 5SXMA 4MK0B 3PSLA 5IJ7E 4J79A 1L0QA 4GMBA 2HJBA 4ERQA 3BG1A 4ZOZA 4JSPC 4I79A 5GXIA 2YB8B 1YFQA 2J56H 1NR0A 2PM7B 5CYKA 3RFGA 3U4YA 3JZNA 4JT5C 4A0AA 4FB1D 4GQ1A 3IKOA 2HKRA 4X3EA 3I8EA 4E5ZA 2HXCA 1B9YA 1NEXB 3OKWA 2PBIB 3A0FA 4PBZA 1MG3A 3MZKA 3AL9A 3JB9L 1ERJA 5K1CC 3SBQA 2XYIA 4GM8A 3F3FA 2H6NA 3GREA 4GM3A 3C5MA 4L3HD 4E54B 3J81g 2CN2A 2PM9B 5FQDA 5EMLB 4J78A 4AEZA 3F3GA 1VYHC 3N0EA 4JD2C 4O3UB 5GMKn 4XEIC 4FAVD 4FA1D 5CXBB 2PM6B 1MG2A 4J81A 3V5WB 3I7HA 4IMMA 3EI4A 4GGCA 4PSXB 4LGNA 4H5IA 3AH8B 4U7AA 4FWWA 3PE7A 2AGZA 4EWRA 1MDAH 3UVKA 1JOFA 3UVOA 3JPXA 4XYIA 1P22A 3L4OD 1FWXA 5HE3B 2I0SA 2QXVA 5HE1B
chains in the Genus database with same CATH superfamily
4NENA 2HYEA 1E8MA 3FRXA 4CI8A 5HE0B 1XKSA 3L4MD 2CO0A 5TEEA 5EARA 5JWZA 3VGZA 1XIPA 5FFOA 3UR4A 2XL2A 3JZHA 3FGBA 4FHLA 5CXCA 2I0TA 2B5MA 2IAAA 3MZLA 3T3PA 3ULEC 2UZXB 4NBMA 4J8GA 1OMWB 3EU7A 1N6FA 5C2WB 3ZE2A 4ZOYA 4JHNA 3UVLA 1Q47A 4A2MA 3E0CA 3I7PA 3SBPA 2H13A 4WK2A 4AN1A 1VE6A 2TRCB 2Z2NA 1GOHA 3UVNA 2BCJB 3QI0A 3MUOA 3NVNA 3RFHA 1H2YA 3OF7A 4MMXA 3OL2B 2JKXA 3DSMA 3QHYB 2VDQA 4A2LA 4BP9A 4K3JB 3ZWLB 4X63B 4CZVA 5FLXg 4CZYA 3BG0A 5A2Qg 4GZ8A 2CE8A 3I89A 2HJ4A 3AL8B 1E5TA 3EI1B 3K27A 5I5JA 3VH0A 2VDOA 4L1MA 1N6EA 2OJYA 3MUNA 3O4GA 3SXTD 3RRMC 1JV2A 3MKQA 2AH1A 4PC0A 2G9AA 5FKRA 3SMRA 2VZ1A 1R5MA 5AJAA 1U8CA 2QR5A 3ORVD 2GNQA 2IUQA 2H9NA 2XZGA 4O2WA 1U2VC 2O9KA 5C2VB 1K32A 3I8CA 3MKSB 4A09A 3I2NA 2AH0A 3ZDZA 4CY2A 2P9KC 3NIDA 3ZDYA 4X61B 1GG2B 2PM9A 3KCIA 4O3TB 1VZ3A 4ES0A 4YVDA 4CC9A 3CFVA 4ESGA 3IJCA 3OTTA 5CXBA 5IT9g 5EMKB 5H17A 5IGOA 4J82A 4PXWA 3DXKC 1QNIA 2XE4A 3BWSA 2EIDA 4Z7QA 2XU7A 4L9OA 5C9ZB 2WQ8A 3EWEA 3UKUC 2VDNA 5GSAA 3PXWD 4L3GD 3SHFA 3F3PA 3EI3B 1QFMA 2XDWA 4GQ2P 2J57G 3IIWA 2IUVA 1VZ2A 3O4HA 2HU5A 4BL0A 4JSXC 4MMYA 2OK6A 3NVQA 2Q7QA 3K72A 3J80g 3O4JA 4H5JA 3RN1D 4BCBA 5FKSA 1U4CA 3I7KA 1GXRA 3IJEA 4OWRA 5EALA 3KRWB 1A0RB 1XHMA 3JRPA 3I7NA 1I2MB 3K71A 3JZGA 4HDJA 5M5RA 3PXTD 2BBKH 2CO0C 2IWFA 4UM9A 4BCCA 3I7LA 3VA6A 3EI2A 2GC7A 3CFSB 5H14A 3KRXB 4FA9D 4BCDA 2CNXA 3OL2A 4DNUA 5FXYA 4J0WA 2I0RA 4J87A 4A0BA 1JJUB 3EQ8A 4QT8A 2VC2A 1C9IA 2H6QA 3IJ0A 1VE7A 2EICA 2P9LC 1S4UX 2B5NA 2OVRB 4JSVC 5H1MA 4A08A 3PVUB 2H6KA 2YNPA 3SFZA 5THAA 5TDHB 3EI1A 2YNOA 1N6DA 3GC3B 3I7OA 4O9DA 1GOFA 3FCSA 3IUNA 4Y7RA 1BPOA 4GM9A 2EIEA 1UOOA 2H3XA 3ZE0A 2YMUA 3NIFA 3SLED 4FAND 3FM0A 2H9PA 3C9CA 4RE5A 3PVWB 5FFGA 2B4EA 3SJLD 4ZOVA 1T2XA 3B7FA 4O45A 5EAMA 2H68A 3HFQA 3IIYA 4PBYA 4J8BA 3OKYB 5IC7A 3RLMD 2VDLA 3C75H 5FKTA 4NC4A 1TBGA 4FA4D 3MVDK 5CXCB 1M1XA 1TYQC 4Z7OA 4AOWA 5EMJB 5I5MA 4K3ID 4JT6C 3VI3A 4BH6A 4LG9A 1JMZB 5HYNB 1A12A 4A7JA 5IJ8E 1GOGA 2VDPA 3EMHA 2VDMA 4QL1A 2G99A 1RI6A 2CE9A 5FKQA 2GC4A 3OKTA 4BP8A 4JSNC 4CY3A 4ZN4A 4E54A 3PSCB 5EM2B 4CI1A 4XYHA 1UTCA 2EIBA 3EI3A 4AX4A 4LG8A 3FCUA 4A11B 2EBSA 4WJKA 1C9LA 1SQ9A 3GFCA 2HESX 4JHPC 5HDBA 4AMZA 2OVQB 2Z2OA 1PI6A 5B4WA 3V9FA 5K19A 3SBRA 5TF2A 3RMZD 3MMYA 2P9IC 4UI9R 3W15A 1E8NA 4NSXA 2I3SA 4CY5A 1H2WA 2HKMA 4IRZA 4JXMA 4Y5RD 4ERYA 1JTDB 5AFU3 1SHYB 3VI4A 2AGLA 3IUQA 2H9MA 3ODTA 5CYKB 3JROA 4AN0A 4A0AB 2OVPB 5M5TA 4A09B 3DXMC 4CI3A 3DDUA 3SWSD 2P9PC 1GP2B 4IA9A 4CI2A 3NVXA 3IUJA 4E5ZB 4J77A 3IUMA 2IURA 5HQGA 2VZ3A 5M61A 4O1QD 2W18A 2AQ5A 4J0XA 3DWLC 3JAMg 4ZOXA 1TYEA 3AFCA 1OLZA 4O02A 5M5UA 2HU8A 1H2XA 3RN0D 2P9NC 4TZ4A 2UZYB 3K26A 4R7AB 3EG6A 3V7DB 5EMMB 5M5VA 3C99A 2AGYA 4PNKB 2P9SC 3IULA 3SCYA 1PBYB 2H9LA 5E6RA 2YBAA 2OK4A 4GGDA 2AGXA 2AGWA 4GQBB 4X60B 2B5LA 4PSWB 4UM8A 4CY1A 2OIZA 1O6FA 2HU7A 2H14A 1B9XA 2P9UC 4QQEA 3SVWD 3EI4B 1O6GA 3OW8A 2XL3A 5GXHA 3AL8A 4GGAA 1GOTB 4QAMA 5AMSA 4FA5D 3OKYA 3NIGA 3ZE1A 4ERZA 4L1QD 4Z8LA 2I3TA 5C92A 5HE2B 4DNVA 5IGQA 3IURA 2CN3A 5E6UA 4G56B 4KFMB 2BKLA 3UVMA 2MTAH 3PXSD 4NAAA 3MXXA 4D6VA 1K8KC 3CIKB 4J86A 4QRJA 4OZUA 1JMXB 3IJ1A 4BUJC 3EI2B 1QFSA 3P4FA 4G1MA 1SQJA 5EM2A 3SN6B 5FA5B 2J55H 2IUPA 2QC5A 5EAPA 4J73A 2Z2PA 3T3MA 4A0BB 1L5GA 4J84A 3ZDXA 3RSEC 4CZXA 1YR2A 5E6SA 5I5IA 1PGUA 4G1EA 4A11A 2IWKA 4A08B 2H47A 2YNNA 2QZPA 4N14A 3DM0A 4D0KA 5KDOB 3N0DA 1PEVA 5TEFA 3UKRC 3V4VA 4G55A 4U1EI 5SXMA 4MK0B 3PSLA 5IJ7E 5M5SA 4J79A 1UOPA 1L0QA 4GMBA 2HJBA 4ERQA 3BG1A 4ZOZA 4DNWA 4JSPC 4I79A 5GXIA 2YB8B 1YFQA 2J56H 1NR0A 2PM7B 3GD1I 5CYKA 3RFGA 3U4YA 3JZNA 4JT5C 4A0AA 4FB1D 4GQ1A 3IKOA 4D9SA 2HKRA 4X3EA 3IVMA 4Z7NA 3I8EA 4E5ZA 2HXCA 1B9YA 1NEXB 3OKWA 2PBIB 3A0FA 4PBZA 1MG3A 4MMZA 3MZKA 3AL9A 3JB9L 1ERJA 5K1CC 2VDRA 3SBQA 2XYIA 4GM8A 3F3FA 4WK4A 2H6NA 3GREA 3EQ7A 4GM3A 4RE6A 3C5MA 4L3HD 4E54B 3J81g 2CN2A 2PM9B 5FQDA 3K6SA 5EMLB 4J78A 4AEZA 3F3GA 1VYHC 3N0EA 4JD2C 4O3UB 5GMKn 4XEIC 4FAVD 4FA1D 5CXBB 2PM6B 4AMYA 1MG2A 4J81A 3V4PA 3V5WB 3I7HA 4IMMA 1UOQA 3EQ9A 3EI4A 3O4IA 4GGCA 1K3IA 4PSXB 4WK0A 4LGNA 4H5IA 3AH8B 4U7AA 5C86A 4FWWA 3PE7A 2AGZA 4EWRA 1MDAH 3UVKA 1JOFA 3UVOA 3JPXA 4XYIA 1P22A 3L4OD 1H2ZA 1FWXA 5HE3B 2I0SA 2VDKA 2QXVA 5HE1B
chains in the Genus database with same CATH topology
2HYEA 3FRXA 4CI8A 5HE0B 1XKSA 3L4MD 2CO0A 5TEEA 5EARA 5JWZA 3VGZA 1XIPA 3UR4A 2XL2A 3JZHA 3FGBA 4FHLA 5CXCA 2I0TA 2B5MA 2IAAA 3MZLA 3ULEC 2UZXB 4J8GA 1OMWB 3EU7A 1N6FA 5C2WB 4ZOYA 3UVLA 1Q47A 4A2MA 3E0CA 3I7PA 3SBPA 2H13A 2TRCB 2Z2NA 3UVNA 2BCJB 3NVNA 3RFHA 3OL2B 3DSMA 4A2LA 4K3JB 3ZWLB 4X63B 4CZVA 5FLXg 4CZYA 3BG0A 5A2Qg 4GZ8A 2CE8A 3I89A 2HJ4A 3AL8B 3EI1B 3K27A 5I5JA 3VH0A 1N6EA 2OJYA 3SXTD 3RRMC 3MKQA 2AH1A 4PC0A 2G9AA 5FKRA 3SMRA 1R5MA 5AJAA 3ORVD 2GNQA 2IUQA 2H9NA 1U2VC 2O9KA 5C2VB 1K32A 3I8CA 3MKSB 4A09A 3I2NA 2AH0A 4CY2A 2P9KC 4X61B 1GG2B 2PM9A 4O3TB 4ES0A 4YVDA 4CC9A 3CFVA 4ESGA 3IJCA 3OTTA 5CXBA 5IT9g 5EMKB 5H17A 5IGOA 4J82A 4PXWA 3DXKC 1QNIA 3BWSA 2XU7A 4L9OA 5C9ZB 3EWEA 3UKUC 5GSAA 3PXWD 4L3GD 3SHFA 3F3PA 3EI3B 4GQ2P 2J57G 3IIWA 2IUVA 4BL0A 4JSXC 2OK6A 3NVQA 2Q7QA 3J80g 4H5JA 3RN1D 5FKSA 1U4CA 3I7KA 1GXRA 4OWRA 5EALA 3KRWB 1A0RB 1XHMA 3JRPA 3I7NA 3JZGA 4HDJA 3PXTD 2BBKH 2CO0C 2IWFA 3I7LA 3VA6A 3EI2A 2GC7A 3CFSB 5H14A 3KRXB 4FA9D 2CNXA 3OL2A 5FXYA 4J0WA 2I0RA 4J87A 4A0BA 1JJUB 4QT8A 2H6QA 3IJ0A 2P9LC 2B5NA 1S4UX 2OVRB 4JSVC 5H1MA 4A08A 3PVUB 2H6KA 2YNPA 3SFZA 5THAA 5TDHB 3EI1A 2YNOA 1N6DA 3I7OA 4O9DA 4Y7RA 4GM9A 2H3XA 2YMUA 3SLED 4FAND 3FM0A 2H9PA 3C9CA 3PVWB 2B4EA 3SJLD 4ZOVA 3B7FA 4O45A 5EAMA 2H68A 3HFQA 3IIYA 4PBYA 4J8BA 3OKYB 5IC7A 3RLMD 3C75H 5FKTA 1TBGA 4FA4D 5CXCB 1TYQC 4AOWA 5EMJB 5I5MA 4K3ID 4JT6C 4BH6A 4LG9A 1JMZB 5HYNB 4A7JA 5IJ8E 3EMHA 4QL1A 2G99A 1RI6A 2CE9A 5FKQA 2GC4A 3OKTA 4JSNC 4CY3A 4ZN4A 4E54A 3PSCB 5EM2B 4CI1A 4XYHA 3EI3A 4LG8A 4A11B 2EBSA 1SQ9A 3GFCA 2HESX 2OVQB 2Z2OA 1PI6A 5B4WA 3V9FA 5K19A 3SBRA 5TF2A 3RMZD 3MMYA 2P9IC 4UI9R 3W15A 4NSXA 2I3SA 4CY5A 2HKMA 4JXMA 4Y5RD 4ERYA 5AFU3 1SHYB 2AGLA 2H9MA 3ODTA 5CYKB 3JROA 4A0AB 2OVPB 4A09B 3DXMC 4CI3A 3SWSD 2P9PC 1GP2B 4IA9A 4CI2A 3NVXA 4E5ZB 4J77A 5HQGA 2IURA 4O1QD 2W18A 2AQ5A 4J0XA 3DWLC 3JAMg 4ZOXA 3AFCA 1OLZA 3RN0D 2P9NC 4TZ4A 2UZYB 3K26A 4R7AB 3EG6A 3V7DB 5EMMB 3C99A 2AGYA 4PNKB 2P9SC 3SCYA 1PBYB 2H9LA 2YBAA 2OK4A 4GGDA 2AGXA 2AGWA 4GQBB 4X60B 2B5LA 4PSWB 4CY1A 2OIZA 2H14A 1B9XA 2P9UC 4QQEA 3SVWD 3EI4B 3OW8A 2XL3A 5GXHA 3AL8A 4GGAA 1GOTB 5AMSA 4FA5D 3OKYA 4ERZA 4L1QD 4Z8LA 2I3TA 5HE2B 5IGQA 2CN3A 4G56B 4KFMB 3UVMA 2MTAH 3PXSD 3MXXA 4D6VA 1K8KC 3CIKB 4J86A 4QRJA 4OZUA 1JMXB 3IJ1A 4BUJC 3EI2B 3P4FA 1SQJA 5EM2A 3SN6B 5FA5B 2J55H 2IUPA 2QC5A 5EAPA 4J73A 2Z2PA 4A0BB 4J84A 3RSEC 4CZXA 5I5IA 1PGUA 4A11A 2IWKA 4A08B 2H47A 2YNNA 4N14A 4D0KA 3DM0A 5KDOB 3N0DA 1PEVA 5TEFA 3UKRC 4U1EI 5SXMA 4MK0B 3PSLA 5IJ7E 4J79A 1L0QA 4GMBA 2HJBA 4ERQA 3BG1A 4ZOZA 4JSPC 4I79A 5GXIA 2YB8B 1YFQA 2J56H 1NR0A 2PM7B 5CYKA 3RFGA 3U4YA 3JZNA 4JT5C 4A0AA 4FB1D 4GQ1A 3IKOA 2HKRA 4X3EA 3I8EA 4E5ZA 2HXCA 1B9YA 1NEXB 3OKWA 2PBIB 3A0FA 4PBZA 1MG3A 3MZKA 3AL9A 3JB9L 1ERJA 5K1CC 3SBQA 2XYIA 4GM8A 3F3FA 2H6NA 3GREA 4GM3A 3C5MA 4L3HD 4E54B 3J81g 2CN2A 2PM9B 5FQDA 5EMLB 4J78A 4AEZA 3F3GA 1VYHC 3N0EA 4JD2C 4O3UB 5GMKn 4XEIC 4FAVD 4FA1D 5CXBB 2PM6B 1MG2A 4J81A 3V5WB 3I7HA 4IMMA 3EI4A 4GGCA 4PSXB 4LGNA 4H5IA 3AH8B 4U7AA 4FWWA 3PE7A 2AGZA 4EWRA 1MDAH 3UVKA 1JOFA 3UVOA 3JPXA 4XYIA 1P22A 3L4OD 1FWXA 5HE3B 2I0SA 2QXVA 5HE1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYE A;  3FRX A;  4CI8 A;  5HE0 B;  1XKS A;  3L4M D;  2CO0 A;  5TEE A;  5EAR A;  5JWZ A;  3VGZ A;  1XIP A;  3UR4 A;  2XL2 A;  3JZH A;  3FGB A;  4FHL A;  5CXC A;  2I0T A;  2B5M A;  2IAA A;  3MZL A;  3ULE C;  2UZX B;  4J8G A;  1OMW B;  3EU7 A;  1N6F A;  5C2W B;  4ZOY A;  3UVL A;  1Q47 A;  4A2M A;  3E0C A;  3I7P A;  3SBP A;  2H13 A;  2TRC B;  2Z2N A;  3UVN A;  2BCJ B;  3NVN A;  3RFH A;  3OL2 B;  3DSM A;  4A2L A;  4K3J B;  3ZWL B;  4X63 B;  4CZV A;  5FLX g;  4CZY A;  3BG0 A;  5A2Q g;  4GZ8 A;  2CE8 A;  3I89 A;  2HJ4 A;  3AL8 B;  3EI1 B;  3K27 A;  5I5J A;  3VH0 A;  1N6E A;  2OJY A;  3SXT D;  3RRM C;  3MKQ A;  2AH1 A;  4PC0 A;  2G9A A;  5FKR A;  3SMR A;  1R5M A;  5AJA A;  3ORV D;  2GNQ A;  2IUQ A;  2H9N A;  1U2V C;  2O9K A;  5C2V B;  1K32 A;  3I8C A;  3MKS B;  4A09 A;  3I2N A;  2AH0 A;  4CY2 A;  2P9K C;  4X61 B;  1GG2 B;  2PM9 A;  4O3T B;  4ES0 A;  4YVD A;  4CC9 A;  3CFV A;  4ESG A;  3IJC A;  3OTT A;  5CXB A;  5IT9 g;  5EMK B;  5H17 A;  5IGO A;  4J82 A;  4PXW A;  3DXK C;  1QNI A;  3BWS A;  2XU7 A;  4L9O A;  5C9Z B;  3EWE A;  3UKU C;  5GSA A;  3PXW D;  4L3G D;  3SHF A;  3F3P A;  3EI3 B;  4GQ2 P;  2J57 G;  3IIW A;  2IUV A;  4BL0 A;  4JSX C;  2OK6 A;  3NVQ A;  2Q7Q A;  3J80 g;  4H5J A;  3RN1 D;  5FKS A;  1U4C A;  3I7K A;  1GXR A;  4OWR A;  5EAL A;  3KRW B;  1A0R B;  1XHM A;  3JRP A;  3I7N A;  3JZG A;  4HDJ A;  3PXT D;  2BBK H;  2CO0 C;  2IWF A;  3I7L A;  3VA6 A;  3EI2 A;  2GC7 A;  3CFS B;  5H14 A;  3KRX B;  4FA9 D;  2CNX A;  3OL2 A;  5FXY A;  4J0W A;  2I0R A;  4J87 A;  4A0B A;  1JJU B;  4QT8 A;  2H6Q A;  3IJ0 A;  2P9L C;  2B5N A;  1S4U X;  2OVR B;  4JSV C;  5H1M A;  4A08 A;  3PVU B;  2H6K A;  2YNP A;  3SFZ A;  5THA A;  5TDH B;  3EI1 A;  2YNO A;  1N6D A;  3I7O A;  4O9D A;  4Y7R A;  4GM9 A;  2H3X A;  2YMU A;  3SLE D;  4FAN D;  3FM0 A;  2H9P A;  3C9C A;  3PVW B;  2B4E A;  3SJL D;  4ZOV A;  3B7F A;  4O45 A;  5EAM A;  2H68 A;  3HFQ A;  3IIY A;  4PBY A;  4J8B A;  3OKY B;  5IC7 A;  3RLM D;  3C75 H;  5FKT A;  1TBG A;  4FA4 D;  5CXC B;  1TYQ C;  4AOW A;  5EMJ B;  5I5M A;  4K3I D;  4JT6 C;  4BH6 A;  4LG9 A;  1JMZ B;  5HYN B;  4A7J A;  5IJ8 E;  3EMH A;  4QL1 A;  2G99 A;  1RI6 A;  2CE9 A;  5FKQ A;  2GC4 A;  3OKT A;  4JSN C;  4CY3 A;  4ZN4 A;  4E54 A;  3PSC B;  5EM2 B;  4CI1 A;  4XYH A;  3EI3 A;  4LG8 A;  4A11 B;  2EBS A;  1SQ9 A;  3GFC A;  2HES X;  2OVQ B;  2Z2O A;  1PI6 A;  5B4W A;  3V9F A;  5K19 A;  3SBR A;  5TF2 A;  3RMZ D;  3MMY A;  2P9I C;  4UI9 R;  3W15 A;  4NSX A;  2I3S A;  4CY5 A;  2HKM A;  4JXM A;  4Y5R D;  4ERY A;  5AFU 3;  1SHY B;  2AGL A;  2H9M A;  3ODT A;  5CYK B;  3JRO A;  4A0A B;  2OVP B;  4A09 B;  3DXM C;  4CI3 A;  3SWS D;  2P9P C;  1GP2 B;  4IA9 A;  4CI2 A;  3NVX A;  4E5Z B;  4J77 A;  5HQG A;  2IUR A;  4O1Q D;  2W18 A;  2AQ5 A;  4J0X A;  3DWL C;  3JAM g;  4ZOX A;  3AFC A;  1OLZ A;  3RN0 D;  2P9N C;  4TZ4 A;  2UZY B;  3K26 A;  4R7A B;  3EG6 A;  3V7D B;  5EMM B;  3C99 A;  2AGY A;  4PNK B;  2P9S C;  3SCY A;  1PBY B;  2H9L A;  2YBA A;  2OK4 A;  4GGD A;  2AGX A;  2AGW A;  4GQB B;  4X60 B;  2B5L A;  4PSW B;  4CY1 A;  2OIZ A;  2H14 A;  1B9X A;  2P9U C;  4QQE A;  3SVW D;  3EI4 B;  3OW8 A;  2XL3 A;  5GXH A;  3AL8 A;  4GGA A;  1GOT B;  5AMS A;  4FA5 D;  3OKY A;  4ERZ A;  4L1Q D;  4Z8L A;  2I3T A;  5HE2 B;  5IGQ A;  2CN3 A;  4G56 B;  4KFM B;  3UVM A;  2MTA H;  3PXS D;  3MXX A;  4D6V A;  1K8K C;  3CIK B;  4J86 A;  4QRJ A;  4OZU A;  1JMX B;  3IJ1 A;  4BUJ C;  3EI2 B;  3P4F A;  1SQJ A;  5EM2 A;  3SN6 B;  5FA5 B;  2J55 H;  2IUP A;  2QC5 A;  5EAP A;  4J73 A;  2Z2P A;  4A0B B;  4J84 A;  3RSE C;  4CZX A;  5I5I A;  1PGU A;  4A11 A;  2IWK A;  4A08 B;  2H47 A;  2YNN A;  4N14 A;  4D0K A;  3DM0 A;  5KDO B;  3N0D A;  1PEV A;  5TEF A;  3UKR C;  4U1E I;  5SXM A;  4MK0 B;  3PSL A;  5IJ7 E;  4J79 A;  1L0Q A;  4GMB A;  2HJB A;  4ERQ A;  3BG1 A;  4ZOZ A;  4JSP C;  4I79 A;  5GXI A;  2YB8 B;  1YFQ A;  2J56 H;  1NR0 A;  2PM7 B;  5CYK A;  3RFG A;  3U4Y A;  3JZN A;  4JT5 C;  4A0A A;  4FB1 D;  4GQ1 A;  3IKO A;  2HKR A;  4X3E A;  3I8E A;  4E5Z A;  2HXC A;  1B9Y A;  1NEX B;  3OKW A;  2PBI B;  3A0F A;  4PBZ A;  1MG3 A;  3MZK A;  3AL9 A;  3JB9 L;  1ERJ A;  5K1C C;  3SBQ A;  2XYI A;  4GM8 A;  3F3F A;  2H6N A;  3GRE A;  4GM3 A;  3C5M A;  4L3H D;  4E54 B;  3J81 g;  2CN2 A;  2PM9 B;  5FQD A;  5EML B;  4J78 A;  4AEZ A;  3F3G A;  1VYH C;  3N0E A;  4JD2 C;  4O3U B;  5GMK n;  4XEI C;  4FAV D;  4FA1 D;  5CXB B;  2PM6 B;  1MG2 A;  4J81 A;  3V5W B;  3I7H A;  4IMM A;  3EI4 A;  4GGC A;  4PSX B;  4LGN A;  4H5I A;  3AH8 B;  4U7A A;  4FWW A;  3PE7 A;  2AGZ A;  4EWR A;  1MDA H;  3UVK A;  1JOF A;  3UVO A;  3JPX A;  4XYI A;  1P22 A;  3L4O D;  1FWX A;  5HE3 B;  2I0S A;  2QXV A;  5HE1 B; 
#chains in the Genus database with same CATH topology
 4NEN A;  2HYE A;  1E8M A;  3FRX A;  4CI8 A;  5HE0 B;  1XKS A;  3L4M D;  2CO0 A;  5TEE A;  5EAR A;  5JWZ A;  3VGZ A;  1XIP A;  5FFO A;  3UR4 A;  2XL2 A;  3JZH A;  3FGB A;  4FHL A;  5CXC A;  2I0T A;  2B5M A;  2IAA A;  3MZL A;  3T3P A;  3ULE C;  2UZX B;  4NBM A;  4J8G A;  1OMW B;  3EU7 A;  1N6F A;  5C2W B;  3ZE2 A;  4ZOY A;  4JHN A;  3UVL A;  1Q47 A;  4A2M A;  3E0C A;  3I7P A;  3SBP A;  2H13 A;  4WK2 A;  4AN1 A;  1VE6 A;  2TRC B;  2Z2N A;  1GOH A;  3UVN A;  2BCJ B;  3QI0 A;  3MUO A;  3NVN A;  3RFH A;  1H2Y A;  3OF7 A;  4MMX A;  3OL2 B;  2JKX A;  3DSM A;  3QHY B;  2VDQ A;  4A2L A;  4BP9 A;  4K3J B;  3ZWL B;  4X63 B;  4CZV A;  5FLX g;  4CZY A;  3BG0 A;  5A2Q g;  4GZ8 A;  2CE8 A;  3I89 A;  2HJ4 A;  3AL8 B;  1E5T A;  3EI1 B;  3K27 A;  5I5J A;  3VH0 A;  2VDO A;  4L1M A;  1N6E A;  2OJY A;  3MUN A;  3O4G A;  3SXT D;  3RRM C;  1JV2 A;  3MKQ A;  2AH1 A;  4PC0 A;  2G9A A;  5FKR A;  3SMR A;  2VZ1 A;  1R5M A;  5AJA A;  1U8C A;  2QR5 A;  3ORV D;  2GNQ A;  2IUQ A;  2H9N A;  2XZG A;  4O2W A;  1U2V C;  2O9K A;  5C2V B;  1K32 A;  3I8C A;  3MKS B;  4A09 A;  3I2N A;  2AH0 A;  3ZDZ A;  4CY2 A;  2P9K C;  3NID A;  3ZDY A;  4X61 B;  1GG2 B;  2PM9 A;  3KCI A;  4O3T B;  1VZ3 A;  4ES0 A;  4YVD A;  4CC9 A;  3CFV A;  4ESG A;  3IJC A;  3OTT A;  5CXB A;  5IT9 g;  5EMK B;  5H17 A;  5IGO A;  4J82 A;  4PXW A;  3DXK C;  1QNI A;  2XE4 A;  3BWS A;  2EID A;  4Z7Q A;  2XU7 A;  4L9O A;  5C9Z B;  2WQ8 A;  3EWE A;  3UKU C;  2VDN A;  5GSA A;  3PXW D;  4L3G D;  3SHF A;  3F3P A;  3EI3 B;  1QFM A;  2XDW A;  4GQ2 P;  2J57 G;  3IIW A;  2IUV A;  1VZ2 A;  3O4H A;  2HU5 A;  4BL0 A;  4JSX C;  4MMY A;  2OK6 A;  3NVQ A;  2Q7Q A;  3K72 A;  3J80 g;  3O4J A;  4H5J A;  3RN1 D;  4BCB A;  5FKS A;  1U4C A;  3I7K A;  1GXR A;  3IJE A;  4OWR A;  5EAL A;  3KRW B;  1A0R B;  1XHM A;  3JRP A;  3I7N A;  1I2M B;  3K71 A;  3JZG A;  4HDJ A;  5M5R A;  3PXT D;  2BBK H;  2CO0 C;  2IWF A;  4UM9 A;  4BCC A;  3I7L A;  3VA6 A;  3EI2 A;  2GC7 A;  3CFS B;  5H14 A;  3KRX B;  4FA9 D;  4BCD A;  2CNX A;  3OL2 A;  4DNU A;  5FXY A;  4J0W A;  2I0R A;  4J87 A;  4A0B A;  1JJU B;  3EQ8 A;  4QT8 A;  2VC2 A;  1C9I A;  2H6Q A;  3IJ0 A;  1VE7 A;  2EIC A;  2P9L C;  1S4U X;  2B5N A;  2OVR B;  4JSV C;  5H1M A;  4A08 A;  3PVU B;  2H6K A;  2YNP A;  3SFZ A;  5THA A;  5TDH B;  3EI1 A;  2YNO A;  1N6D A;  3GC3 B;  3I7O A;  4O9D A;  1GOF A;  3FCS A;  3IUN A;  4Y7R A;  1BPO A;  4GM9 A;  2EIE A;  1UOO A;  2H3X A;  3ZE0 A;  2YMU A;  3NIF A;  3SLE D;  4FAN D;  3FM0 A;  2H9P A;  3C9C A;  4RE5 A;  3PVW B;  5FFG A;  2B4E A;  3SJL D;  4ZOV A;  1T2X A;  3B7F A;  4O45 A;  5EAM A;  2H68 A;  3HFQ A;  3IIY A;  4PBY A;  4J8B A;  3OKY B;  5IC7 A;  3RLM D;  2VDL A;  3C75 H;  5FKT A;  4NC4 A;  1TBG A;  4FA4 D;  3MVD K;  5CXC B;  1M1X A;  1TYQ C;  4Z7O A;  4AOW A;  5EMJ B;  5I5M A;  4K3I D;  4JT6 C;  3VI3 A;  4BH6 A;  4LG9 A;  1JMZ B;  5HYN B;  1A12 A;  4A7J A;  5IJ8 E;  1GOG A;  2VDP A;  3EMH A;  2VDM A;  4QL1 A;  2G99 A;  1RI6 A;  2CE9 A;  5FKQ A;  2GC4 A;  3OKT A;  4BP8 A;  4JSN C;  4CY3 A;  4ZN4 A;  4E54 A;  3PSC B;  5EM2 B;  4CI1 A;  4XYH A;  1UTC A;  2EIB A;  3EI3 A;  4AX4 A;  4LG8 A;  3FCU A;  4A11 B;  2EBS A;  4WJK A;  1C9L A;  1SQ9 A;  3GFC A;  2HES X;  4JHP C;  5HDB A;  4AMZ A;  2OVQ B;  2Z2O A;  1PI6 A;  5B4W A;  3V9F A;  5K19 A;  3SBR A;  5TF2 A;  3RMZ D;  3MMY A;  2P9I C;  4UI9 R;  3W15 A;  1E8N A;  4NSX A;  2I3S A;  4CY5 A;  1H2W A;  2HKM A;  4IRZ A;  4JXM A;  4Y5R D;  4ERY A;  1JTD B;  5AFU 3;  1SHY B;  3VI4 A;  2AGL A;  3IUQ A;  2H9M A;  3ODT A;  5CYK B;  3JRO A;  4AN0 A;  4A0A B;  2OVP B;  5M5T A;  4A09 B;  3DXM C;  4CI3 A;  3DDU A;  3SWS D;  2P9P C;  1GP2 B;  4IA9 A;  4CI2 A;  3NVX A;  3IUJ A;  4E5Z B;  4J77 A;  3IUM A;  2IUR A;  5HQG A;  2VZ3 A;  5M61 A;  4O1Q D;  2W18 A;  2AQ5 A;  4J0X A;  3DWL C;  3JAM g;  4ZOX A;  1TYE A;  3AFC A;  1OLZ A;  4O02 A;  5M5U A;  2HU8 A;  1H2X A;  3RN0 D;  2P9N C;  4TZ4 A;  2UZY B;  3K26 A;  4R7A B;  3EG6 A;  3V7D B;  5EMM B;  5M5V A;  3C99 A;  2AGY A;  4PNK B;  2P9S C;  3IUL A;  3SCY A;  1PBY B;  2H9L A;  5E6R A;  2YBA A;  2OK4 A;  4GGD A;  2AGX A;  2AGW A;  4GQB B;  4X60 B;  2B5L A;  4PSW B;  4UM8 A;  4CY1 A;  2OIZ A;  1O6F A;  2HU7 A;  2H14 A;  1B9X A;  2P9U C;  4QQE A;  3SVW D;  3EI4 B;  1O6G A;  3OW8 A;  2XL3 A;  5GXH A;  3AL8 A;  4GGA A;  1GOT B;  4QAM A;  5AMS A;  4FA5 D;  3OKY A;  3NIG A;  3ZE1 A;  4ERZ A;  4L1Q D;  4Z8L A;  2I3T A;  5C92 A;  5HE2 B;  4DNV A;  5IGQ A;  3IUR A;  2CN3 A;  5E6U A;  4G56 B;  4KFM B;  2BKL A;  3UVM A;  2MTA H;  3PXS D;  4NAA A;  3MXX A;  4D6V A;  1K8K C;  3CIK B;  4J86 A;  4QRJ A;  4OZU A;  1JMX B;  3IJ1 A;  4BUJ C;  3EI2 B;  1QFS A;  3P4F A;  4G1M A;  1SQJ A;  5EM2 A;  3SN6 B;  5FA5 B;  2J55 H;  2IUP A;  2QC5 A;  5EAP A;  4J73 A;  2Z2P A;  3T3M A;  4A0B B;  1L5G A;  4J84 A;  3ZDX A;  3RSE C;  4CZX A;  1YR2 A;  5E6S A;  5I5I A;  1PGU A;  4G1E A;  4A11 A;  2IWK A;  4A08 B;  2H47 A;  2YNN A;  2QZP A;  4N14 A;  3DM0 A;  4D0K A;  5KDO B;  3N0D A;  1PEV A;  5TEF A;  3UKR C;  3V4V A;  4G55 A;  4U1E I;  5SXM A;  4MK0 B;  3PSL A;  5IJ7 E;  5M5S A;  4J79 A;  1UOP A;  1L0Q A;  4GMB A;  2HJB A;  4ERQ A;  3BG1 A;  4ZOZ A;  4DNW A;  4JSP C;  4I79 A;  5GXI A;  2YB8 B;  1YFQ A;  2J56 H;  1NR0 A;  2PM7 B;  3GD1 I;  5CYK A;  3RFG A;  3U4Y A;  3JZN A;  4JT5 C;  4A0A A;  4FB1 D;  4GQ1 A;  3IKO A;  4D9S A;  2HKR A;  4X3E A;  3IVM A;  4Z7N A;  3I8E A;  4E5Z A;  2HXC A;  1B9Y A;  1NEX B;  3OKW A;  2PBI B;  3A0F A;  4PBZ A;  1MG3 A;  4MMZ A;  3MZK A;  3AL9 A;  3JB9 L;  1ERJ A;  5K1C C;  2VDR A;  3SBQ A;  2XYI A;  4GM8 A;  3F3F A;  4WK4 A;  2H6N A;  3GRE A;  3EQ7 A;  4GM3 A;  4RE6 A;  3C5M A;  4L3H D;  4E54 B;  3J81 g;  2CN2 A;  2PM9 B;  5FQD A;  3K6S A;  5EML B;  4J78 A;  4AEZ A;  3F3G A;  1VYH C;  3N0E A;  4JD2 C;  4O3U B;  5GMK n;  4XEI C;  4FAV D;  4FA1 D;  5CXB B;  2PM6 B;  4AMY A;  1MG2 A;  4J81 A;  3V4P A;  3V5W B;  3I7H A;  4IMM A;  1UOQ A;  3EQ9 A;  3EI4 A;  3O4I A;  4GGC A;  1K3I A;  4PSX B;  4WK0 A;  4LGN A;  4H5I A;  3AH8 B;  4U7A A;  5C86 A;  4FWW A;  3PE7 A;  2AGZ A;  4EWR A;  1MDA H;  3UVK A;  1JOF A;  3UVO A;  3JPX A;  4XYI A;  1P22 A;  3L4O D;  1H2Z A;  1FWX A;  5HE3 B;  2I0S A;  2VDK A;  2QXV A;  5HE1 B; 
#chains in the Genus database with same CATH homology
 2HYE A;  3FRX A;  4CI8 A;  5HE0 B;  1XKS A;  3L4M D;  2CO0 A;  5TEE A;  5EAR A;  5JWZ A;  3VGZ A;  1XIP A;  3UR4 A;  2XL2 A;  3JZH A;  3FGB A;  4FHL A;  5CXC A;  2I0T A;  2B5M A;  2IAA A;  3MZL A;  3ULE C;  2UZX B;  4J8G A;  1OMW B;  3EU7 A;  1N6F A;  5C2W B;  4ZOY A;  3UVL A;  1Q47 A;  4A2M A;  3E0C A;  3I7P A;  3SBP A;  2H13 A;  2TRC B;  2Z2N A;  3UVN A;  2BCJ B;  3NVN A;  3RFH A;  3OL2 B;  3DSM A;  4A2L A;  4K3J B;  3ZWL B;  4X63 B;  4CZV A;  5FLX g;  4CZY A;  3BG0 A;  5A2Q g;  4GZ8 A;  2CE8 A;  3I89 A;  2HJ4 A;  3AL8 B;  3EI1 B;  3K27 A;  5I5J A;  3VH0 A;  1N6E A;  2OJY A;  3SXT D;  3RRM C;  3MKQ A;  2AH1 A;  4PC0 A;  2G9A A;  5FKR A;  3SMR A;  1R5M A;  5AJA A;  3ORV D;  2GNQ A;  2IUQ A;  2H9N A;  1U2V C;  2O9K A;  5C2V B;  1K32 A;  3I8C A;  3MKS B;  4A09 A;  3I2N A;  2AH0 A;  4CY2 A;  2P9K C;  4X61 B;  1GG2 B;  2PM9 A;  4O3T B;  4ES0 A;  4YVD A;  4CC9 A;  3CFV A;  4ESG A;  3IJC A;  3OTT A;  5CXB A;  5IT9 g;  5EMK B;  5H17 A;  5IGO A;  4J82 A;  4PXW A;  3DXK C;  1QNI A;  3BWS A;  2XU7 A;  4L9O A;  5C9Z B;  3EWE A;  3UKU C;  5GSA A;  3PXW D;  4L3G D;  3SHF A;  3F3P A;  3EI3 B;  4GQ2 P;  2J57 G;  3IIW A;  2IUV A;  4BL0 A;  4JSX C;  2OK6 A;  3NVQ A;  2Q7Q A;  3J80 g;  4H5J A;  3RN1 D;  5FKS A;  1U4C A;  3I7K A;  1GXR A;  4OWR A;  5EAL A;  3KRW B;  1A0R B;  1XHM A;  3JRP A;  3I7N A;  3JZG A;  4HDJ A;  3PXT D;  2BBK H;  2CO0 C;  2IWF A;  3I7L A;  3VA6 A;  3EI2 A;  2GC7 A;  3CFS B;  5H14 A;  3KRX B;  4FA9 D;  2CNX A;  3OL2 A;  5FXY A;  4J0W A;  2I0R A;  4J87 A;  4A0B A;  1JJU B;  4QT8 A;  2H6Q A;  3IJ0 A;  2P9L C;  2B5N A;  1S4U X;  2OVR B;  4JSV C;  5H1M A;  4A08 A;  3PVU B;  2H6K A;  2YNP A;  3SFZ A;  5THA A;  5TDH B;  3EI1 A;  2YNO A;  1N6D A;  3I7O A;  4O9D A;  4Y7R A;  4GM9 A;  2H3X A;  2YMU A;  3SLE D;  4FAN D;  3FM0 A;  2H9P A;  3C9C A;  3PVW B;  2B4E A;  3SJL D;  4ZOV A;  3B7F A;  4O45 A;  5EAM A;  2H68 A;  3HFQ A;  3IIY A;  4PBY A;  4J8B A;  3OKY B;  5IC7 A;  3RLM D;  3C75 H;  5FKT A;  1TBG A;  4FA4 D;  5CXC B;  1TYQ C;  4AOW A;  5EMJ B;  5I5M A;  4K3I D;  4JT6 C;  4BH6 A;  4LG9 A;  1JMZ B;  5HYN B;  4A7J A;  5IJ8 E;  3EMH A;  4QL1 A;  2G99 A;  1RI6 A;  2CE9 A;  5FKQ A;  2GC4 A;  3OKT A;  4JSN C;  4CY3 A;  4ZN4 A;  4E54 A;  3PSC B;  5EM2 B;  4CI1 A;  4XYH A;  3EI3 A;  4LG8 A;  4A11 B;  2EBS A;  1SQ9 A;  3GFC A;  2HES X;  2OVQ B;  2Z2O A;  1PI6 A;  5B4W A;  3V9F A;  5K19 A;  3SBR A;  5TF2 A;  3RMZ D;  3MMY A;  2P9I C;  4UI9 R;  3W15 A;  4NSX A;  2I3S A;  4CY5 A;  2HKM A;  4JXM A;  4Y5R D;  4ERY A;  5AFU 3;  1SHY B;  2AGL A;  2H9M A;  3ODT A;  5CYK B;  3JRO A;  4A0A B;  2OVP B;  4A09 B;  3DXM C;  4CI3 A;  3SWS D;  2P9P C;  1GP2 B;  4IA9 A;  4CI2 A;  3NVX A;  4E5Z B;  4J77 A;  5HQG A;  2IUR A;  4O1Q D;  2W18 A;  2AQ5 A;  4J0X A;  3DWL C;  3JAM g;  4ZOX A;  3AFC A;  1OLZ A;  3RN0 D;  2P9N C;  4TZ4 A;  2UZY B;  3K26 A;  4R7A B;  3EG6 A;  3V7D B;  5EMM B;  3C99 A;  2AGY A;  4PNK B;  2P9S C;  3SCY A;  1PBY B;  2H9L A;  2YBA A;  2OK4 A;  4GGD A;  2AGX A;  2AGW A;  4GQB B;  4X60 B;  2B5L A;  4PSW B;  4CY1 A;  2OIZ A;  2H14 A;  1B9X A;  2P9U C;  4QQE A;  3SVW D;  3EI4 B;  3OW8 A;  2XL3 A;  5GXH A;  3AL8 A;  4GGA A;  1GOT B;  5AMS A;  4FA5 D;  3OKY A;  4ERZ A;  4L1Q D;  4Z8L A;  2I3T A;  5HE2 B;  5IGQ A;  2CN3 A;  4G56 B;  4KFM B;  3UVM A;  2MTA H;  3PXS D;  3MXX A;  4D6V A;  1K8K C;  3CIK B;  4J86 A;  4QRJ A;  4OZU A;  1JMX B;  3IJ1 A;  4BUJ C;  3EI2 B;  3P4F A;  1SQJ A;  5EM2 A;  3SN6 B;  5FA5 B;  2J55 H;  2IUP A;  2QC5 A;  5EAP A;  4J73 A;  2Z2P A;  4A0B B;  4J84 A;  3RSE C;  4CZX A;  5I5I A;  1PGU A;  4A11 A;  2IWK A;  4A08 B;  2H47 A;  2YNN A;  4N14 A;  4D0K A;  3DM0 A;  5KDO B;  3N0D A;  1PEV A;  5TEF A;  3UKR C;  4U1E I;  5SXM A;  4MK0 B;  3PSL A;  5IJ7 E;  4J79 A;  1L0Q A;  4GMB A;  2HJB A;  4ERQ A;  3BG1 A;  4ZOZ A;  4JSP C;  4I79 A;  5GXI A;  2YB8 B;  1YFQ A;  2J56 H;  1NR0 A;  2PM7 B;  5CYK A;  3RFG A;  3U4Y A;  3JZN A;  4JT5 C;  4A0A A;  4FB1 D;  4GQ1 A;  3IKO A;  2HKR A;  4X3E A;  3I8E A;  4E5Z A;  2HXC A;  1B9Y A;  1NEX B;  3OKW A;  2PBI B;  3A0F A;  4PBZ A;  1MG3 A;  3MZK A;  3AL9 A;  3JB9 L;  1ERJ A;  5K1C C;  3SBQ A;  2XYI A;  4GM8 A;  3F3F A;  2H6N A;  3GRE A;  4GM3 A;  3C5M A;  4L3H D;  4E54 B;  3J81 g;  2CN2 A;  2PM9 B;  5FQD A;  5EML B;  4J78 A;  4AEZ A;  3F3G A;  1VYH C;  3N0E A;  4JD2 C;  4O3U B;  5GMK n;  4XEI C;  4FAV D;  4FA1 D;  5CXB B;  2PM6 B;  1MG2 A;  4J81 A;  3V5W B;  3I7H A;  4IMM A;  3EI4 A;  4GGC A;  4PSX B;  4LGN A;  4H5I A;  3AH8 B;  4U7A A;  4FWW A;  3PE7 A;  2AGZ A;  4EWR A;  1MDA H;  3UVK A;  1JOF A;  3UVO A;  3JPX A;  4XYI A;  1P22 A;  3L4O D;  1FWX A;  5HE3 B;  2I0S A;  2QXV A;  5HE1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...