4BH6A

Insights into degron recognition by apc coactivators from the structure of an acm1-cdh1 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
304
structure length
304
Chain Sequence
b'RQIAKVPYRVLDAPSLADDFYYSLIDWSSTDVLAVALGKSIFLTDNNTGDVVHLCDTENEYTSLSWIGAGSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APC/C ACTIVATOR PROTEIN CDH1
molecule tags Cell cycle
source organism Saccharomyces cerevisiae
publication title Insights Into Degron Recognition by Apc/C Coactivators from the Structure of an Acm1-Cdh1 Complex.
pubmed doi rcsb
total genus 88
structure length 304
sequence length 304
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4bh6A00
1PBYB 1ERJA 3VGZA 4J87A 4LG9A 1MG2A 5EAPA 5EMKB 4J86A 4JT6C 3AH8B 2B5NA 4JSPC 5SXMA 4JSVC 4BH6A 3PXSD 4PXWA 4OZUA 5C9ZB 1SHYB 4ZOXA 2IAAA 3AL9A 2P9PC 4N14A 4HDJA 3MXXA 4TZ4A 4Y7RA 3I7LA 3UVMA 5EM2A 3I7KA 3FM0A 4CI1A 4GQ2P 4A09A 4GM9A 1PGUA 4J77A 2H3XA 4GZ8A 4BL0A 4ERZA 2J55H 2OJYA 3PXTD 1FWXA 2CNXA 4E5ZB 3K26A 4FA1D 5CXCB 4GGAA 4GMBA 4QRJA 1GP2B 3JPXA 3I8EA 4CY2A 3RMZD 3SBQA 4X3EA 5GXIA 3C5MA 2MTAH 3FGBA 4CZYA 5B4WA 3UKRC 1SQ9A 1MDAH 3I8CA 3F3FA 4FWWA 3L4OD 4L9OA 3SWSD 3I7OA 5C2VB 3PSCB 2EBSA 4GM3A 2O9KA 2OVPB 3KRWB 5TEFA 5GMKn 5EARA 4FA4D 1K32A 2CE8A 4KFMB 2IUQA 3C99A 4A09B 2HXCA 2H14A 4GM8A 3RLMD 4LGNA 3SN6B 3J80g 4JXMA 5IGOA 4CZVA 4O45A 4H5IA 5AJAA 1GG2B 4MK0B 2Z2OA 3E0CA 2OK6A 2CN3A 3IIWA 5FKQA 3AFCA 4CI2A 5I5MA 5FA5B 4CY5A 5THAA 4PC0A 5I5IA 3MKQA 2H9MA 2OK4A 2I0SA 2CE9A 4PSXB 5IC7A 1U2VC 3RN1D 3OKWA 1TBGA 3DXMC 2H9LA 2HKMA 3V5WB 5A2Qg 4E54A 3RSEC 4J84A 4J8BA 3IIYA 3SXTD 5I5JA 2IWKA 3F3PA 3DSMA 2PBIB 2H68A 4O3UB 2AGXA 2AQ5A 4AEZA 3V9FA 3RFHA 5H1MA 3UKUC 2AGZA 3IJ0A 1OLZA 5TEEA 2AGWA 5FKRA 4A08B 3CIKB 2H13A 3N0DA 3OL2A 3SFZA 5CXCA 3OKYB 2H47A 5FXYA 2CN2A 2AGYA 1R5MA 3JZGA 3SCYA 4U1EI 4PNKB 3HFQA 4UI9R 1XIPA 3PVWB 2H9PA 2I0RA 3K27A 3VH0A 2XL2A 3SHFA 2BBKH 4G56B 2PM9A 5CXBB 1K8KC 4J82A 4XYIA 4Y5RD 2PM7B 4I79A 4CI8A 4L1QD 2YMUA 1YFQA 3OW8A 4IMMA 2CO0C 4O9DA 1B9XA 2IUPA 3W15A 4NSXA 5AFU3 3JZNA 4XEIC 3JZHA 4BUJC 3JB9L 2W18A 4A0AA 3DM0A 2J56H 2H6KA 5EMMB 2GNQA 1B9YA 3AL8A 3U4YA 2YNPA 4ZOZA 2GC4A 5EMJB 4PBZA 3MZKA 3EI1B 2Z2PA 5IGQA 4A0BB 2OVRB 1VYHC 2P9LC 4A08A 2HJBA 1QNIA 4A11B 2AGLA 3FRXA 3EU7A 1SQJA 2YNNA 3C9CA 3JAMg 3BWSA 4J79A 1S4UX 4XYHA 4A11A 4GQBB 4E54B 3UVNA 5H14A 5FKSA 2UZXB 5CYKB 4K3ID 3OKYA 4AOWA 3OKTA 2J57G 5GSAA 3EI1A 2HESX 2I3SA 2HKRA 5K1CC 2I0TA 4O3TB 4E5ZA 4LG8A 4A7JA 3NVXA 3SBPA 1MG3A 3SBRA 3I7PA 2B5LA 2IWFA 4L3HD 4U7AA 4J0XA 3PSLA 2IURA 4CI3A 4JSXC 1N6FA 3EI3B 5GXHA 5HE2B 3UVLA 3UVKA 3EWEA 4A0AB 2OVQB 3VA6A 3I7HA 2IUVA 4FA9D 5C2WB 3EI4A 2HYEA 2G99A 2YNOA 3CFVA 1Q47A 3UVOA 5TF2A 1NEXB 3I7NA 3BG1A 4PBYA 1P22A 4ZOYA 3DXKC 2B4EA 2PM9B 2H6QA 2QXVA 2BCJB 5EAMA 1U4CA 5AMSA 1PEVA 5EALA 2H9NA 4QT8A 4R7AB 2B5MA 3ULEC 2PM6B 3V7DB 5HE3B 2AH1A 4GGDA 4A2MA 4J8GA 4CY3A 4CZXA 2Z2NA 5IJ8E 3IJCA 2P9IC 3J81g 2G9AA 4ERYA 3DWLC 4D6VA 2YB8B 4L3GD 2XU7A 2QC5A 2CO0A 4PSWB 4FA5D 4JD2C 2Q7QA 1A0RB 3EI2A 3RN0D 3C75H 3RRMC 3B7FA 3SJLD 2XYIA 4ES0A 3MKSB 4J81A 4JSNC 5FQDA 3RFGA 1XKSA 4FAND 5H17A 5HQGA 2YBAA 4ZOVA 3MMYA 3NVNA 5HE0B 2HJ4A 3EMHA 3MZLA 4H5JA 4X60B 4ESGA 4A0BA 1OMWB 3EG6A 1RI6A 5JWZA 2GC7A 3JRPA 4GGCA 5IJ7E 4FB1D 4EWRA 3OTTA 1L0QA 5KDOB 1N6EA 3SMRA 3EI4B 3GFCA 2AH0A 2I3TA 5HE1B 4FHLA 3UR4A 3PXWD 4ERQA 3ZWLB 1JMXB 4K3JB 3N0EA 3PE7A 2P9UC 1GOTB 5HYNB 2P9SC 5TDHB 3I2NA 4IA9A 3ODTA 5K19A 4A2LA 4QQEA 4QL1A 2OIZA 3PVUB 5FKTA 3KRXB 1N6DA 3CFSB 3SLED 2UZYB 3P4FA 4CC9A 3L4MD 5CXBA 3A0FA 5CYKA 1JOFA 4CY1A 2P9KC 3SVWD 1XHMA 4OWRA 3NVQA 3I89A 2H6NA 1GXRA 3EI3A 3IKOA 1TYQC 3F3GA 3GREA 3EI2B 5EMLB 2XL3A 3JROA 4Z8LA 4GQ1A 3IJ1A 4FAVD 4J73A 4J78A 3OL2B 5IT9g 4O1QD 1JJUB 2P9NC 4J0WA 1NR0A 5FLXg 4YVDA 1JMZB 4X63B 4D0KA 3ORVD 3AL8B 4ZN4A 2TRCB 4JT5C 4X61B 1PI6A 3BG0A 5EM2B
chains in the Genus database with same CATH superfamily
1PBYB 1ERJA 5E6RA 3VGZA 4J87A 4LG9A 1MG2A 3IUQA 1K3IA 5EAPA 1T2XA 5EMKB 4J86A 4JT6C 3AH8B 2B5NA 4JSPC 5SXMA 4JSVC 4BH6A 3ZDYA 4L1MA 3PXSD 4O2WA 4PXWA 3FCSA 4OZUA 5C9ZB 2VDQA 1SHYB 1VZ3A 4ZOXA 4BCCA 2IAAA 3AL9A 2P9PC 1H2XA 4N14A 4HDJA 3MXXA 4TZ4A 4Y7RA 3I7LA 3UVMA 5EM2A 2EICA 3I7KA 3FM0A 1JV2A 4CI1A 4GQ2P 4AMYA 4GM9A 4A09A 1PGUA 4J77A 2H3XA 4MMZA 4GZ8A 4BL0A 3GD1I 4ERZA 2J55H 2OJYA 3PXTD 1FWXA 2CNXA 4E5ZB 4AX4A 3K26A 4WJKA 4FA1D 5CXCB 4AN0A 4GGAA 1YR2A 4GMBA 4QRJA 1GP2B 3JPXA 3I8EA 4CY2A 3RMZD 3VI4A 3SBQA 4X3EA 4DNVA 5GXIA 3C5MA 2MTAH 3FGBA 4CZYA 5B4WA 3UKRC 1SQ9A 1MDAH 3I8CA 3F3FA 4FWWA 5M5VA 3L4OD 1QFSA 4L9OA 3SWSD 3I7OA 5C2VB 5M5RA 3PSCB 2EBSA 4JHNA 2JKXA 4GM3A 2O9KA 2OVPB 3KRWB 5TEFA 3NIFA 4QAMA 5GMKn 5EARA 4BP9A 4FA4D 1K32A 2CE8A 4KFMB 2IUQA 3C99A 1U8CA 4A09B 2HXCA 2H14A 3EQ9A 3MUNA 4GM8A 1GOFA 3RLMD 1H2ZA 4LGNA 3SN6B 1UOOA 3J80g 4JXMA 5IGOA 4CZVA 4O45A 4H5IA 1GG2B 4MK0B 5AJAA 2Z2OA 3E0CA 2OK6A 1UOPA 2CN3A 3IIWA 3EQ8A 5FKQA 3AFCA 4CI2A 5I5MA 5FA5B 4CY5A 3ZDXA 5THAA 4PC0A 5I5IA 3MKQA 2H9MA 4BP8A 2OK4A 2I0SA 4DNWA 2CE9A 4PSXB 5IC7A 1C9LA 4WK0A 1U2VC 3RN1D 3OKWA 1TBGA 5M61A 3DXMC 2H9LA 2HKMA 3V5WB 5A2Qg 4E54A 3V4VA 3RSEC 4J84A 4J8BA 3IIYA 3SXTD 5M5UA 3ZDZA 5I5JA 2IWKA 3F3PA 3DSMA 4NC4A 2PBIB 2H68A 4O3UB 2AGXA 2AQ5A 3QI0A 4AEZA 5M5TA 3V4PA 3V9FA 3RFHA 5H1MA 3UKUC 2AGZA 3IJ0A 1OLZA 5TEEA 2AGWA 5FKRA 4A08B 3CIKB 2H13A 3N0DA 3OL2A 3SFZA 3GC3B 5CXCA 3OKYB 2H47A 5FFOA 5FXYA 3OF7A 2CN2A 4MMXA 2AGYA 1R5MA 3T3MA 3IUJA 3JZGA 2VDLA 3SCYA 4U1EI 4PNKB 3HFQA 4UI9R 1XIPA 5C86A 2VDRA 4WK2A 3PVWB 2H9PA 3O4JA 2I0RA 3K27A 3VH0A 2XL2A 3SHFA 3ZE1A 2BBKH 4G56B 2PM9A 5CXBB 2VZ1A 1K8KC 1M1XA 4J82A 4XYIA 4Y5RD 2PM7B 4I79A 4CI8A 4L1QD 2YMUA 4IRZA 1YFQA 3OW8A 5E6SA 4IMMA 4O02A 2CO0C 4G1EA 4O9DA 4G55A 4NAAA 1E5TA 1B9XA 2IUPA 3W15A 3IURA 4NSXA 5AFU3 3JZNA 4AMZA 4XEIC 3JZHA 2HU7A 4BUJC 3JB9L 2W18A 3IUMA 2QZPA 4Z7OA 4A0AA 2XE4A 3DM0A 2J56H 2H6KA 5EMMB 2GNQA 1B9YA 2VDMA 1QFMA 3AL8A 3U4YA 1H2WA 2YNPA 4ZOZA 2GC4A 5EMJB 4PBZA 3MZKA 3EI1B 2Z2PA 5IGQA 4A0BB 2OVRB 1VYHC 2P9LC 2VDPA 4A08A 1VE6A 1E8MA 2HJBA 3ZE0A 1QNIA 4A11B 2AGLA 3FRXA 3EU7A 1SQJA 4Z7QA 2YNNA 2EIEA 3C9CA 3IVMA 3JAMg 3MVDK 3BWSA 4J79A 1S4UX 4XYHA 3VI3A 3O4HA 2WQ8A 4A11A 4GQBB 4E54B 3UVNA 5H14A 5FKSA 2UZXB 3MUOA 5CYKB 4K3ID 3OKYA 4AOWA 3OKTA 2J57G 5GSAA 3EI1A 2HESX 2I3SA 3O4IA 2HKRA 1O6FA 5K1CC 2I0TA 4O3TB 4E5ZA 4LG8A 4A7JA 3NVXA 3SBPA 1MG3A 3SBRA 3I7PA 2B5LA 1E8NA 2IWFA 4L3HD 4U7AA 4J0XA 3PSLA 1VE7A 2IURA 4CI3A 4JSXC 1N6FA 3EI3B 5GXHA 1I2MB 5HE2B 3UVLA 3UVKA 3EWEA 4A0AB 2BKLA 2OVQB 3NIGA 3VA6A 3I7HA 1O6GA 2IUVA 4FA9D 5C2WB 3EI4A 2HYEA 1A12A 2G99A 2YNOA 1TYEA 3CFVA 2VDKA 1Q47A 4NBMA 3UVOA 5TF2A 1NEXB 3I7NA 3BG1A 4RE6A 4PBYA 1GOHA 1P22A 4ZOYA 3DXKC 4G1MA 2B4EA 2PM9B 2H6QA 2QXVA 2BCJB 5EAMA 1U4CA 5AMSA 5E6UA 1PEVA 5EALA 2VDOA 2H9NA 4QT8A 4R7AB 2B5MA 3ULEC 2VC2A 2PM6B 4BCBA 3V7DB 1BPOA 5HE3B 4JHPC 2AH1A 4GGDA 2HU5A 4A2MA 4J8GA 4CY3A 4CZXA 1GOGA 2Z2NA 5IJ8E 3IJCA 2VZ3A 1UTCA 2P9IC 3J81g 1H2YA 2G9AA 3IJEA 4ERYA 3DWLC 4AN1A 4D6VA 2YB8B 4L3GD 5M5SA 2XU7A 2QC5A 2CO0A 4Z7NA 4PSWB 4FA5D 4JD2C 3O4GA 2Q7QA 1A0RB 3T3PA 3EI2A 3RN0D 2HU8A 3C75H 3RRMC 3B7FA 3SJLD 2XYIA 4ES0A 3MKSB 4J81A 4JSNC 5FQDA 3K6SA 3RFGA 1XKSA 4FAND 5H17A 2XDWA 5HQGA 2YBAA 4ZOVA 3MMYA 3NVNA 5HE0B 5FFGA 2HJ4A 3EMHA 3MZLA 4H5JA 4X60B 4ESGA 4A0BA 1OMWB 3EG6A 2EIDA 1RI6A 5JWZA 2GC7A 3JRPA 4GGCA 5IJ7E 4FB1D 4EWRA 3OTTA 3QHYB 1L0QA 4NENA 5KDOB 1N6EA 4MMYA 3SMRA 3EI4B 3GFCA 2AH0A 2I3TA 5HE1B 4FHLA 3UR4A 3PXWD 4ERQA 3ZWLB 3IUNA 1JMXB 4K3JB 3N0EA 3PE7A 3IULA 2P9UC 1GOTB 5HDBA 5HYNB 2P9SC 5TDHB 3I2NA 4IA9A 3ODTA 5K19A 1UOQA 4A2LA 2VDNA 4QL1A 4QQEA 2OIZA 3PVUB 5FKTA 3KRXB 1N6DA 3FCUA 3CFSB 2XZGA 3SLED 2UZYB 3P4FA 4CC9A 3L4MD 5CXBA 3ZE2A 1VZ2A 3A0FA 5CYKA 1JOFA 4CY1A 4RE5A 2P9KC 3SVWD 2EIBA 1L5GA 1XHMA 3DDUA 4UM9A 4OWRA 3NVQA 3I89A 2H6NA 1GXRA 3EI3A 3IKOA 1TYQC 3F3GA 3NIDA 5C92A 3GREA 3EI2B 5EMLB 2XL3A 4UM8A 3K71A 4BCDA 3JROA 4Z8LA 3EQ7A 4GQ1A 3IJ1A 4FAVD 4J73A 4J78A 3OL2B 4D9SA 5IT9g 2QR5A 4O1QD 1JJUB 2P9NC 4J0WA 1NR0A 4DNUA 1C9IA 5FLXg 4YVDA 1JMZB 4X63B 4D0KA 3ORVD 3AL8B 4ZN4A 2TRCB 3KCIA 4JT5C 4X61B 1PI6A 1JTDB 4WK4A 3BG0A 5EM2B 3K72A
chains in the Genus database with same CATH topology
1PBYB 1ERJA 3VGZA 4J87A 4LG9A 1MG2A 5EAPA 5EMKB 4J86A 4JT6C 3AH8B 2B5NA 4JSPC 5SXMA 4JSVC 4BH6A 3PXSD 4PXWA 4OZUA 5C9ZB 1SHYB 4ZOXA 2IAAA 3AL9A 2P9PC 4N14A 4HDJA 3MXXA 4TZ4A 4Y7RA 3I7LA 3UVMA 5EM2A 3I7KA 3FM0A 4CI1A 4GQ2P 4A09A 4GM9A 1PGUA 4J77A 2H3XA 4GZ8A 4BL0A 4ERZA 2J55H 2OJYA 3PXTD 1FWXA 2CNXA 4E5ZB 3K26A 4FA1D 5CXCB 4GGAA 4GMBA 4QRJA 1GP2B 3JPXA 3I8EA 4CY2A 3RMZD 3SBQA 4X3EA 5GXIA 3C5MA 2MTAH 3FGBA 4CZYA 5B4WA 3UKRC 1SQ9A 1MDAH 3I8CA 3F3FA 4FWWA 3L4OD 4L9OA 3SWSD 3I7OA 5C2VB 3PSCB 2EBSA 4GM3A 2O9KA 2OVPB 3KRWB 5TEFA 5GMKn 5EARA 4FA4D 1K32A 2CE8A 4KFMB 2IUQA 3C99A 4A09B 2HXCA 2H14A 4GM8A 3RLMD 4LGNA 3SN6B 3J80g 4JXMA 5IGOA 4CZVA 4O45A 4H5IA 5AJAA 1GG2B 4MK0B 2Z2OA 3E0CA 2OK6A 2CN3A 3IIWA 5FKQA 3AFCA 4CI2A 5I5MA 5FA5B 4CY5A 5THAA 4PC0A 5I5IA 3MKQA 2H9MA 2OK4A 2I0SA 2CE9A 4PSXB 5IC7A 1U2VC 3RN1D 3OKWA 1TBGA 3DXMC 2H9LA 2HKMA 3V5WB 5A2Qg 4E54A 3RSEC 4J84A 4J8BA 3IIYA 3SXTD 5I5JA 2IWKA 3F3PA 3DSMA 2PBIB 2H68A 4O3UB 2AGXA 2AQ5A 4AEZA 3V9FA 3RFHA 5H1MA 3UKUC 2AGZA 3IJ0A 1OLZA 5TEEA 2AGWA 5FKRA 4A08B 3CIKB 2H13A 3N0DA 3OL2A 3SFZA 5CXCA 3OKYB 2H47A 5FXYA 2CN2A 2AGYA 1R5MA 3JZGA 3SCYA 4U1EI 4PNKB 3HFQA 4UI9R 1XIPA 3PVWB 2H9PA 2I0RA 3K27A 3VH0A 2XL2A 3SHFA 2BBKH 4G56B 2PM9A 5CXBB 1K8KC 4J82A 4XYIA 4Y5RD 2PM7B 4I79A 4CI8A 4L1QD 2YMUA 1YFQA 3OW8A 4IMMA 2CO0C 4O9DA 1B9XA 2IUPA 3W15A 4NSXA 5AFU3 3JZNA 4XEIC 3JZHA 4BUJC 3JB9L 2W18A 4A0AA 3DM0A 2J56H 2H6KA 5EMMB 2GNQA 1B9YA 3AL8A 3U4YA 2YNPA 4ZOZA 2GC4A 5EMJB 4PBZA 3MZKA 3EI1B 2Z2PA 5IGQA 4A0BB 2OVRB 1VYHC 2P9LC 4A08A 2HJBA 1QNIA 4A11B 2AGLA 3FRXA 3EU7A 1SQJA 2YNNA 3C9CA 3JAMg 3BWSA 4J79A 1S4UX 4XYHA 4A11A 4GQBB 4E54B 3UVNA 5H14A 5FKSA 2UZXB 5CYKB 4K3ID 3OKYA 4AOWA 3OKTA 2J57G 5GSAA 3EI1A 2HESX 2I3SA 2HKRA 5K1CC 2I0TA 4O3TB 4E5ZA 4LG8A 4A7JA 3NVXA 3SBPA 1MG3A 3SBRA 3I7PA 2B5LA 2IWFA 4L3HD 4U7AA 4J0XA 3PSLA 2IURA 4CI3A 4JSXC 1N6FA 3EI3B 5GXHA 5HE2B 3UVLA 3UVKA 3EWEA 4A0AB 2OVQB 3VA6A 3I7HA 2IUVA 4FA9D 5C2WB 3EI4A 2HYEA 2G99A 2YNOA 3CFVA 1Q47A 3UVOA 5TF2A 1NEXB 3I7NA 3BG1A 4PBYA 1P22A 4ZOYA 3DXKC 2B4EA 2PM9B 2H6QA 2QXVA 2BCJB 5EAMA 1U4CA 5AMSA 1PEVA 5EALA 2H9NA 4QT8A 4R7AB 2B5MA 3ULEC 2PM6B 3V7DB 5HE3B 2AH1A 4GGDA 4A2MA 4J8GA 4CY3A 4CZXA 2Z2NA 5IJ8E 3IJCA 2P9IC 3J81g 2G9AA 4ERYA 3DWLC 4D6VA 2YB8B 4L3GD 2XU7A 2QC5A 2CO0A 4PSWB 4FA5D 4JD2C 2Q7QA 1A0RB 3EI2A 3RN0D 3C75H 3RRMC 3B7FA 3SJLD 2XYIA 4ES0A 3MKSB 4J81A 4JSNC 5FQDA 3RFGA 1XKSA 4FAND 5H17A 5HQGA 2YBAA 4ZOVA 3MMYA 3NVNA 5HE0B 2HJ4A 3EMHA 3MZLA 4H5JA 4X60B 4ESGA 4A0BA 1OMWB 3EG6A 1RI6A 5JWZA 2GC7A 3JRPA 4GGCA 5IJ7E 4FB1D 4EWRA 3OTTA 1L0QA 5KDOB 1N6EA 3SMRA 3EI4B 3GFCA 2AH0A 2I3TA 5HE1B 4FHLA 3UR4A 3PXWD 4ERQA 3ZWLB 1JMXB 4K3JB 3N0EA 3PE7A 2P9UC 1GOTB 5HYNB 2P9SC 5TDHB 3I2NA 4IA9A 3ODTA 5K19A 4A2LA 4QQEA 4QL1A 2OIZA 3PVUB 5FKTA 3KRXB 1N6DA 3CFSB 3SLED 2UZYB 3P4FA 4CC9A 3L4MD 5CXBA 3A0FA 5CYKA 1JOFA 4CY1A 2P9KC 3SVWD 1XHMA 4OWRA 3NVQA 3I89A 2H6NA 1GXRA 3EI3A 3IKOA 1TYQC 3F3GA 3GREA 3EI2B 5EMLB 2XL3A 3JROA 4Z8LA 4GQ1A 3IJ1A 4FAVD 4J73A 4J78A 3OL2B 5IT9g 4O1QD 1JJUB 2P9NC 4J0WA 1NR0A 5FLXg 4YVDA 1JMZB 4X63B 4D0KA 3ORVD 3AL8B 4ZN4A 2TRCB 4JT5C 4X61B 1PI6A 3BG0A 5EM2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBY B;  1ERJ A;  3VGZ A;  4J87 A;  4LG9 A;  1MG2 A;  5EAP A;  5EMK B;  4J86 A;  4JT6 C;  3AH8 B;  2B5N A;  4JSP C;  5SXM A;  4JSV C;  4BH6 A;  3PXS D;  4PXW A;  4OZU A;  5C9Z B;  1SHY B;  4ZOX A;  2IAA A;  3AL9 A;  2P9P C;  4N14 A;  4HDJ A;  3MXX A;  4TZ4 A;  4Y7R A;  3I7L A;  3UVM A;  5EM2 A;  3I7K A;  3FM0 A;  4CI1 A;  4GQ2 P;  4A09 A;  4GM9 A;  1PGU A;  4J77 A;  2H3X A;  4GZ8 A;  4BL0 A;  4ERZ A;  2J55 H;  2OJY A;  3PXT D;  1FWX A;  2CNX A;  4E5Z B;  3K26 A;  4FA1 D;  5CXC B;  4GGA A;  4GMB A;  4QRJ A;  1GP2 B;  3JPX A;  3I8E A;  4CY2 A;  3RMZ D;  3SBQ A;  4X3E A;  5GXI A;  3C5M A;  2MTA H;  3FGB A;  4CZY A;  5B4W A;  3UKR C;  1SQ9 A;  1MDA H;  3I8C A;  3F3F A;  4FWW A;  3L4O D;  4L9O A;  3SWS D;  3I7O A;  5C2V B;  3PSC B;  2EBS A;  4GM3 A;  2O9K A;  2OVP B;  3KRW B;  5TEF A;  5GMK n;  5EAR A;  4FA4 D;  1K32 A;  2CE8 A;  4KFM B;  2IUQ A;  3C99 A;  4A09 B;  2HXC A;  2H14 A;  4GM8 A;  3RLM D;  4LGN A;  3SN6 B;  3J80 g;  4JXM A;  5IGO A;  4CZV A;  4O45 A;  4H5I A;  5AJA A;  1GG2 B;  4MK0 B;  2Z2O A;  3E0C A;  2OK6 A;  2CN3 A;  3IIW A;  5FKQ A;  3AFC A;  4CI2 A;  5I5M A;  5FA5 B;  4CY5 A;  5THA A;  4PC0 A;  5I5I A;  3MKQ A;  2H9M A;  2OK4 A;  2I0S A;  2CE9 A;  4PSX B;  5IC7 A;  1U2V C;  3RN1 D;  3OKW A;  1TBG A;  3DXM C;  2H9L A;  2HKM A;  3V5W B;  5A2Q g;  4E54 A;  3RSE C;  4J84 A;  4J8B A;  3IIY A;  3SXT D;  5I5J A;  2IWK A;  3F3P A;  3DSM A;  2PBI B;  2H68 A;  4O3U B;  2AGX A;  2AQ5 A;  4AEZ A;  3V9F A;  3RFH A;  5H1M A;  3UKU C;  2AGZ A;  3IJ0 A;  1OLZ A;  5TEE A;  2AGW A;  5FKR A;  4A08 B;  3CIK B;  2H13 A;  3N0D A;  3OL2 A;  3SFZ A;  5CXC A;  3OKY B;  2H47 A;  5FXY A;  2CN2 A;  2AGY A;  1R5M A;  3JZG A;  3SCY A;  4U1E I;  4PNK B;  3HFQ A;  4UI9 R;  1XIP A;  3PVW B;  2H9P A;  2I0R A;  3K27 A;  3VH0 A;  2XL2 A;  3SHF A;  2BBK H;  4G56 B;  2PM9 A;  5CXB B;  1K8K C;  4J82 A;  4XYI A;  4Y5R D;  2PM7 B;  4I79 A;  4CI8 A;  4L1Q D;  2YMU A;  1YFQ A;  3OW8 A;  4IMM A;  2CO0 C;  4O9D A;  1B9X A;  2IUP A;  3W15 A;  4NSX A;  5AFU 3;  3JZN A;  4XEI C;  3JZH A;  4BUJ C;  3JB9 L;  2W18 A;  4A0A A;  3DM0 A;  2J56 H;  2H6K A;  5EMM B;  2GNQ A;  1B9Y A;  3AL8 A;  3U4Y A;  2YNP A;  4ZOZ A;  2GC4 A;  5EMJ B;  4PBZ A;  3MZK A;  3EI1 B;  2Z2P A;  5IGQ A;  4A0B B;  2OVR B;  1VYH C;  2P9L C;  4A08 A;  2HJB A;  1QNI A;  4A11 B;  2AGL A;  3FRX A;  3EU7 A;  1SQJ A;  2YNN A;  3C9C A;  3JAM g;  3BWS A;  4J79 A;  1S4U X;  4XYH A;  4A11 A;  4GQB B;  4E54 B;  3UVN A;  5H14 A;  5FKS A;  2UZX B;  5CYK B;  4K3I D;  3OKY A;  4AOW A;  3OKT A;  2J57 G;  5GSA A;  3EI1 A;  2HES X;  2I3S A;  2HKR A;  5K1C C;  2I0T A;  4O3T B;  4E5Z A;  4LG8 A;  4A7J A;  3NVX A;  3SBP A;  1MG3 A;  3SBR A;  3I7P A;  2B5L A;  2IWF A;  4L3H D;  4U7A A;  4J0X A;  3PSL A;  2IUR A;  4CI3 A;  4JSX C;  1N6F A;  3EI3 B;  5GXH A;  5HE2 B;  3UVL A;  3UVK A;  3EWE A;  4A0A B;  2OVQ B;  3VA6 A;  3I7H A;  2IUV A;  4FA9 D;  5C2W B;  3EI4 A;  2HYE A;  2G99 A;  2YNO A;  3CFV A;  1Q47 A;  3UVO A;  5TF2 A;  1NEX B;  3I7N A;  3BG1 A;  4PBY A;  1P22 A;  4ZOY A;  3DXK C;  2B4E A;  2PM9 B;  2H6Q A;  2QXV A;  2BCJ B;  5EAM A;  1U4C A;  5AMS A;  1PEV A;  5EAL A;  2H9N A;  4QT8 A;  4R7A B;  2B5M A;  3ULE C;  2PM6 B;  3V7D B;  5HE3 B;  2AH1 A;  4GGD A;  4A2M A;  4J8G A;  4CY3 A;  4CZX A;  2Z2N A;  5IJ8 E;  3IJC A;  2P9I C;  3J81 g;  2G9A A;  4ERY A;  3DWL C;  4D6V A;  2YB8 B;  4L3G D;  2XU7 A;  2QC5 A;  2CO0 A;  4PSW B;  4FA5 D;  4JD2 C;  2Q7Q A;  1A0R B;  3EI2 A;  3RN0 D;  3C75 H;  3RRM C;  3B7F A;  3SJL D;  2XYI A;  4ES0 A;  3MKS B;  4J81 A;  4JSN C;  5FQD A;  3RFG A;  1XKS A;  4FAN D;  5H17 A;  5HQG A;  2YBA A;  4ZOV A;  3MMY A;  3NVN A;  5HE0 B;  2HJ4 A;  3EMH A;  3MZL A;  4H5J A;  4X60 B;  4ESG A;  4A0B A;  1OMW B;  3EG6 A;  1RI6 A;  5JWZ A;  2GC7 A;  3JRP A;  4GGC A;  5IJ7 E;  4FB1 D;  4EWR A;  3OTT A;  1L0Q A;  5KDO B;  1N6E A;  3SMR A;  3EI4 B;  3GFC A;  2AH0 A;  2I3T A;  5HE1 B;  4FHL A;  3UR4 A;  3PXW D;  4ERQ A;  3ZWL B;  1JMX B;  4K3J B;  3N0E A;  3PE7 A;  2P9U C;  1GOT B;  5HYN B;  2P9S C;  5TDH B;  3I2N A;  4IA9 A;  3ODT A;  5K19 A;  4A2L A;  4QQE A;  4QL1 A;  2OIZ A;  3PVU B;  5FKT A;  3KRX B;  1N6D A;  3CFS B;  3SLE D;  2UZY B;  3P4F A;  4CC9 A;  3L4M D;  5CXB A;  3A0F A;  5CYK A;  1JOF A;  4CY1 A;  2P9K C;  3SVW D;  1XHM A;  4OWR A;  3NVQ A;  3I89 A;  2H6N A;  1GXR A;  3EI3 A;  3IKO A;  1TYQ C;  3F3G A;  3GRE A;  3EI2 B;  5EML B;  2XL3 A;  3JRO A;  4Z8L A;  4GQ1 A;  3IJ1 A;  4FAV D;  4J73 A;  4J78 A;  3OL2 B;  5IT9 g;  4O1Q D;  1JJU B;  2P9N C;  4J0W A;  1NR0 A;  5FLX g;  4YVD A;  1JMZ B;  4X63 B;  4D0K A;  3ORV D;  3AL8 B;  4ZN4 A;  2TRC B;  4JT5 C;  4X61 B;  1PI6 A;  3BG0 A;  5EM2 B; 
#chains in the Genus database with same CATH topology
 1PBY B;  1ERJ A;  5E6R A;  3VGZ A;  4J87 A;  4LG9 A;  1MG2 A;  3IUQ A;  1K3I A;  5EAP A;  1T2X A;  5EMK B;  4J86 A;  4JT6 C;  3AH8 B;  2B5N A;  4JSP C;  5SXM A;  4JSV C;  4BH6 A;  3ZDY A;  4L1M A;  3PXS D;  4O2W A;  4PXW A;  3FCS A;  4OZU A;  5C9Z B;  2VDQ A;  1SHY B;  1VZ3 A;  4ZOX A;  4BCC A;  2IAA A;  3AL9 A;  2P9P C;  1H2X A;  4N14 A;  4HDJ A;  3MXX A;  4TZ4 A;  4Y7R A;  3I7L A;  3UVM A;  5EM2 A;  2EIC A;  3I7K A;  3FM0 A;  1JV2 A;  4CI1 A;  4GQ2 P;  4AMY A;  4GM9 A;  4A09 A;  1PGU A;  4J77 A;  2H3X A;  4MMZ A;  4GZ8 A;  4BL0 A;  3GD1 I;  4ERZ A;  2J55 H;  2OJY A;  3PXT D;  1FWX A;  2CNX A;  4E5Z B;  4AX4 A;  3K26 A;  4WJK A;  4FA1 D;  5CXC B;  4AN0 A;  4GGA A;  1YR2 A;  4GMB A;  4QRJ A;  1GP2 B;  3JPX A;  3I8E A;  4CY2 A;  3RMZ D;  3VI4 A;  3SBQ A;  4X3E A;  4DNV A;  5GXI A;  3C5M A;  2MTA H;  3FGB A;  4CZY A;  5B4W A;  3UKR C;  1SQ9 A;  1MDA H;  3I8C A;  3F3F A;  4FWW A;  5M5V A;  3L4O D;  1QFS A;  4L9O A;  3SWS D;  3I7O A;  5C2V B;  5M5R A;  3PSC B;  2EBS A;  4JHN A;  2JKX A;  4GM3 A;  2O9K A;  2OVP B;  3KRW B;  5TEF A;  3NIF A;  4QAM A;  5GMK n;  5EAR A;  4BP9 A;  4FA4 D;  1K32 A;  2CE8 A;  4KFM B;  2IUQ A;  3C99 A;  1U8C A;  4A09 B;  2HXC A;  2H14 A;  3EQ9 A;  3MUN A;  4GM8 A;  1GOF A;  3RLM D;  1H2Z A;  4LGN A;  3SN6 B;  1UOO A;  3J80 g;  4JXM A;  5IGO A;  4CZV A;  4O45 A;  4H5I A;  1GG2 B;  4MK0 B;  5AJA A;  2Z2O A;  3E0C A;  2OK6 A;  1UOP A;  2CN3 A;  3IIW A;  3EQ8 A;  5FKQ A;  3AFC A;  4CI2 A;  5I5M A;  5FA5 B;  4CY5 A;  3ZDX A;  5THA A;  4PC0 A;  5I5I A;  3MKQ A;  2H9M A;  4BP8 A;  2OK4 A;  2I0S A;  4DNW A;  2CE9 A;  4PSX B;  5IC7 A;  1C9L A;  4WK0 A;  1U2V C;  3RN1 D;  3OKW A;  1TBG A;  5M61 A;  3DXM C;  2H9L A;  2HKM A;  3V5W B;  5A2Q g;  4E54 A;  3V4V A;  3RSE C;  4J84 A;  4J8B A;  3IIY A;  3SXT D;  5M5U A;  3ZDZ A;  5I5J A;  2IWK A;  3F3P A;  3DSM A;  4NC4 A;  2PBI B;  2H68 A;  4O3U B;  2AGX A;  2AQ5 A;  3QI0 A;  4AEZ A;  5M5T A;  3V4P A;  3V9F A;  3RFH A;  5H1M A;  3UKU C;  2AGZ A;  3IJ0 A;  1OLZ A;  5TEE A;  2AGW A;  5FKR A;  4A08 B;  3CIK B;  2H13 A;  3N0D A;  3OL2 A;  3SFZ A;  3GC3 B;  5CXC A;  3OKY B;  2H47 A;  5FFO A;  5FXY A;  3OF7 A;  2CN2 A;  4MMX A;  2AGY A;  1R5M A;  3T3M A;  3IUJ A;  3JZG A;  2VDL A;  3SCY A;  4U1E I;  4PNK B;  3HFQ A;  4UI9 R;  1XIP A;  5C86 A;  2VDR A;  4WK2 A;  3PVW B;  2H9P A;  3O4J A;  2I0R A;  3K27 A;  3VH0 A;  2XL2 A;  3SHF A;  3ZE1 A;  2BBK H;  4G56 B;  2PM9 A;  5CXB B;  2VZ1 A;  1K8K C;  1M1X A;  4J82 A;  4XYI A;  4Y5R D;  2PM7 B;  4I79 A;  4CI8 A;  4L1Q D;  2YMU A;  4IRZ A;  1YFQ A;  3OW8 A;  5E6S A;  4IMM A;  4O02 A;  2CO0 C;  4G1E A;  4O9D A;  4G55 A;  4NAA A;  1E5T A;  1B9X A;  2IUP A;  3W15 A;  3IUR A;  4NSX A;  5AFU 3;  3JZN A;  4AMZ A;  4XEI C;  3JZH A;  2HU7 A;  4BUJ C;  3JB9 L;  2W18 A;  3IUM A;  2QZP A;  4Z7O A;  4A0A A;  2XE4 A;  3DM0 A;  2J56 H;  2H6K A;  5EMM B;  2GNQ A;  1B9Y A;  2VDM A;  1QFM A;  3AL8 A;  3U4Y A;  1H2W A;  2YNP A;  4ZOZ A;  2GC4 A;  5EMJ B;  4PBZ A;  3MZK A;  3EI1 B;  2Z2P A;  5IGQ A;  4A0B B;  2OVR B;  1VYH C;  2P9L C;  2VDP A;  4A08 A;  1VE6 A;  1E8M A;  2HJB A;  3ZE0 A;  1QNI A;  4A11 B;  2AGL A;  3FRX A;  3EU7 A;  1SQJ A;  4Z7Q A;  2YNN A;  2EIE A;  3C9C A;  3IVM A;  3JAM g;  3MVD K;  3BWS A;  4J79 A;  1S4U X;  4XYH A;  3VI3 A;  3O4H A;  2WQ8 A;  4A11 A;  4GQB B;  4E54 B;  3UVN A;  5H14 A;  5FKS A;  2UZX B;  3MUO A;  5CYK B;  4K3I D;  3OKY A;  4AOW A;  3OKT A;  2J57 G;  5GSA A;  3EI1 A;  2HES X;  2I3S A;  3O4I A;  2HKR A;  1O6F A;  5K1C C;  2I0T A;  4O3T B;  4E5Z A;  4LG8 A;  4A7J A;  3NVX A;  3SBP A;  1MG3 A;  3SBR A;  3I7P A;  2B5L A;  1E8N A;  2IWF A;  4L3H D;  4U7A A;  4J0X A;  3PSL A;  1VE7 A;  2IUR A;  4CI3 A;  4JSX C;  1N6F A;  3EI3 B;  5GXH A;  1I2M B;  5HE2 B;  3UVL A;  3UVK A;  3EWE A;  4A0A B;  2BKL A;  2OVQ B;  3NIG A;  3VA6 A;  3I7H A;  1O6G A;  2IUV A;  4FA9 D;  5C2W B;  3EI4 A;  2HYE A;  1A12 A;  2G99 A;  2YNO A;  1TYE A;  3CFV A;  2VDK A;  1Q47 A;  4NBM A;  3UVO A;  5TF2 A;  1NEX B;  3I7N A;  3BG1 A;  4RE6 A;  4PBY A;  1GOH A;  1P22 A;  4ZOY A;  3DXK C;  4G1M A;  2B4E A;  2PM9 B;  2H6Q A;  2QXV A;  2BCJ B;  5EAM A;  1U4C A;  5AMS A;  5E6U A;  1PEV A;  5EAL A;  2VDO A;  2H9N A;  4QT8 A;  4R7A B;  2B5M A;  3ULE C;  2VC2 A;  2PM6 B;  4BCB A;  3V7D B;  1BPO A;  5HE3 B;  4JHP C;  2AH1 A;  4GGD A;  2HU5 A;  4A2M A;  4J8G A;  4CY3 A;  4CZX A;  1GOG A;  2Z2N A;  5IJ8 E;  3IJC A;  2VZ3 A;  1UTC A;  2P9I C;  3J81 g;  1H2Y A;  2G9A A;  3IJE A;  4ERY A;  3DWL C;  4AN1 A;  4D6V A;  2YB8 B;  4L3G D;  5M5S A;  2XU7 A;  2QC5 A;  2CO0 A;  4Z7N A;  4PSW B;  4FA5 D;  4JD2 C;  3O4G A;  2Q7Q A;  1A0R B;  3T3P A;  3EI2 A;  3RN0 D;  2HU8 A;  3C75 H;  3RRM C;  3B7F A;  3SJL D;  2XYI A;  4ES0 A;  3MKS B;  4J81 A;  4JSN C;  5FQD A;  3K6S A;  3RFG A;  1XKS A;  4FAN D;  5H17 A;  2XDW A;  5HQG A;  2YBA A;  4ZOV A;  3MMY A;  3NVN A;  5HE0 B;  5FFG A;  2HJ4 A;  3EMH A;  3MZL A;  4H5J A;  4X60 B;  4ESG A;  4A0B A;  1OMW B;  3EG6 A;  2EID A;  1RI6 A;  5JWZ A;  2GC7 A;  3JRP A;  4GGC A;  5IJ7 E;  4FB1 D;  4EWR A;  3OTT A;  3QHY B;  1L0Q A;  4NEN A;  5KDO B;  1N6E A;  4MMY A;  3SMR A;  3EI4 B;  3GFC A;  2AH0 A;  2I3T A;  5HE1 B;  4FHL A;  3UR4 A;  3PXW D;  4ERQ A;  3ZWL B;  3IUN A;  1JMX B;  4K3J B;  3N0E A;  3PE7 A;  3IUL A;  2P9U C;  1GOT B;  5HDB A;  5HYN B;  2P9S C;  5TDH B;  3I2N A;  4IA9 A;  3ODT A;  5K19 A;  1UOQ A;  4A2L A;  2VDN A;  4QL1 A;  4QQE A;  2OIZ A;  3PVU B;  5FKT A;  3KRX B;  1N6D A;  3FCU A;  3CFS B;  2XZG A;  3SLE D;  2UZY B;  3P4F A;  4CC9 A;  3L4M D;  5CXB A;  3ZE2 A;  1VZ2 A;  3A0F A;  5CYK A;  1JOF A;  4CY1 A;  4RE5 A;  2P9K C;  3SVW D;  2EIB A;  1L5G A;  1XHM A;  3DDU A;  4UM9 A;  4OWR A;  3NVQ A;  3I89 A;  2H6N A;  1GXR A;  3EI3 A;  3IKO A;  1TYQ C;  3F3G A;  3NID A;  5C92 A;  3GRE A;  3EI2 B;  5EML B;  2XL3 A;  4UM8 A;  3K71 A;  4BCD A;  3JRO A;  4Z8L A;  3EQ7 A;  4GQ1 A;  3IJ1 A;  4FAV D;  4J73 A;  4J78 A;  3OL2 B;  4D9S A;  5IT9 g;  2QR5 A;  4O1Q D;  1JJU B;  2P9N C;  4J0W A;  1NR0 A;  4DNU A;  1C9I A;  5FLX g;  4YVD A;  1JMZ B;  4X63 B;  4D0K A;  3ORV D;  3AL8 B;  4ZN4 A;  2TRC B;  3KCI A;  4JT5 C;  4X61 B;  1PI6 A;  1JTD B;  4WK4 A;  3BG0 A;  5EM2 B;  3K72 A; 
#chains in the Genus database with same CATH homology
 1PBY B;  1ERJ A;  3VGZ A;  4J87 A;  4LG9 A;  1MG2 A;  5EAP A;  5EMK B;  4J86 A;  4JT6 C;  3AH8 B;  2B5N A;  4JSP C;  5SXM A;  4JSV C;  4BH6 A;  3PXS D;  4PXW A;  4OZU A;  5C9Z B;  1SHY B;  4ZOX A;  2IAA A;  3AL9 A;  2P9P C;  4N14 A;  4HDJ A;  3MXX A;  4TZ4 A;  4Y7R A;  3I7L A;  3UVM A;  5EM2 A;  3I7K A;  3FM0 A;  4CI1 A;  4GQ2 P;  4A09 A;  4GM9 A;  1PGU A;  4J77 A;  2H3X A;  4GZ8 A;  4BL0 A;  4ERZ A;  2J55 H;  2OJY A;  3PXT D;  1FWX A;  2CNX A;  4E5Z B;  3K26 A;  4FA1 D;  5CXC B;  4GGA A;  4GMB A;  4QRJ A;  1GP2 B;  3JPX A;  3I8E A;  4CY2 A;  3RMZ D;  3SBQ A;  4X3E A;  5GXI A;  3C5M A;  2MTA H;  3FGB A;  4CZY A;  5B4W A;  3UKR C;  1SQ9 A;  1MDA H;  3I8C A;  3F3F A;  4FWW A;  3L4O D;  4L9O A;  3SWS D;  3I7O A;  5C2V B;  3PSC B;  2EBS A;  4GM3 A;  2O9K A;  2OVP B;  3KRW B;  5TEF A;  5GMK n;  5EAR A;  4FA4 D;  1K32 A;  2CE8 A;  4KFM B;  2IUQ A;  3C99 A;  4A09 B;  2HXC A;  2H14 A;  4GM8 A;  3RLM D;  4LGN A;  3SN6 B;  3J80 g;  4JXM A;  5IGO A;  4CZV A;  4O45 A;  4H5I A;  5AJA A;  1GG2 B;  4MK0 B;  2Z2O A;  3E0C A;  2OK6 A;  2CN3 A;  3IIW A;  5FKQ A;  3AFC A;  4CI2 A;  5I5M A;  5FA5 B;  4CY5 A;  5THA A;  4PC0 A;  5I5I A;  3MKQ A;  2H9M A;  2OK4 A;  2I0S A;  2CE9 A;  4PSX B;  5IC7 A;  1U2V C;  3RN1 D;  3OKW A;  1TBG A;  3DXM C;  2H9L A;  2HKM A;  3V5W B;  5A2Q g;  4E54 A;  3RSE C;  4J84 A;  4J8B A;  3IIY A;  3SXT D;  5I5J A;  2IWK A;  3F3P A;  3DSM A;  2PBI B;  2H68 A;  4O3U B;  2AGX A;  2AQ5 A;  4AEZ A;  3V9F A;  3RFH A;  5H1M A;  3UKU C;  2AGZ A;  3IJ0 A;  1OLZ A;  5TEE A;  2AGW A;  5FKR A;  4A08 B;  3CIK B;  2H13 A;  3N0D A;  3OL2 A;  3SFZ A;  5CXC A;  3OKY B;  2H47 A;  5FXY A;  2CN2 A;  2AGY A;  1R5M A;  3JZG A;  3SCY A;  4U1E I;  4PNK B;  3HFQ A;  4UI9 R;  1XIP A;  3PVW B;  2H9P A;  2I0R A;  3K27 A;  3VH0 A;  2XL2 A;  3SHF A;  2BBK H;  4G56 B;  2PM9 A;  5CXB B;  1K8K C;  4J82 A;  4XYI A;  4Y5R D;  2PM7 B;  4I79 A;  4CI8 A;  4L1Q D;  2YMU A;  1YFQ A;  3OW8 A;  4IMM A;  2CO0 C;  4O9D A;  1B9X A;  2IUP A;  3W15 A;  4NSX A;  5AFU 3;  3JZN A;  4XEI C;  3JZH A;  4BUJ C;  3JB9 L;  2W18 A;  4A0A A;  3DM0 A;  2J56 H;  2H6K A;  5EMM B;  2GNQ A;  1B9Y A;  3AL8 A;  3U4Y A;  2YNP A;  4ZOZ A;  2GC4 A;  5EMJ B;  4PBZ A;  3MZK A;  3EI1 B;  2Z2P A;  5IGQ A;  4A0B B;  2OVR B;  1VYH C;  2P9L C;  4A08 A;  2HJB A;  1QNI A;  4A11 B;  2AGL A;  3FRX A;  3EU7 A;  1SQJ A;  2YNN A;  3C9C A;  3JAM g;  3BWS A;  4J79 A;  1S4U X;  4XYH A;  4A11 A;  4GQB B;  4E54 B;  3UVN A;  5H14 A;  5FKS A;  2UZX B;  5CYK B;  4K3I D;  3OKY A;  4AOW A;  3OKT A;  2J57 G;  5GSA A;  3EI1 A;  2HES X;  2I3S A;  2HKR A;  5K1C C;  2I0T A;  4O3T B;  4E5Z A;  4LG8 A;  4A7J A;  3NVX A;  3SBP A;  1MG3 A;  3SBR A;  3I7P A;  2B5L A;  2IWF A;  4L3H D;  4U7A A;  4J0X A;  3PSL A;  2IUR A;  4CI3 A;  4JSX C;  1N6F A;  3EI3 B;  5GXH A;  5HE2 B;  3UVL A;  3UVK A;  3EWE A;  4A0A B;  2OVQ B;  3VA6 A;  3I7H A;  2IUV A;  4FA9 D;  5C2W B;  3EI4 A;  2HYE A;  2G99 A;  2YNO A;  3CFV A;  1Q47 A;  3UVO A;  5TF2 A;  1NEX B;  3I7N A;  3BG1 A;  4PBY A;  1P22 A;  4ZOY A;  3DXK C;  2B4E A;  2PM9 B;  2H6Q A;  2QXV A;  2BCJ B;  5EAM A;  1U4C A;  5AMS A;  1PEV A;  5EAL A;  2H9N A;  4QT8 A;  4R7A B;  2B5M A;  3ULE C;  2PM6 B;  3V7D B;  5HE3 B;  2AH1 A;  4GGD A;  4A2M A;  4J8G A;  4CY3 A;  4CZX A;  2Z2N A;  5IJ8 E;  3IJC A;  2P9I C;  3J81 g;  2G9A A;  4ERY A;  3DWL C;  4D6V A;  2YB8 B;  4L3G D;  2XU7 A;  2QC5 A;  2CO0 A;  4PSW B;  4FA5 D;  4JD2 C;  2Q7Q A;  1A0R B;  3EI2 A;  3RN0 D;  3C75 H;  3RRM C;  3B7F A;  3SJL D;  2XYI A;  4ES0 A;  3MKS B;  4J81 A;  4JSN C;  5FQD A;  3RFG A;  1XKS A;  4FAN D;  5H17 A;  5HQG A;  2YBA A;  4ZOV A;  3MMY A;  3NVN A;  5HE0 B;  2HJ4 A;  3EMH A;  3MZL A;  4H5J A;  4X60 B;  4ESG A;  4A0B A;  1OMW B;  3EG6 A;  1RI6 A;  5JWZ A;  2GC7 A;  3JRP A;  4GGC A;  5IJ7 E;  4FB1 D;  4EWR A;  3OTT A;  1L0Q A;  5KDO B;  1N6E A;  3SMR A;  3EI4 B;  3GFC A;  2AH0 A;  2I3T A;  5HE1 B;  4FHL A;  3UR4 A;  3PXW D;  4ERQ A;  3ZWL B;  1JMX B;  4K3J B;  3N0E A;  3PE7 A;  2P9U C;  1GOT B;  5HYN B;  2P9S C;  5TDH B;  3I2N A;  4IA9 A;  3ODT A;  5K19 A;  4A2L A;  4QQE A;  4QL1 A;  2OIZ A;  3PVU B;  5FKT A;  3KRX B;  1N6D A;  3CFS B;  3SLE D;  2UZY B;  3P4F A;  4CC9 A;  3L4M D;  5CXB A;  3A0F A;  5CYK A;  1JOF A;  4CY1 A;  2P9K C;  3SVW D;  1XHM A;  4OWR A;  3NVQ A;  3I89 A;  2H6N A;  1GXR A;  3EI3 A;  3IKO A;  1TYQ C;  3F3G A;  3GRE A;  3EI2 B;  5EML B;  2XL3 A;  3JRO A;  4Z8L A;  4GQ1 A;  3IJ1 A;  4FAV D;  4J73 A;  4J78 A;  3OL2 B;  5IT9 g;  4O1Q D;  1JJU B;  2P9N C;  4J0W A;  1NR0 A;  5FLX g;  4YVD A;  1JMZ B;  4X63 B;  4D0K A;  3ORV D;  3AL8 B;  4ZN4 A;  2TRC B;  4JT5 C;  4X61 B;  1PI6 A;  3BG0 A;  5EM2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...