4BH6A

Insights into degron recognition by apc coactivators from the structure of an acm1-cdh1 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
304
structure length
304
Chain Sequence
RQIAKVPYRVLDAPSLADDFYYSLIDWSSTDVLAVALGKSIFLTDNNTGDVVHLCDTENEYTSLSWIGAGSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APC/C ACTIVATOR PROTEIN CDH1
publication title Insights Into Degron Recognition by Apc/C Coactivators from the Structure of an Acm1-Cdh1 Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 88
structure length 304
sequence length 304
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4bh6A00
4D0KA 2IWFA 4O3UB 4BL0A 4JT6C 2XYIA 3SXTD 5TDHB 2H68A 4XEIC 3F3PA 3HFQA 3UVLA 2XL3A 3JROA 4ZOYA 3V7DB 3ULEC 2HKMA 2P9LC 3CIKB 2H9PA 3MKQA 3PVWB 5CYKA 3SFZA 3I7LA 2B5NA 4YVDA 2CO0A 3C5MA 4G56B 2P9NC 4L1QD 3OTTA 4J78A 4E5ZA 4ZN4A 5I5IA 3SHFA 2PM9A 5AMSA 4BH6A 4D6VA 3JAMg 4E54B 4GGCA 5IJ7E 4A0BA 3RFHA 3OKYA 4CZVA 3JRPA 2H9LA 4A2MA 2P9UC 3JZHA 4Y5RD 3AFCA 3IIYA 1K32A 3C99A 3KRXB 5B4WA 4I79A 3OL2A 4J82A 4QL1A 2Z2NA 5HE1B 2CN3A 4OWRA 2CE9A 3SLED 5I5MA 3SBPA 4FHLA 5EAPA 4CY5A 4JT5C 3EI1B 4PC0A 1B9XA 2Z2PA 3DSMA 2H6QA 4X60B 2G99A 4MK0B 4A09B 3C75H 4J73A 5IC7A 2HYEA 3EMHA 2OJYA 4A2LA 4J8GA 4O9DA 4L9OA 1U4CA 4OZUA 5EMKB 3B7FA 5IGOA 4A08A 5EMLB 5TF2A 2I0TA 2IUVA 4GQ2P 3IJ0A 1JMZB 3EI2A 3V5WB 3U4YA 4CY3A 1SHYB 2HKRA 3IKOA 4GQ1A 2B5MA 4A0AA 1TBGA 2CN2A 4JSNC 2Z2OA 1XIPA 1NR0A 3JZNA 4CI1A 4ERYA 5HQGA 4KFMB 2H9MA 3DM0A 4FB1D 2CE8A 2QC5A 2YB8B 3DXMC 3RFGA 1GG2B 3EI3A 5THAA 4PNKB 4R7AB 3UVNA 4ES0A 4U7AA 3I7PA 5FKRA 2I0RA 3SCYA 2CO0C 1GOTB 1B9YA 2H6NA 3N0DA 2AH1A 2TRCB 4PSWB 3I7OA 2PBIB 4J0WA 5H14A 4AOWA 4JSPC 2YNOA 2BBKH 5EARA 4A11B 2H3XA 5IJ8E 4O3TB 3AL9A 4CI2A 3SBQA 4FAVD 5H1MA 4FWWA 3W15A 5AJAA 4CI3A 2P9IC 4U1EI 3BG1A 3SVWD 5A2Qg 3OKTA 2YMUA 4O45A 2OVQB 4X61B 2YNPA 2HESX 5FKQA 3MMYA 4GQBB 1A0RB 2BCJB 3GREA 3EI4A 5EM2B 2J57G 4J77A 4O1QD 3N0EA 4X3EA 1N6DA 3AL8A 1GP2B 2PM7B 3MZLA 3VH0A 3GFCA 2H6KA 4K3JB 3PXTD 4JSVC 3UVMA 5CXBB 1XHMA 2J55H 2UZXB 5CXCB 3FRXA 1MG3A 4IA9A 3DWLC 4CY2A 2AGXA 3JB9L 2Q7QA 1NEXB 1N6FA 3PE7A 5HE3B 2H14A 3UVKA 4PBYA 5IGQA 5C2WB 3OKWA 3IJCA 5C9ZB 3MKSB 2AGZA 5HE0B 5TEFA 3NVXA 5C2VB 4J0XA 3I8EA 5CYKB 3V9FA 3K27A 1OMWB 1XKSA 2IUQA 3L4MD 1PGUA 4HDJA 4ZOZA 2OK4A 3PXSD 5SXMA 3ZWLB 4E5ZB 2HJ4A 4J86A 1OLZA 2PM9B 3FM0A 3J81g 4H5JA 4FAND 3SN6B 4X63B 3NVNA 4A0BB 3BG0A 3UVOA 3F3FA 3SMRA 3OKYB 1PEVA 2P9KC 3F3GA 2YBAA 4LG8A 1PI6A 3JPXA 5I5JA 1YFQA 3E0CA 4E54A 3OL2B 3I7NA 2PM6B 2QXVA 2H47A 5K19A 5FLXg 3EU7A 3UKUC 1FWXA 4LG9A 3ODTA 5JWZA 4L3HD 3VA6A 2CNXA 4UI9R 3JZGA 4QT8A 2XL2A 3MXXA 4XYIA 5FXYA 1MG2A 1JJUB 2W18A 1ERJA 2P9SC 3L4OD 4EWRA 3J80g 3EI1A 1PBYB 1R5MA 4A08B 4A09A 3P4FA 3EI2B 4CZYA 3NVQA 2AH0A 4A0AB 3BWSA 4GM8A 3EG6A 3RN0D 4XYHA 5FKTA 2OK6A 3KRWB 3SJLD 5HE2B 4GZ8A 2IWKA 3SWSD 3UR4A 3ORVD 2GNQA 2H13A 4NSXA 3FGBA 4GGDA 4LGNA 3UKRC 3EI3B 5GXIA 4GM9A 2HJBA 5EMMB 4J87A 2GC7A 3RRMC 2HXCA 3I7HA 4IMMA 2I3TA 2AGWA 3MZKA 1QNIA 3PSLA 2OVPB 1S4UX 2AGLA 2G9AA 2H9NA 4CI8A 4J79A 2MTAH 4AEZA 5EAMA 1L0QA 4Y7RA 5AFU3 1RI6A 3IJ1A 5H17A 4J81A 4H5IA 4ESGA 3CFVA 1JOFA 1Q47A 2YNNA 3I8CA 2OIZA 3RN1D 2I0SA 3DXKC 3RMZD 3K26A 5FA5B 4N14A 4CY1A 4L3GD 4FA9D 2I3SA 2IUPA 5GSAA 3PXWD 3OW8A 4ERQA 4K3ID 4A11A 4CZXA 2AGYA 4FA4D 5FQDA 3I2NA 2XU7A 1K8KC 2B5LA 3I89A 4ZOXA 5TEEA 4GMBA 3RSEC 3EI4B 1SQJA 4QRJA 5EMJB 5IT9g 4PBZA 4ZOVA 3AL8B 2IAAA 4JXMA 1TYQC 3PVUB 4TZ4A 5GXHA 3SBRA 4PSXB 3VGZA 3CFSB 2P9PC 4J8BA 4PXWA 4ERZA 3I7KA 2J56H 4CC9A 4A7JA 2B4EA 4J84A 1U2VC 4QQEA 4Z8LA 5HYNB 5EM2A 5EALA 3A0FA 2OVRB 1GXRA 1P22A 5KDOB 2IURA 1N6EA 4GM3A 4JD2C 1VYHC 4JSXC 5GMKn 4FA5D 2GC4A 3RLMD 3EWEA 3IIWA 1MDAH 5K1CC 2O9KA 5FKSA 2UZYB 1SQ9A 3C9CA 4FA1D 1JMXB 5CXBA 4BUJC 3PSCB 5CXCA 2AQ5A 3AH8B 4GGAA 2EBSA
chains in the Genus database with same CATH superfamily
4D0KA 2IWFA 4O3UB 1A12A 4BL0A 4JT6C 2XYIA 3SXTD 5TDHB 2H68A 4XEIC 3F3PA 3HFQA 3FCUA 3UVLA 2XL3A 3JROA 4ZOYA 3V7DB 3ULEC 2HKMA 2P9LC 3CIKB 2H9PA 3MKQA 3PVWB 5CYKA 3SFZA 3IULA 5M5UA 4IRZA 3I7LA 2B5NA 1O6GA 4YVDA 2EIEA 2CO0A 3C5MA 4G56B 4UM8A 2P9NC 4D9SA 4L1QD 3OTTA 4J78A 4E5ZA 4ZN4A 5I5IA 3SHFA 2PM9A 5AMSA 4BH6A 4D6VA 3JAMg 4E54B 4RE6A 4GGCA 3ZE1A 5IJ7E 4A0BA 3RFHA 3OKYA 4CZVA 3JRPA 4L1MA 4AMZA 3OF7A 2H9LA 4A2MA 4AN0A 2P9UC 3JZHA 5C86A 4Y5RD 3AFCA 3IIYA 1K32A 3C99A 3KRXB 5B4WA 4I79A 3OL2A 4J82A 1E8MA 4QL1A 2Z2NA 5HE1B 3QI0A 2CN3A 4OWRA 2CE9A 3SLED 5I5MA 3SBPA 4FHLA 5EAPA 4CY5A 4JT5C 4Z7QA 3EI1B 1E8NA 4PC0A 1B9XA 2Z2PA 3DSMA 2H6QA 1QFMA 4X60B 2G99A 4MK0B 4A09B 3C75H 5M5TA 3IURA 4NAAA 4J73A 5M61A 5IC7A 2HYEA 3EMHA 2OJYA 3EQ8A 4A2LA 4J8GA 4DNWA 4O9DA 4L9OA 1U4CA 4OZUA 3MUNA 5EMKB 3EQ9A 3B7FA 5IGOA 4A08A 5EMLB 5TF2A 2I0TA 2IUVA 4GQ2P 3IJ0A 1JMZB 3IUJA 3V5WB 3EI2A 3EQ7A 3U4YA 4CY3A 2VZ1A 1SHYB 2HKRA 3IKOA 3K6SA 4GQ1A 2B5MA 4A0AA 1C9LA 1TBGA 2CN2A 4JSNC 2Z2OA 4NENA 1XIPA 3JZNA 1NR0A 4CI1A 4ERYA 5HQGA 2H9MA 3DM0A 4KFMB 2VC2A 4FB1D 2CE8A 2QC5A 1UOPA 2YB8B 3DXMC 3RFGA 2EIDA 1GG2B 3K72A 3EI3A 5THAA 4BCCA 3IUNA 4PNKB 4R7AB 3UVNA 4ES0A 4U7AA 4NC4A 2JKXA 3I7PA 5FKRA 2I0RA 3SCYA 2CO0C 1GOHA 4O2WA 1GOTB 3KCIA 1B9YA 2H6NA 3MVDK 3N0DA 2HU7A 4MMXA 1M1XA 1UTCA 2AH1A 5M5SA 2TRCB 4PSWB 3I7OA 1UOQA 3NIFA 3O4IA 2PBIB 4QAMA 4J0WA 4BP8A 1BPOA 5H14A 4AOWA 4JSPC 2YNOA 2BBKH 5EARA 4A11B 2H3XA 4G1MA 5IJ8E 4O3TB 3AL9A 4CI2A 3ZDZA 3SBQA 4FAVD 5H1MA 4FWWA 3ZE2A 3W15A 5AJAA 3O4GA 2VDNA 4CI3A 2P9IC 4U1EI 3BG1A 3SVWD 1U8CA 1JTDB 5A2Qg 3OKTA 3ZDYA 4Z7OA 2YMUA 4O45A 2OVQB 3QHYB 4X61B 2YNPA 4MMZA 2HESX 5FKQA 3MMYA 4GQBB 1A0RB 2BKLA 2BCJB 4G55A 3GREA 3EI4A 5EM2B 2J57G 4J77A 4NBMA 3N0EA 4O1QD 4X3EA 1N6DA 3AL8A 1GP2B 4MMYA 3ZDXA 2QR5A 3VI3A 2PM7B 3MZLA 3ZE0A 1T2XA 3VH0A 3GFCA 5FFOA 2H6KA 4K3JB 3PXTD 2EICA 4JSVC 2VDRA 2WQ8A 4JHNA 3UVMA 5CXBB 1XHMA 2J55H 2XZGA 2UZXB 3FRXA 5CXCB 1MG3A 4IA9A 3DWLC 4CY2A 2AGXA 2HU8A 3JB9L 2Q7QA 1NEXB 1N6FA 3PE7A 5HE3B 4WK4A 2H14A 2VZ3A 3UVKA 4AX4A 4PBYA 5IGQA 5C2WB 3IUQA 3OKWA 3IJCA 3DDUA 2XDWA 5C9ZB 1GOGA 3MKSB 2AGZA 5HE0B 5TEFA 3NVXA 5C2VB 4J0XA 3I8EA 5CYKB 3V9FA 3K27A 1OMWB 1XKSA 2IUQA 3L4MD 1PGUA 4HDJA 5HDBA 4ZOZA 2OK4A 3PXSD 5SXMA 3ZWLB 2VDOA 4E5ZB 2HJ4A 4J86A 3NIGA 1OLZA 2EIBA 2PM9B 3FM0A 3J81g 4BCDA 4H5JA 1O6FA 4FAND 1VE6A 3SN6B 4X63B 3NVNA 4A0BB 1E5TA 3BG0A 3UVOA 3F3FA 3SMRA 1YR2A 3GC3B 3OKYB 1PEVA 3T3PA 3T3MA 2P9KC 3F3GA 4AN1A 2YBAA 4LG8A 1PI6A 3JPXA 5I5JA 1YFQA 3E0CA 4E54A 3OL2B 3I7NA 2PM6B 2QXVA 2H47A 5K19A 5FLXg 3EU7A 3GD1I 3VI4A 3UKUC 1FWXA 1UOOA 4LG9A 3IJEA 4RE5A 3ODTA 5JWZA 4L3HD 3VA6A 2CNXA 4UI9R 3JZGA 4QT8A 2XL2A 3MXXA 4XYIA 5FXYA 1MG2A 1JJUB 2W18A 1ERJA 2P9SC 3L4OD 4EWRA 3J80g 3EI1A 1PBYB 1H2ZA 1R5MA 4A08B 4A09A 3P4FA 3EI2B 3MUOA 4CZYA 3K71A 3NVQA 4DNUA 1JV2A 2AH0A 4A0AB 3BWSA 4GM8A 3EG6A 3RN0D 4XYHA 5FKTA 2OK6A 3IUMA 3KRWB 1VZ2A 4AMYA 3SJLD 5HE2B 3O4JA 4GZ8A 2IWKA 3SWSD 3UR4A 2VDQA 2H13A 2GNQA 3ORVD 3V4PA 4NSXA 2VDMA 3FGBA 4GGDA 4LGNA 3UKRC 3EI3B 5GXIA 4GM9A 2HJBA 5EMMB 4J87A 2GC7A 3RRMC 2HXCA 3I7HA 4IMMA 1TYEA 5E6RA 2I3TA 2AGWA 3MZKA 1QNIA 3PSLA 2OVPB 1S4UX 2AGLA 4Z7NA 2G9AA 2H9NA 2QZPA 4CI8A 4BP9A 4J79A 2MTAH 4AEZA 1H2WA 5EAMA 1L0QA 4Y7RA 5AFU3 1H2YA 1RI6A 3IJ1A 5H17A 4J81A 4H5IA 4ESGA 1VE7A 3CFVA 3IVMA 5C92A 4JHPC 1JOFA 1Q47A 2YNNA 3I8CA 2OIZA 3RN1D 2I0SA 3DXKC 3RMZD 3K26A 4WK2A 5FA5B 4N14A 4CY1A 5M5VA 4L3GD 4O02A 4FA9D 2I3SA 4WK0A 2IUPA 4UM9A 5FFGA 5GSAA 3PXWD 3OW8A 4BCBA 4ERQA 4K3ID 4WJKA 2XE4A 4A11A 4CZXA 3O4HA 2AGYA 1H2XA 3FCSA 4FA4D 5FQDA 3I2NA 2XU7A 1QFSA 1K8KC 2B5LA 3I89A 1I2MB 4ZOXA 5TEEA 1C9IA 4GMBA 3RSEC 3EI4B 1SQJA 4QRJA 5EMJB 5IT9g 4PBZA 4ZOVA 3AL8B 2IAAA 1K3IA 4JXMA 1TYQC 3PVUB 4TZ4A 5GXHA 3SBRA 4PSXB 3V4VA 3VGZA 3CFSB 2P9PC 2VDPA 4J8BA 1VZ3A 4PXWA 3NIDA 2VDKA 4ERZA 3I7KA 2J56H 4CC9A 4A7JA 2B4EA 4J84A 1U2VC 4QQEA 4Z8LA 5HYNB 5EM2A 5EALA 1GOFA 2OVRB 3A0FA 1GXRA 1P22A 4G1EA 5KDOB 2IURA 2VDLA 1N6EA 4GM3A 4JD2C 4DNVA 1VYHC 4JSXC 5GMKn 4FA5D 2GC4A 1L5GA 3RLMD 3EWEA 3IIWA 1MDAH 5K1CC 2O9KA 5FKSA 2UZYB 3C9CA 1SQ9A 2HU5A 4FA1D 1JMXB 5CXBA 4BUJC 3PSCB 5CXCA 5E6UA 5E6SA 2AQ5A 3AH8B 5M5RA 4GGAA 2EBSA
chains in the Genus database with same CATH topology
4D0KA 2IWFA 4O3UB 4BL0A 4JT6C 2XYIA 3SXTD 5TDHB 2H68A 4XEIC 3F3PA 3HFQA 3UVLA 2XL3A 3JROA 4ZOYA 3V7DB 3ULEC 2HKMA 2P9LC 3CIKB 2H9PA 3MKQA 3PVWB 5CYKA 3SFZA 3I7LA 2B5NA 4YVDA 2CO0A 3C5MA 4G56B 2P9NC 4L1QD 3OTTA 4J78A 4E5ZA 4ZN4A 5I5IA 3SHFA 2PM9A 5AMSA 4BH6A 4D6VA 3JAMg 4E54B 4GGCA 5IJ7E 4A0BA 3RFHA 3OKYA 4CZVA 3JRPA 2H9LA 4A2MA 2P9UC 3JZHA 4Y5RD 3AFCA 3IIYA 1K32A 3C99A 3KRXB 5B4WA 4I79A 3OL2A 4J82A 4QL1A 2Z2NA 5HE1B 2CN3A 4OWRA 2CE9A 3SLED 5I5MA 3SBPA 4FHLA 5EAPA 4CY5A 4JT5C 3EI1B 4PC0A 1B9XA 2Z2PA 3DSMA 2H6QA 4X60B 2G99A 4MK0B 4A09B 3C75H 4J73A 5IC7A 2HYEA 3EMHA 2OJYA 4A2LA 4J8GA 4O9DA 4L9OA 1U4CA 4OZUA 5EMKB 3B7FA 5IGOA 4A08A 5EMLB 5TF2A 2I0TA 2IUVA 4GQ2P 3IJ0A 1JMZB 3EI2A 3V5WB 3U4YA 4CY3A 1SHYB 2HKRA 3IKOA 4GQ1A 2B5MA 4A0AA 1TBGA 2CN2A 4JSNC 2Z2OA 1XIPA 1NR0A 3JZNA 4CI1A 4ERYA 5HQGA 4KFMB 2H9MA 3DM0A 4FB1D 2CE8A 2QC5A 2YB8B 3DXMC 3RFGA 1GG2B 3EI3A 5THAA 4PNKB 4R7AB 3UVNA 4ES0A 4U7AA 3I7PA 5FKRA 2I0RA 3SCYA 2CO0C 1GOTB 1B9YA 2H6NA 3N0DA 2AH1A 2TRCB 4PSWB 3I7OA 2PBIB 4J0WA 5H14A 4AOWA 4JSPC 2YNOA 2BBKH 5EARA 4A11B 2H3XA 5IJ8E 4O3TB 3AL9A 4CI2A 3SBQA 4FAVD 5H1MA 4FWWA 3W15A 5AJAA 4CI3A 2P9IC 4U1EI 3BG1A 3SVWD 5A2Qg 3OKTA 2YMUA 4O45A 2OVQB 4X61B 2YNPA 2HESX 5FKQA 3MMYA 4GQBB 1A0RB 2BCJB 3GREA 3EI4A 5EM2B 2J57G 4J77A 4O1QD 3N0EA 4X3EA 1N6DA 3AL8A 1GP2B 2PM7B 3MZLA 3VH0A 3GFCA 2H6KA 4K3JB 3PXTD 4JSVC 3UVMA 5CXBB 1XHMA 2J55H 2UZXB 5CXCB 3FRXA 1MG3A 4IA9A 3DWLC 4CY2A 2AGXA 3JB9L 2Q7QA 1NEXB 1N6FA 3PE7A 5HE3B 2H14A 3UVKA 4PBYA 5IGQA 5C2WB 3OKWA 3IJCA 5C9ZB 3MKSB 2AGZA 5HE0B 5TEFA 3NVXA 5C2VB 4J0XA 3I8EA 5CYKB 3V9FA 3K27A 1OMWB 1XKSA 2IUQA 3L4MD 1PGUA 4HDJA 4ZOZA 2OK4A 3PXSD 5SXMA 3ZWLB 4E5ZB 2HJ4A 4J86A 1OLZA 2PM9B 3FM0A 3J81g 4H5JA 4FAND 3SN6B 4X63B 3NVNA 4A0BB 3BG0A 3UVOA 3F3FA 3SMRA 3OKYB 1PEVA 2P9KC 3F3GA 2YBAA 4LG8A 1PI6A 3JPXA 5I5JA 1YFQA 3E0CA 4E54A 3OL2B 3I7NA 2PM6B 2QXVA 2H47A 5K19A 5FLXg 3EU7A 3UKUC 1FWXA 4LG9A 3ODTA 5JWZA 4L3HD 3VA6A 2CNXA 4UI9R 3JZGA 4QT8A 2XL2A 3MXXA 4XYIA 5FXYA 1MG2A 1JJUB 2W18A 1ERJA 2P9SC 3L4OD 4EWRA 3J80g 3EI1A 1PBYB 1R5MA 4A08B 4A09A 3P4FA 3EI2B 4CZYA 3NVQA 2AH0A 4A0AB 3BWSA 4GM8A 3EG6A 3RN0D 4XYHA 5FKTA 2OK6A 3KRWB 3SJLD 5HE2B 4GZ8A 2IWKA 3SWSD 3UR4A 3ORVD 2GNQA 2H13A 4NSXA 3FGBA 4GGDA 4LGNA 3UKRC 3EI3B 5GXIA 4GM9A 2HJBA 5EMMB 4J87A 2GC7A 3RRMC 2HXCA 3I7HA 4IMMA 2I3TA 2AGWA 3MZKA 1QNIA 3PSLA 2OVPB 1S4UX 2AGLA 2G9AA 2H9NA 4CI8A 4J79A 2MTAH 4AEZA 5EAMA 1L0QA 4Y7RA 5AFU3 1RI6A 3IJ1A 5H17A 4J81A 4H5IA 4ESGA 3CFVA 1JOFA 1Q47A 2YNNA 3I8CA 2OIZA 3RN1D 2I0SA 3DXKC 3RMZD 3K26A 5FA5B 4N14A 4CY1A 4L3GD 4FA9D 2I3SA 2IUPA 5GSAA 3PXWD 3OW8A 4ERQA 4K3ID 4A11A 4CZXA 2AGYA 4FA4D 5FQDA 3I2NA 2XU7A 1K8KC 2B5LA 3I89A 4ZOXA 5TEEA 4GMBA 3RSEC 3EI4B 1SQJA 4QRJA 5EMJB 5IT9g 4PBZA 4ZOVA 3AL8B 2IAAA 4JXMA 1TYQC 3PVUB 4TZ4A 5GXHA 3SBRA 4PSXB 3VGZA 3CFSB 2P9PC 4J8BA 4PXWA 4ERZA 3I7KA 2J56H 4CC9A 4A7JA 2B4EA 4J84A 1U2VC 4QQEA 4Z8LA 5HYNB 5EM2A 5EALA 3A0FA 2OVRB 1GXRA 1P22A 5KDOB 2IURA 1N6EA 4GM3A 4JD2C 1VYHC 4JSXC 5GMKn 4FA5D 2GC4A 3RLMD 3EWEA 3IIWA 1MDAH 5K1CC 2O9KA 5FKSA 2UZYB 1SQ9A 3C9CA 4FA1D 1JMXB 5CXBA 4BUJC 3PSCB 5CXCA 2AQ5A 3AH8B 4GGAA 2EBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D0K A;  2IWF A;  4O3U B;  4BL0 A;  4JT6 C;  2XYI A;  3SXT D;  5TDH B;  2H68 A;  4XEI C;  3F3P A;  3HFQ A;  3UVL A;  2XL3 A;  3JRO A;  4ZOY A;  3V7D B;  3ULE C;  2HKM A;  2P9L C;  3CIK B;  2H9P A;  3MKQ A;  3PVW B;  5CYK A;  3SFZ A;  3I7L A;  2B5N A;  4YVD A;  2CO0 A;  3C5M A;  4G56 B;  2P9N C;  4L1Q D;  3OTT A;  4J78 A;  4E5Z A;  4ZN4 A;  5I5I A;  3SHF A;  2PM9 A;  5AMS A;  4BH6 A;  4D6V A;  3JAM g;  4E54 B;  4GGC A;  5IJ7 E;  4A0B A;  3RFH A;  3OKY A;  4CZV A;  3JRP A;  2H9L A;  4A2M A;  2P9U C;  3JZH A;  4Y5R D;  3AFC A;  3IIY A;  1K32 A;  3C99 A;  3KRX B;  5B4W A;  4I79 A;  3OL2 A;  4J82 A;  4QL1 A;  2Z2N A;  5HE1 B;  2CN3 A;  4OWR A;  2CE9 A;  3SLE D;  5I5M A;  3SBP A;  4FHL A;  5EAP A;  4CY5 A;  4JT5 C;  3EI1 B;  4PC0 A;  1B9X A;  2Z2P A;  3DSM A;  2H6Q A;  4X60 B;  2G99 A;  4MK0 B;  4A09 B;  3C75 H;  4J73 A;  5IC7 A;  2HYE A;  3EMH A;  2OJY A;  4A2L A;  4J8G A;  4O9D A;  4L9O A;  1U4C A;  4OZU A;  5EMK B;  3B7F A;  5IGO A;  4A08 A;  5EML B;  5TF2 A;  2I0T A;  2IUV A;  4GQ2 P;  3IJ0 A;  1JMZ B;  3EI2 A;  3V5W B;  3U4Y A;  4CY3 A;  1SHY B;  2HKR A;  3IKO A;  4GQ1 A;  2B5M A;  4A0A A;  1TBG A;  2CN2 A;  4JSN C;  2Z2O A;  1XIP A;  1NR0 A;  3JZN A;  4CI1 A;  4ERY A;  5HQG A;  4KFM B;  2H9M A;  3DM0 A;  4FB1 D;  2CE8 A;  2QC5 A;  2YB8 B;  3DXM C;  3RFG A;  1GG2 B;  3EI3 A;  5THA A;  4PNK B;  4R7A B;  3UVN A;  4ES0 A;  4U7A A;  3I7P A;  5FKR A;  2I0R A;  3SCY A;  2CO0 C;  1GOT B;  1B9Y A;  2H6N A;  3N0D A;  2AH1 A;  2TRC B;  4PSW B;  3I7O A;  2PBI B;  4J0W A;  5H14 A;  4AOW A;  4JSP C;  2YNO A;  2BBK H;  5EAR A;  4A11 B;  2H3X A;  5IJ8 E;  4O3T B;  3AL9 A;  4CI2 A;  3SBQ A;  4FAV D;  5H1M A;  4FWW A;  3W15 A;  5AJA A;  4CI3 A;  2P9I C;  4U1E I;  3BG1 A;  3SVW D;  5A2Q g;  3OKT A;  2YMU A;  4O45 A;  2OVQ B;  4X61 B;  2YNP A;  2HES X;  5FKQ A;  3MMY A;  4GQB B;  1A0R B;  2BCJ B;  3GRE A;  3EI4 A;  5EM2 B;  2J57 G;  4J77 A;  4O1Q D;  3N0E A;  4X3E A;  1N6D A;  3AL8 A;  1GP2 B;  2PM7 B;  3MZL A;  3VH0 A;  3GFC A;  2H6K A;  4K3J B;  3PXT D;  4JSV C;  3UVM A;  5CXB B;  1XHM A;  2J55 H;  2UZX B;  5CXC B;  3FRX A;  1MG3 A;  4IA9 A;  3DWL C;  4CY2 A;  2AGX A;  3JB9 L;  2Q7Q A;  1NEX B;  1N6F A;  3PE7 A;  5HE3 B;  2H14 A;  3UVK A;  4PBY A;  5IGQ A;  5C2W B;  3OKW A;  3IJC A;  5C9Z B;  3MKS B;  2AGZ A;  5HE0 B;  5TEF A;  3NVX A;  5C2V B;  4J0X A;  3I8E A;  5CYK B;  3V9F A;  3K27 A;  1OMW B;  1XKS A;  2IUQ A;  3L4M D;  1PGU A;  4HDJ A;  4ZOZ A;  2OK4 A;  3PXS D;  5SXM A;  3ZWL B;  4E5Z B;  2HJ4 A;  4J86 A;  1OLZ A;  2PM9 B;  3FM0 A;  3J81 g;  4H5J A;  4FAN D;  3SN6 B;  4X63 B;  3NVN A;  4A0B B;  3BG0 A;  3UVO A;  3F3F A;  3SMR A;  3OKY B;  1PEV A;  2P9K C;  3F3G A;  2YBA A;  4LG8 A;  1PI6 A;  3JPX A;  5I5J A;  1YFQ A;  3E0C A;  4E54 A;  3OL2 B;  3I7N A;  2PM6 B;  2QXV A;  2H47 A;  5K19 A;  5FLX g;  3EU7 A;  3UKU C;  1FWX A;  4LG9 A;  3ODT A;  5JWZ A;  4L3H D;  3VA6 A;  2CNX A;  4UI9 R;  3JZG A;  4QT8 A;  2XL2 A;  3MXX A;  4XYI A;  5FXY A;  1MG2 A;  1JJU B;  2W18 A;  1ERJ A;  2P9S C;  3L4O D;  4EWR A;  3J80 g;  3EI1 A;  1PBY B;  1R5M A;  4A08 B;  4A09 A;  3P4F A;  3EI2 B;  4CZY A;  3NVQ A;  2AH0 A;  4A0A B;  3BWS A;  4GM8 A;  3EG6 A;  3RN0 D;  4XYH A;  5FKT A;  2OK6 A;  3KRW B;  3SJL D;  5HE2 B;  4GZ8 A;  2IWK A;  3SWS D;  3UR4 A;  3ORV D;  2GNQ A;  2H13 A;  4NSX A;  3FGB A;  4GGD A;  4LGN A;  3UKR C;  3EI3 B;  5GXI A;  4GM9 A;  2HJB A;  5EMM B;  4J87 A;  2GC7 A;  3RRM C;  2HXC A;  3I7H A;  4IMM A;  2I3T A;  2AGW A;  3MZK A;  1QNI A;  3PSL A;  2OVP B;  1S4U X;  2AGL A;  2G9A A;  2H9N A;  4CI8 A;  4J79 A;  2MTA H;  4AEZ A;  5EAM A;  1L0Q A;  4Y7R A;  5AFU 3;  1RI6 A;  3IJ1 A;  5H17 A;  4J81 A;  4H5I A;  4ESG A;  3CFV A;  1JOF A;  1Q47 A;  2YNN A;  3I8C A;  2OIZ A;  3RN1 D;  2I0S A;  3DXK C;  3RMZ D;  3K26 A;  5FA5 B;  4N14 A;  4CY1 A;  4L3G D;  4FA9 D;  2I3S A;  2IUP A;  5GSA A;  3PXW D;  3OW8 A;  4ERQ A;  4K3I D;  4A11 A;  4CZX A;  2AGY A;  4FA4 D;  5FQD A;  3I2N A;  2XU7 A;  1K8K C;  2B5L A;  3I89 A;  4ZOX A;  5TEE A;  4GMB A;  3RSE C;  3EI4 B;  1SQJ A;  4QRJ A;  5EMJ B;  5IT9 g;  4PBZ A;  4ZOV A;  3AL8 B;  2IAA A;  4JXM A;  1TYQ C;  3PVU B;  4TZ4 A;  5GXH A;  3SBR A;  4PSX B;  3VGZ A;  3CFS B;  2P9P C;  4J8B A;  4PXW A;  4ERZ A;  3I7K A;  2J56 H;  4CC9 A;  4A7J A;  2B4E A;  4J84 A;  1U2V C;  4QQE A;  4Z8L A;  5HYN B;  5EM2 A;  5EAL A;  3A0F A;  2OVR B;  1GXR A;  1P22 A;  5KDO B;  2IUR A;  1N6E A;  4GM3 A;  4JD2 C;  1VYH C;  4JSX C;  5GMK n;  4FA5 D;  2GC4 A;  3RLM D;  3EWE A;  3IIW A;  1MDA H;  5K1C C;  2O9K A;  5FKS A;  2UZY B;  1SQ9 A;  3C9C A;  4FA1 D;  1JMX B;  5CXB A;  4BUJ C;  3PSC B;  5CXC A;  2AQ5 A;  3AH8 B;  4GGA A;  2EBS A; 
#chains in the Genus database with same CATH topology
 4D0K A;  2IWF A;  4O3U B;  1A12 A;  4BL0 A;  4JT6 C;  2XYI A;  3SXT D;  5TDH B;  2H68 A;  4XEI C;  3F3P A;  3HFQ A;  3FCU A;  3UVL A;  2XL3 A;  3JRO A;  4ZOY A;  3V7D B;  3ULE C;  2HKM A;  2P9L C;  3CIK B;  2H9P A;  3MKQ A;  3PVW B;  5CYK A;  3SFZ A;  3IUL A;  5M5U A;  4IRZ A;  3I7L A;  2B5N A;  1O6G A;  4YVD A;  2EIE A;  2CO0 A;  3C5M A;  4G56 B;  4UM8 A;  2P9N C;  4D9S A;  4L1Q D;  3OTT A;  4J78 A;  4E5Z A;  4ZN4 A;  5I5I A;  3SHF A;  2PM9 A;  5AMS A;  4BH6 A;  4D6V A;  3JAM g;  4E54 B;  4RE6 A;  4GGC A;  3ZE1 A;  5IJ7 E;  4A0B A;  3RFH A;  3OKY A;  4CZV A;  3JRP A;  4L1M A;  4AMZ A;  3OF7 A;  2H9L A;  4A2M A;  4AN0 A;  2P9U C;  3JZH A;  5C86 A;  4Y5R D;  3AFC A;  3IIY A;  1K32 A;  3C99 A;  3KRX B;  5B4W A;  4I79 A;  3OL2 A;  4J82 A;  1E8M A;  4QL1 A;  2Z2N A;  5HE1 B;  3QI0 A;  2CN3 A;  4OWR A;  2CE9 A;  3SLE D;  5I5M A;  3SBP A;  4FHL A;  5EAP A;  4CY5 A;  4JT5 C;  4Z7Q A;  3EI1 B;  1E8N A;  4PC0 A;  1B9X A;  2Z2P A;  3DSM A;  2H6Q A;  1QFM A;  4X60 B;  2G99 A;  4MK0 B;  4A09 B;  3C75 H;  5M5T A;  3IUR A;  4NAA A;  4J73 A;  5M61 A;  5IC7 A;  2HYE A;  3EMH A;  2OJY A;  3EQ8 A;  4A2L A;  4J8G A;  4DNW A;  4O9D A;  4L9O A;  1U4C A;  4OZU A;  3MUN A;  5EMK B;  3EQ9 A;  3B7F A;  5IGO A;  4A08 A;  5EML B;  5TF2 A;  2I0T A;  2IUV A;  4GQ2 P;  3IJ0 A;  1JMZ B;  3IUJ A;  3V5W B;  3EI2 A;  3EQ7 A;  3U4Y A;  4CY3 A;  2VZ1 A;  1SHY B;  2HKR A;  3IKO A;  3K6S A;  4GQ1 A;  2B5M A;  4A0A A;  1C9L A;  1TBG A;  2CN2 A;  4JSN C;  2Z2O A;  4NEN A;  1XIP A;  3JZN A;  1NR0 A;  4CI1 A;  4ERY A;  5HQG A;  2H9M A;  3DM0 A;  4KFM B;  2VC2 A;  4FB1 D;  2CE8 A;  2QC5 A;  1UOP A;  2YB8 B;  3DXM C;  3RFG A;  2EID A;  1GG2 B;  3K72 A;  3EI3 A;  5THA A;  4BCC A;  3IUN A;  4PNK B;  4R7A B;  3UVN A;  4ES0 A;  4U7A A;  4NC4 A;  2JKX A;  3I7P A;  5FKR A;  2I0R A;  3SCY A;  2CO0 C;  1GOH A;  4O2W A;  1GOT B;  3KCI A;  1B9Y A;  2H6N A;  3MVD K;  3N0D A;  2HU7 A;  4MMX A;  1M1X A;  1UTC A;  2AH1 A;  5M5S A;  2TRC B;  4PSW B;  3I7O A;  1UOQ A;  3NIF A;  3O4I A;  2PBI B;  4QAM A;  4J0W A;  4BP8 A;  1BPO A;  5H14 A;  4AOW A;  4JSP C;  2YNO A;  2BBK H;  5EAR A;  4A11 B;  2H3X A;  4G1M A;  5IJ8 E;  4O3T B;  3AL9 A;  4CI2 A;  3ZDZ A;  3SBQ A;  4FAV D;  5H1M A;  4FWW A;  3ZE2 A;  3W15 A;  5AJA A;  3O4G A;  2VDN A;  4CI3 A;  2P9I C;  4U1E I;  3BG1 A;  3SVW D;  1U8C A;  1JTD B;  5A2Q g;  3OKT A;  3ZDY A;  4Z7O A;  2YMU A;  4O45 A;  2OVQ B;  3QHY B;  4X61 B;  2YNP A;  4MMZ A;  2HES X;  5FKQ A;  3MMY A;  4GQB B;  1A0R B;  2BKL A;  2BCJ B;  4G55 A;  3GRE A;  3EI4 A;  5EM2 B;  2J57 G;  4J77 A;  4NBM A;  3N0E A;  4O1Q D;  4X3E A;  1N6D A;  3AL8 A;  1GP2 B;  4MMY A;  3ZDX A;  2QR5 A;  3VI3 A;  2PM7 B;  3MZL A;  3ZE0 A;  1T2X A;  3VH0 A;  3GFC A;  5FFO A;  2H6K A;  4K3J B;  3PXT D;  2EIC A;  4JSV C;  2VDR A;  2WQ8 A;  4JHN A;  3UVM A;  5CXB B;  1XHM A;  2J55 H;  2XZG A;  2UZX B;  3FRX A;  5CXC B;  1MG3 A;  4IA9 A;  3DWL C;  4CY2 A;  2AGX A;  2HU8 A;  3JB9 L;  2Q7Q A;  1NEX B;  1N6F A;  3PE7 A;  5HE3 B;  4WK4 A;  2H14 A;  2VZ3 A;  3UVK A;  4AX4 A;  4PBY A;  5IGQ A;  5C2W B;  3IUQ A;  3OKW A;  3IJC A;  3DDU A;  2XDW A;  5C9Z B;  1GOG A;  3MKS B;  2AGZ A;  5HE0 B;  5TEF A;  3NVX A;  5C2V B;  4J0X A;  3I8E A;  5CYK B;  3V9F A;  3K27 A;  1OMW B;  1XKS A;  2IUQ A;  3L4M D;  1PGU A;  4HDJ A;  5HDB A;  4ZOZ A;  2OK4 A;  3PXS D;  5SXM A;  3ZWL B;  2VDO A;  4E5Z B;  2HJ4 A;  4J86 A;  3NIG A;  1OLZ A;  2EIB A;  2PM9 B;  3FM0 A;  3J81 g;  4BCD A;  4H5J A;  1O6F A;  4FAN D;  1VE6 A;  3SN6 B;  4X63 B;  3NVN A;  4A0B B;  1E5T A;  3BG0 A;  3UVO A;  3F3F A;  3SMR A;  1YR2 A;  3GC3 B;  3OKY B;  1PEV A;  3T3P A;  3T3M A;  2P9K C;  3F3G A;  4AN1 A;  2YBA A;  4LG8 A;  1PI6 A;  3JPX A;  5I5J A;  1YFQ A;  3E0C A;  4E54 A;  3OL2 B;  3I7N A;  2PM6 B;  2QXV A;  2H47 A;  5K19 A;  5FLX g;  3EU7 A;  3GD1 I;  3VI4 A;  3UKU C;  1FWX A;  1UOO A;  4LG9 A;  3IJE A;  4RE5 A;  3ODT A;  5JWZ A;  4L3H D;  3VA6 A;  2CNX A;  4UI9 R;  3JZG A;  4QT8 A;  2XL2 A;  3MXX A;  4XYI A;  5FXY A;  1MG2 A;  1JJU B;  2W18 A;  1ERJ A;  2P9S C;  3L4O D;  4EWR A;  3J80 g;  3EI1 A;  1PBY B;  1H2Z A;  1R5M A;  4A08 B;  4A09 A;  3P4F A;  3EI2 B;  3MUO A;  4CZY A;  3K71 A;  3NVQ A;  4DNU A;  1JV2 A;  2AH0 A;  4A0A B;  3BWS A;  4GM8 A;  3EG6 A;  3RN0 D;  4XYH A;  5FKT A;  2OK6 A;  3IUM A;  3KRW B;  1VZ2 A;  4AMY A;  3SJL D;  5HE2 B;  3O4J A;  4GZ8 A;  2IWK A;  3SWS D;  3UR4 A;  2VDQ A;  2H13 A;  2GNQ A;  3ORV D;  3V4P A;  4NSX A;  2VDM A;  3FGB A;  4GGD A;  4LGN A;  3UKR C;  3EI3 B;  5GXI A;  4GM9 A;  2HJB A;  5EMM B;  4J87 A;  2GC7 A;  3RRM C;  2HXC A;  3I7H A;  4IMM A;  1TYE A;  5E6R A;  2I3T A;  2AGW A;  3MZK A;  1QNI A;  3PSL A;  2OVP B;  1S4U X;  2AGL A;  4Z7N A;  2G9A A;  2H9N A;  2QZP A;  4CI8 A;  4BP9 A;  4J79 A;  2MTA H;  4AEZ A;  1H2W A;  5EAM A;  1L0Q A;  4Y7R A;  5AFU 3;  1H2Y A;  1RI6 A;  3IJ1 A;  5H17 A;  4J81 A;  4H5I A;  4ESG A;  1VE7 A;  3CFV A;  3IVM A;  5C92 A;  4JHP C;  1JOF A;  1Q47 A;  2YNN A;  3I8C A;  2OIZ A;  3RN1 D;  2I0S A;  3DXK C;  3RMZ D;  3K26 A;  4WK2 A;  5FA5 B;  4N14 A;  4CY1 A;  5M5V A;  4L3G D;  4O02 A;  4FA9 D;  2I3S A;  4WK0 A;  2IUP A;  4UM9 A;  5FFG A;  5GSA A;  3PXW D;  3OW8 A;  4BCB A;  4ERQ A;  4K3I D;  4WJK A;  2XE4 A;  4A11 A;  4CZX A;  3O4H A;  2AGY A;  1H2X A;  3FCS A;  4FA4 D;  5FQD A;  3I2N A;  2XU7 A;  1QFS A;  1K8K C;  2B5L A;  3I89 A;  1I2M B;  4ZOX A;  5TEE A;  1C9I A;  4GMB A;  3RSE C;  3EI4 B;  1SQJ A;  4QRJ A;  5EMJ B;  5IT9 g;  4PBZ A;  4ZOV A;  3AL8 B;  2IAA A;  1K3I A;  4JXM A;  1TYQ C;  3PVU B;  4TZ4 A;  5GXH A;  3SBR A;  4PSX B;  3V4V A;  3VGZ A;  3CFS B;  2P9P C;  2VDP A;  4J8B A;  1VZ3 A;  4PXW A;  3NID A;  2VDK A;  4ERZ A;  3I7K A;  2J56 H;  4CC9 A;  4A7J A;  2B4E A;  4J84 A;  1U2V C;  4QQE A;  4Z8L A;  5HYN B;  5EM2 A;  5EAL A;  1GOF A;  2OVR B;  3A0F A;  1GXR A;  1P22 A;  4G1E A;  5KDO B;  2IUR A;  2VDL A;  1N6E A;  4GM3 A;  4JD2 C;  4DNV A;  1VYH C;  4JSX C;  5GMK n;  4FA5 D;  2GC4 A;  1L5G A;  3RLM D;  3EWE A;  3IIW A;  1MDA H;  5K1C C;  2O9K A;  5FKS A;  2UZY B;  3C9C A;  1SQ9 A;  2HU5 A;  4FA1 D;  1JMX B;  5CXB A;  4BUJ C;  3PSC B;  5CXC A;  5E6U A;  5E6S A;  2AQ5 A;  3AH8 B;  5M5R A;  4GGA A;  2EBS A; 
#chains in the Genus database with same CATH homology
 4D0K A;  2IWF A;  4O3U B;  4BL0 A;  4JT6 C;  2XYI A;  3SXT D;  5TDH B;  2H68 A;  4XEI C;  3F3P A;  3HFQ A;  3UVL A;  2XL3 A;  3JRO A;  4ZOY A;  3V7D B;  3ULE C;  2HKM A;  2P9L C;  3CIK B;  2H9P A;  3MKQ A;  3PVW B;  5CYK A;  3SFZ A;  3I7L A;  2B5N A;  4YVD A;  2CO0 A;  3C5M A;  4G56 B;  2P9N C;  4L1Q D;  3OTT A;  4J78 A;  4E5Z A;  4ZN4 A;  5I5I A;  3SHF A;  2PM9 A;  5AMS A;  4BH6 A;  4D6V A;  3JAM g;  4E54 B;  4GGC A;  5IJ7 E;  4A0B A;  3RFH A;  3OKY A;  4CZV A;  3JRP A;  2H9L A;  4A2M A;  2P9U C;  3JZH A;  4Y5R D;  3AFC A;  3IIY A;  1K32 A;  3C99 A;  3KRX B;  5B4W A;  4I79 A;  3OL2 A;  4J82 A;  4QL1 A;  2Z2N A;  5HE1 B;  2CN3 A;  4OWR A;  2CE9 A;  3SLE D;  5I5M A;  3SBP A;  4FHL A;  5EAP A;  4CY5 A;  4JT5 C;  3EI1 B;  4PC0 A;  1B9X A;  2Z2P A;  3DSM A;  2H6Q A;  4X60 B;  2G99 A;  4MK0 B;  4A09 B;  3C75 H;  4J73 A;  5IC7 A;  2HYE A;  3EMH A;  2OJY A;  4A2L A;  4J8G A;  4O9D A;  4L9O A;  1U4C A;  4OZU A;  5EMK B;  3B7F A;  5IGO A;  4A08 A;  5EML B;  5TF2 A;  2I0T A;  2IUV A;  4GQ2 P;  3IJ0 A;  1JMZ B;  3EI2 A;  3V5W B;  3U4Y A;  4CY3 A;  1SHY B;  2HKR A;  3IKO A;  4GQ1 A;  2B5M A;  4A0A A;  1TBG A;  2CN2 A;  4JSN C;  2Z2O A;  1XIP A;  1NR0 A;  3JZN A;  4CI1 A;  4ERY A;  5HQG A;  4KFM B;  2H9M A;  3DM0 A;  4FB1 D;  2CE8 A;  2QC5 A;  2YB8 B;  3DXM C;  3RFG A;  1GG2 B;  3EI3 A;  5THA A;  4PNK B;  4R7A B;  3UVN A;  4ES0 A;  4U7A A;  3I7P A;  5FKR A;  2I0R A;  3SCY A;  2CO0 C;  1GOT B;  1B9Y A;  2H6N A;  3N0D A;  2AH1 A;  2TRC B;  4PSW B;  3I7O A;  2PBI B;  4J0W A;  5H14 A;  4AOW A;  4JSP C;  2YNO A;  2BBK H;  5EAR A;  4A11 B;  2H3X A;  5IJ8 E;  4O3T B;  3AL9 A;  4CI2 A;  3SBQ A;  4FAV D;  5H1M A;  4FWW A;  3W15 A;  5AJA A;  4CI3 A;  2P9I C;  4U1E I;  3BG1 A;  3SVW D;  5A2Q g;  3OKT A;  2YMU A;  4O45 A;  2OVQ B;  4X61 B;  2YNP A;  2HES X;  5FKQ A;  3MMY A;  4GQB B;  1A0R B;  2BCJ B;  3GRE A;  3EI4 A;  5EM2 B;  2J57 G;  4J77 A;  4O1Q D;  3N0E A;  4X3E A;  1N6D A;  3AL8 A;  1GP2 B;  2PM7 B;  3MZL A;  3VH0 A;  3GFC A;  2H6K A;  4K3J B;  3PXT D;  4JSV C;  3UVM A;  5CXB B;  1XHM A;  2J55 H;  2UZX B;  5CXC B;  3FRX A;  1MG3 A;  4IA9 A;  3DWL C;  4CY2 A;  2AGX A;  3JB9 L;  2Q7Q A;  1NEX B;  1N6F A;  3PE7 A;  5HE3 B;  2H14 A;  3UVK A;  4PBY A;  5IGQ A;  5C2W B;  3OKW A;  3IJC A;  5C9Z B;  3MKS B;  2AGZ A;  5HE0 B;  5TEF A;  3NVX A;  5C2V B;  4J0X A;  3I8E A;  5CYK B;  3V9F A;  3K27 A;  1OMW B;  1XKS A;  2IUQ A;  3L4M D;  1PGU A;  4HDJ A;  4ZOZ A;  2OK4 A;  3PXS D;  5SXM A;  3ZWL B;  4E5Z B;  2HJ4 A;  4J86 A;  1OLZ A;  2PM9 B;  3FM0 A;  3J81 g;  4H5J A;  4FAN D;  3SN6 B;  4X63 B;  3NVN A;  4A0B B;  3BG0 A;  3UVO A;  3F3F A;  3SMR A;  3OKY B;  1PEV A;  2P9K C;  3F3G A;  2YBA A;  4LG8 A;  1PI6 A;  3JPX A;  5I5J A;  1YFQ A;  3E0C A;  4E54 A;  3OL2 B;  3I7N A;  2PM6 B;  2QXV A;  2H47 A;  5K19 A;  5FLX g;  3EU7 A;  3UKU C;  1FWX A;  4LG9 A;  3ODT A;  5JWZ A;  4L3H D;  3VA6 A;  2CNX A;  4UI9 R;  3JZG A;  4QT8 A;  2XL2 A;  3MXX A;  4XYI A;  5FXY A;  1MG2 A;  1JJU B;  2W18 A;  1ERJ A;  2P9S C;  3L4O D;  4EWR A;  3J80 g;  3EI1 A;  1PBY B;  1R5M A;  4A08 B;  4A09 A;  3P4F A;  3EI2 B;  4CZY A;  3NVQ A;  2AH0 A;  4A0A B;  3BWS A;  4GM8 A;  3EG6 A;  3RN0 D;  4XYH A;  5FKT A;  2OK6 A;  3KRW B;  3SJL D;  5HE2 B;  4GZ8 A;  2IWK A;  3SWS D;  3UR4 A;  3ORV D;  2GNQ A;  2H13 A;  4NSX A;  3FGB A;  4GGD A;  4LGN A;  3UKR C;  3EI3 B;  5GXI A;  4GM9 A;  2HJB A;  5EMM B;  4J87 A;  2GC7 A;  3RRM C;  2HXC A;  3I7H A;  4IMM A;  2I3T A;  2AGW A;  3MZK A;  1QNI A;  3PSL A;  2OVP B;  1S4U X;  2AGL A;  2G9A A;  2H9N A;  4CI8 A;  4J79 A;  2MTA H;  4AEZ A;  5EAM A;  1L0Q A;  4Y7R A;  5AFU 3;  1RI6 A;  3IJ1 A;  5H17 A;  4J81 A;  4H5I A;  4ESG A;  3CFV A;  1JOF A;  1Q47 A;  2YNN A;  3I8C A;  2OIZ A;  3RN1 D;  2I0S A;  3DXK C;  3RMZ D;  3K26 A;  5FA5 B;  4N14 A;  4CY1 A;  4L3G D;  4FA9 D;  2I3S A;  2IUP A;  5GSA A;  3PXW D;  3OW8 A;  4ERQ A;  4K3I D;  4A11 A;  4CZX A;  2AGY A;  4FA4 D;  5FQD A;  3I2N A;  2XU7 A;  1K8K C;  2B5L A;  3I89 A;  4ZOX A;  5TEE A;  4GMB A;  3RSE C;  3EI4 B;  1SQJ A;  4QRJ A;  5EMJ B;  5IT9 g;  4PBZ A;  4ZOV A;  3AL8 B;  2IAA A;  4JXM A;  1TYQ C;  3PVU B;  4TZ4 A;  5GXH A;  3SBR A;  4PSX B;  3VGZ A;  3CFS B;  2P9P C;  4J8B A;  4PXW A;  4ERZ A;  3I7K A;  2J56 H;  4CC9 A;  4A7J A;  2B4E A;  4J84 A;  1U2V C;  4QQE A;  4Z8L A;  5HYN B;  5EM2 A;  5EAL A;  3A0F A;  2OVR B;  1GXR A;  1P22 A;  5KDO B;  2IUR A;  1N6E A;  4GM3 A;  4JD2 C;  1VYH C;  4JSX C;  5GMK n;  4FA5 D;  2GC4 A;  3RLM D;  3EWE A;  3IIW A;  1MDA H;  5K1C C;  2O9K A;  5FKS A;  2UZY B;  1SQ9 A;  3C9C A;  4FA1 D;  1JMX B;  5CXB A;  4BUJ C;  3PSC B;  5CXC A;  2AQ5 A;  3AH8 B;  4GGA A;  2EBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...