4BH6A

Insights into degron recognition by apc coactivators from the structure of an acm1-cdh1 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
304
structure length
304
Chain Sequence
RQIAKVPYRVLDAPSLADDFYYSLIDWSSTDVLAVALGKSIFLTDNNTGDVVHLCDTENEYTSLSWIGAGSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords APC/C ACTIVATOR PROTEIN CDH1
publication title Insights Into Degron Recognition by Apc/C Coactivators from the Structure of an Acm1-Cdh1 Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 88
structure length 304
sequence length 304
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4bh6A00
2OVPB 4ZN4A 1N6EA 4ESGA 4GZ8A 3VA6A 4CI2A 2YMUA 2MTAH 2B4EA 4TZ4A 1N6DA 5HE0B 3EI4B 4HDJA 2YNPA 2PM7B 3F3PA 4O3TB 2B5LA 3PXWD 1R5MA 4FHLA 4ERZA 5CXCA 4GGCA 1N6FA 1MDAH 5EAMA 3GREA 3N0EA 3NVQA 4J73A 2H9PA 2H68A 5FKRA 4FB1D 4H5JA 2IURA 2J57G 4ERQA 3EI2A 5GXHA 3OKWA 4ZOVA 2OK4A 4A2MA 4ZOZA 3JROA 2QXVA 3JZHA 4AEZA 2CO0A 4A7JA 2HJBA 4O3UB 2CE8A 2P9NC 4CI8A 1P22A 1JJUB 3IJCA 4X61B 2B5NA 3EI3B 3U4YA 5HE2B 4A0AA 1JMZB 3IJ0A 3PE7A 3RN0D 3AFCA 3JPXA 3UVLA 2GNQA 4G56B 5EMLB 3RFGA 3I8CA 5EMMB 3IIWA 2B5MA 5IC7A 4J0WA 5AJAA 3I7OA 2IUQA 4JSNC 5IGOA 4ZOYA 2O9KA 4J0XA 4JSPC 2EBSA 3L4OD 3C99A 3I7KA 3RSEC 4PSXB 3GFCA 1JOFA 2H9NA 4J79A 4Y5RD 4X60B 3JAMg 3SBPA 4ZOXA 3PVWB 3V5WB 5CXBB 2W18A 5HE3B 4E54A 4A0BA 4ERYA 5FLXg 1QNIA 4L1QD 2HXCA 4Y7RA 3OL2B 3UVNA 2UZYB 3FGBA 2G9AA 1B9YA 4X63B 5I5MA 4FAND 2AGZA 3SCYA 4A08B 1TYQC 3OKYA 3JRPA 4BH6A 3F3FA 5JWZA 3DM0A 3PXSD 2HESX 2UZXB 5AMSA 2CO0C 3UVOA 4NSXA 5FKSA 1PBYB 4FA5D 2IUVA 3C75H 3K26A 4L3GD 4CI3A 5EM2A 3ODTA 2BCJB 1GP2B 5CXCB 5CYKA 4XYIA 4LGNA 2P9PC 2GC7A 3PSCB 5HYNB 2H6NA 1B9XA 3PXTD 4GQ1A 5EALA 4A11A 2AGLA 3EI2B 1XKSA 4CY1A 4JT6C 5A2Qg 2I0RA 3ULEC 5TDHB 3I8EA 5FXYA 5EARA 3OW8A 1GG2B 2IAAA 4X3EA 3CFVA 5H17A 2I0TA 4GMBA 4GM3A 2CE9A 4MK0B 3I2NA 2OVQB 3DXKC 2H14A 3V9FA 4CZXA 3NVNA 4A0AB 2AH0A 4J84A 3KRWB 2Q7QA 2CN3A 3OKTA 3EU7A 2Z2NA 3F3GA 3DSMA 2J55H 5C2WB 4JXMA 4PSWB 3AH8B 3JB9L 5H14A 3FM0A 1MG3A 3SLED 4FWWA 5K1CC 3SVWD 2HKMA 4CY3A 2GC4A 1A0RB 4U1EI 3MZKA 4U7AA 3CFSB 5I5JA 3J81g 3JZGA 3UVMA 2XYIA 3BWSA 4CY2A 2G99A 4E54B 5IT9g 4A0BB 3FRXA 4O45A 4J86A 3SHFA 3C5MA 3DXMC 4R7AB 1L0QA 4CY5A 3UR4A 2J56H 3SJLD 4JT5C 1K8KC 4A09A 2IWKA 2PM9A 2CN2A 2I3TA 1FWXA 1U2VC 3OKYB 2P9UC 3B7FA 3N0DA 5TEEA 4AOWA 3I7PA 3MMYA 4J87A 4OZUA 4GM9A 3JZNA 4I79A 4XYHA 2HKRA 3BG0A 3AL9A 4FAVD 1NEXB 3I7HA 4GGAA 4GQBB 3MZLA 4K3JB 3SXTD 3CIKB 4GQ2P 1OMWB 2P9LC 4UI9R 3EG6A 5EM2B 3AL8A 4EWRA 1SQ9A 5CYKB 3SFZA 1GOTB 5GMKn 5FA5B 5C2VB 5B4WA 1PI6A 2AGWA 1ERJA 3EI1A 2AGYA 4CI1A 4GGDA 4JSXC 4E5ZA 4A11B 1SQJA 3I89A 2P9IC 3PSLA 4OWRA 3RLMD 3E0CA 2I3SA 4K3ID 2H13A 4QT8A 3BG1A 5IJ8E 4D6VA 2AGXA 4CZYA 5GSAA 3UKRC 3HFQA 2YNOA 3UKUC 1GXRA 5HQGA 4CZVA 3MKQA 2IUPA 1TBGA 2H3XA 4J78A 4PXWA 1OLZA 4LG8A 4FA4D 5FKQA 1MG2A 3EI4A 3KRXB 4J82A 3A0FA 1Q47A 3SMRA 1SHYB 4QRJA 3UVKA 2AH1A 3SBRA 4LG9A 3SN6B 2CNXA 3RN1D 4BL0A 3J80g 2QC5A 4CC9A 2PBIB 5SXMA 4N14A 1JMXB 5AFU3 5H1MA 5FQDA 4PBZA 1RI6A 3IJ1A 2XL2A 1U4CA 3NVXA 4YVDA 3OTTA 2AQ5A 4A2LA 1YFQA 1K32A 2Z2PA 4IMMA 2H6KA 2H9MA 4PBYA 3L4MD 5HE1B 4J8BA 3VGZA 1PGUA 3V7DB 4H5IA 4BUJC 4D0KA 1NR0A 4A09B 4O1QD 3EI3A 2PM9B 2TRCB 3RRMC 4J77A 2YB8B 2P9KC 4J8GA 2OK6A 3SBQA 2XL3A 5FKTA 5I5IA 3DWLC 4KFMB 2YNNA 2H6QA 4J81A 4PC0A 1S4UX 3EWEA 4Z8LA 2HYEA 4QL1A 5EMJB 5TEFA 2P9SC 2YBAA 4FA1D 3P4FA 3PVUB 3SWSD 2IWFA 2I0SA 4PNKB 3I7NA 2PM6B 2OJYA 4JSVC 3I7LA 5EMKB 4IA9A 3MXXA 3AL8B 3ZWLB 4ES0A 3W15A 1PEVA 5CXBA 5IJ7E 2OVRB 3K27A 4GM8A 2XU7A 4O9DA 5EAPA 4JD2C 3EI1B 4E5ZB 5IGQA 2H9LA 2BBKH 3RMZD 4FA9D 1XHMA 3RFHA 3OL2A 4QQEA 2OIZA 5C9ZB 3IIYA 3MKSB 4L3HD 2HJ4A 2H47A 5TF2A 3IKOA 4A08A 1VYHC 5GXIA 3ORVD 5K19A 5THAA 4L9OA 3EMHA 2Z2OA 4XEIC 3C9CA 1XIPA 5KDOB 3VH0A
chains in the Genus database with same CATH superfamily
2OVPB 4ZN4A 1N6EA 4ESGA 4GZ8A 3EQ8A 3VA6A 1GOGA 4CI2A 2YMUA 2MTAH 2B4EA 4Z7NA 3IUJA 2WQ8A 4TZ4A 1N6DA 5HE0B 2VDQA 3EI4B 4HDJA 2YNPA 2PM7B 3F3PA 4O3TB 2B5LA 3NIDA 3PXWD 1R5MA 4BCCA 4FHLA 4ERZA 5CXCA 4GGCA 4UM9A 1C9LA 1N6FA 1MDAH 5EAMA 3GREA 3N0EA 3NVQA 4J73A 2H9PA 3IVMA 2H68A 5FKRA 4FB1D 4H5JA 2IURA 2J57G 4ERQA 3EI2A 5GXHA 5M5RA 3OKWA 4ZOVA 2OK4A 4A2MA 1VZ3A 4ZOZA 1E8NA 3JROA 2QXVA 3JZHA 2VDOA 4AEZA 2EICA 2CO0A 4A7JA 2HJBA 4O3UB 1VE6A 2CE8A 2P9NC 4CI8A 1P22A 1JJUB 3IJCA 4X61B 2B5NA 3IUMA 3EI3B 3NIFA 3U4YA 5HE2B 4A0AA 3MUNA 1JMZB 4D9SA 3GD1I 3IJ0A 3PE7A 3T3MA 3RN0D 3AFCA 3JPXA 3UVLA 2GNQA 4G56B 5EMLB 3RFGA 3I8CA 5EMMB 3IIWA 3NIGA 2B5MA 5IC7A 4J0WA 5AJAA 3I7OA 2IUQA 4JSNC 5IGOA 4ZOYA 4MMXA 2O9KA 4J0XA 4UM8A 4G1EA 4JSPC 4DNVA 2EBSA 3L4OD 3C99A 3I7KA 3RSEC 4PSXB 3GFCA 1JOFA 2H9NA 4J79A 4Y5RD 3OF7A 4X60B 3JAMg 5M5SA 3SBPA 1VZ2A 4ZOXA 1H2XA 3PVWB 3V5WB 5CXBB 2W18A 5HE3B 4E54A 4A0BA 4AN0A 1H2WA 2EIBA 4ERYA 5FLXg 1QNIA 3O4JA 4L1QD 2HXCA 4Y7RA 3OL2B 3UVNA 4AMYA 2UZYB 3FGBA 2G9AA 1B9YA 4X63B 5I5MA 4FAND 2AGZA 3SCYA 2HU7A 3O4HA 1UTCA 4A08B 1TYQC 3OKYA 3JRPA 2QR5A 4BH6A 3F3FA 5JWZA 2JKXA 3DM0A 3PXSD 2HESX 2UZXB 5C86A 5AMSA 2CO0C 3UVOA 2XDWA 2VDKA 4NSXA 5FKSA 1PBYB 4FA5D 2IUVA 3C75H 3K26A 4L3GD 4CI3A 4JHNA 5EM2A 3ODTA 2BCJB 1GP2B 5CXCB 5CYKA 4XYIA 4LGNA 1TYEA 2P9PC 2GC7A 3PSCB 5HYNB 3IUNA 2H6NA 1O6FA 4NBMA 1M1XA 4NC4A 1B9XA 3PXTD 4GQ1A 5EALA 4WK0A 4A11A 2AGLA 3EI2B 1XKSA 1BPOA 5FFGA 4BP9A 4CY1A 4JT6C 5A2Qg 3O4GA 2I0RA 2QZPA 2EIEA 4O02A 3ULEC 5TDHB 3ZE1A 4QAMA 3V4PA 1GOFA 3I8EA 5FXYA 5EARA 3OW8A 1GG2B 2IAAA 4X3EA 3VI4A 3CFVA 5H17A 2I0TA 4GMBA 5M5UA 4GM3A 3V4VA 1VE7A 2CE9A 4MK0B 3I2NA 2OVQB 3DXKC 2H14A 2XZGA 3V9FA 4CZXA 3NVNA 5M61A 2AH0A 4A0AB 1T2XA 4J84A 1GOHA 3KRWB 2Q7QA 2CN3A 3OKTA 3EU7A 5C92A 2Z2NA 3F3GA 3DSMA 2J55H 5C2WB 4JXMA 4PSWB 5FFOA 3AH8B 3JB9L 5H14A 3FM0A 1MG3A 3SLED 4FWWA 5K1CC 3SVWD 2HKMA 3EQ7A 4CY3A 2GC4A 1A0RB 4U1EI 3MZKA 4U7AA 3CFSB 5I5JA 3J81g 3JZGA 1O6GA 3UVMA 2XYIA 3BWSA 4CY2A 2G99A 4E54B 5IT9g 4A0BB 3VI3A 3FRXA 3ZDZA 4O45A 4J86A 3SHFA 3C5MA 3DXMC 4R7AB 1L0QA 4CY5A 1E5TA 3ZDXA 3UR4A 2J56H 3SJLD 4JT5C 1K8KC 4A09A 2IWKA 3MUOA 2PM9A 2CN2A 2VC2A 2I3TA 1FWXA 1U2VC 2VDPA 3OKYB 3IULA 2P9UC 2VDRA 3B7FA 3N0DA 5TEEA 4AOWA 3I7PA 3MMYA 4J87A 4OZUA 1U8CA 4GM9A 3JZNA 4I79A 4XYHA 2HKRA 3BG0A 3AL9A 4FAVD 1NEXB 2VZ1A 3I7HA 4GGAA 4GQBB 3MZLA 4K3JB 3SXTD 2VDNA 4NAAA 2EIDA 3CIKB 4WK4A 4GQ2P 1OMWB 2P9LC 4UI9R 3EG6A 5EM2B 4DNWA 3AL8A 4EWRA 1SQ9A 5CYKB 3SFZA 1GOTB 5E6RA 5GMKn 5FA5B 5C2VB 5B4WA 1PI6A 1QFSA 1H2ZA 2AGWA 1ERJA 3EI1A 2AGYA 4CI1A 4GGDA 4JSXC 4E5ZA 4A11B 1SQJA 3I89A 2P9IC 3PSLA 4OWRA 3RLMD 3E0CA 2I3SA 4K3ID 2H13A 1C9IA 4QT8A 3BG1A 5IJ8E 4D6VA 2AGXA 4CZYA 5GSAA 3K6SA 4MMZA 3UKRC 2HU5A 3HFQA 2YNOA 3UKUC 1GXRA 5HQGA 4CZVA 2VDLA 3MKQA 5E6SA 4WK2A 2IUPA 1TBGA 2XE4A 2H3XA 4J78A 4PXWA 1OLZA 4LG8A 5E6UA 4FA4D 5FKQA 1MG2A 3EI4A 3KRXB 4J82A 3A0FA 1Q47A 3SMRA 1SHYB 4QRJA 3DDUA 3UVKA 3O4IA 2AH1A 4IRZA 4MMYA 4LG9A 3SBRA 1QFMA 3SN6B 4AX4A 2CNXA 3RN1D 4BL0A 3J80g 2QC5A 4CC9A 2PBIB 5SXMA 4N14A 1JMXB 5AFU3 5H1MA 5FQDA 4PBZA 4WJKA 3T3PA 4Z7QA 1RI6A 3IJ1A 2XL2A 4BP8A 1U4CA 3NVXA 4YVDA 3ZDYA 3OTTA 4AN1A 2AQ5A 2BKLA 4A2LA 1YFQA 4JHPC 4NENA 1JTDB 3FCSA 1K32A 4G55A 2Z2PA 4IMMA 2H6KA 2H9MA 4PBYA 3L4MD 5HE1B 3EQ9A 3QI0A 1JV2A 4J8BA 3VGZA 1K3IA 1PGUA 3V7DB 4H5IA 1I2MB 1UOQA 4BUJC 4D0KA 1YR2A 1NR0A 4A09B 4O1QD 3IJEA 3EI3A 2PM9B 2TRCB 3RRMC 4J77A 2YB8B 2P9KC 4J8GA 2OK6A 3SBQA 2XL3A 5FKTA 5I5IA 4DNUA 4G1MA 3DWLC 4RE5A 4L1MA 4KFMB 1E8MA 5HDBA 2YNNA 2H6QA 4J81A 4PC0A 1S4UX 2HU8A 3EWEA 4Z8LA 5M5TA 2HYEA 3MVDK 4QL1A 5EMJB 5TEFA 2P9SC 2YBAA 4FA1D 3P4FA 3PVUB 3SWSD 2IWFA 2I0SA 4PNKB 3I7NA 2PM6B 1L5GA 2OJYA 4JSVC 3I7LA 5EMKB 1H2YA 3IURA 3K71A 4IA9A 3MXXA 4O2WA 4RE6A 2VZ3A 3AL8B 3ZWLB 4ES0A 3W15A 5M5VA 1PEVA 5CXBA 4AMZA 2OVRB 3K27A 4GM8A 5IJ7E 2XU7A 3FCUA 3GC3B 4BCBA 4O9DA 4Z7OA 5EAPA 4JD2C 3EI1B 4E5ZB 3ZE2A 5IGQA 2H9LA 2BBKH 3RMZD 4FA9D 1XHMA 3RFHA 4BCDA 3IUQA 1UOOA 1A12A 3OL2A 4QQEA 1UOPA 2OIZA 2VDMA 5C9ZB 3IIYA 3MKSB 4L3HD 3K72A 2HJ4A 2H47A 5TF2A 3IKOA 4A08A 1VYHC 3QHYB 3KCIA 5GXIA 3ORVD 5K19A 5THAA 4L9OA 3ZE0A 3EMHA 2Z2OA 4XEIC 3C9CA 1XIPA 5KDOB 3VH0A
chains in the Genus database with same CATH topology
2OVPB 4ZN4A 1N6EA 4ESGA 4GZ8A 3VA6A 4CI2A 2YMUA 2MTAH 2B4EA 4TZ4A 1N6DA 5HE0B 3EI4B 4HDJA 2YNPA 2PM7B 3F3PA 4O3TB 2B5LA 3PXWD 1R5MA 4FHLA 4ERZA 5CXCA 4GGCA 1N6FA 1MDAH 5EAMA 3GREA 3N0EA 3NVQA 4J73A 2H9PA 2H68A 5FKRA 4FB1D 4H5JA 2IURA 2J57G 4ERQA 3EI2A 5GXHA 3OKWA 4ZOVA 2OK4A 4A2MA 4ZOZA 3JROA 2QXVA 3JZHA 4AEZA 2CO0A 4A7JA 2HJBA 4O3UB 2CE8A 2P9NC 4CI8A 1P22A 1JJUB 3IJCA 4X61B 2B5NA 3EI3B 3U4YA 5HE2B 4A0AA 1JMZB 3IJ0A 3PE7A 3RN0D 3AFCA 3JPXA 3UVLA 2GNQA 4G56B 5EMLB 3RFGA 3I8CA 5EMMB 3IIWA 2B5MA 5IC7A 4J0WA 5AJAA 3I7OA 2IUQA 4JSNC 5IGOA 4ZOYA 2O9KA 4J0XA 4JSPC 2EBSA 3L4OD 3C99A 3I7KA 3RSEC 4PSXB 3GFCA 1JOFA 2H9NA 4J79A 4Y5RD 4X60B 3JAMg 3SBPA 4ZOXA 3PVWB 3V5WB 5CXBB 2W18A 5HE3B 4E54A 4A0BA 4ERYA 5FLXg 1QNIA 4L1QD 2HXCA 4Y7RA 3OL2B 3UVNA 2UZYB 3FGBA 2G9AA 1B9YA 4X63B 5I5MA 4FAND 2AGZA 3SCYA 4A08B 1TYQC 3OKYA 3JRPA 4BH6A 3F3FA 5JWZA 3DM0A 3PXSD 2HESX 2UZXB 5AMSA 2CO0C 3UVOA 4NSXA 5FKSA 1PBYB 4FA5D 2IUVA 3C75H 3K26A 4L3GD 4CI3A 5EM2A 3ODTA 2BCJB 1GP2B 5CXCB 5CYKA 4XYIA 4LGNA 2P9PC 2GC7A 3PSCB 5HYNB 2H6NA 1B9XA 3PXTD 4GQ1A 5EALA 4A11A 2AGLA 3EI2B 1XKSA 4CY1A 4JT6C 5A2Qg 2I0RA 3ULEC 5TDHB 3I8EA 5FXYA 5EARA 3OW8A 1GG2B 2IAAA 4X3EA 3CFVA 5H17A 2I0TA 4GMBA 4GM3A 2CE9A 4MK0B 3I2NA 2OVQB 3DXKC 2H14A 3V9FA 4CZXA 3NVNA 4A0AB 2AH0A 4J84A 3KRWB 2Q7QA 2CN3A 3OKTA 3EU7A 2Z2NA 3F3GA 3DSMA 2J55H 5C2WB 4JXMA 4PSWB 3AH8B 3JB9L 5H14A 3FM0A 1MG3A 3SLED 4FWWA 5K1CC 3SVWD 2HKMA 4CY3A 2GC4A 1A0RB 4U1EI 3MZKA 4U7AA 3CFSB 5I5JA 3J81g 3JZGA 3UVMA 2XYIA 3BWSA 4CY2A 2G99A 4E54B 5IT9g 4A0BB 3FRXA 4O45A 4J86A 3SHFA 3C5MA 3DXMC 4R7AB 1L0QA 4CY5A 3UR4A 2J56H 3SJLD 4JT5C 1K8KC 4A09A 2IWKA 2PM9A 2CN2A 2I3TA 1FWXA 1U2VC 3OKYB 2P9UC 3B7FA 3N0DA 5TEEA 4AOWA 3I7PA 3MMYA 4J87A 4OZUA 4GM9A 3JZNA 4I79A 4XYHA 2HKRA 3BG0A 3AL9A 4FAVD 1NEXB 3I7HA 4GGAA 4GQBB 3MZLA 4K3JB 3SXTD 3CIKB 4GQ2P 1OMWB 2P9LC 4UI9R 3EG6A 5EM2B 3AL8A 4EWRA 1SQ9A 5CYKB 3SFZA 1GOTB 5GMKn 5FA5B 5C2VB 5B4WA 1PI6A 2AGWA 1ERJA 3EI1A 2AGYA 4CI1A 4GGDA 4JSXC 4E5ZA 4A11B 1SQJA 3I89A 2P9IC 3PSLA 4OWRA 3RLMD 3E0CA 2I3SA 4K3ID 2H13A 4QT8A 3BG1A 5IJ8E 4D6VA 2AGXA 4CZYA 5GSAA 3UKRC 3HFQA 2YNOA 3UKUC 1GXRA 5HQGA 4CZVA 3MKQA 2IUPA 1TBGA 2H3XA 4J78A 4PXWA 1OLZA 4LG8A 4FA4D 5FKQA 1MG2A 3EI4A 3KRXB 4J82A 3A0FA 1Q47A 3SMRA 1SHYB 4QRJA 3UVKA 2AH1A 3SBRA 4LG9A 3SN6B 2CNXA 3RN1D 4BL0A 3J80g 2QC5A 4CC9A 2PBIB 5SXMA 4N14A 1JMXB 5AFU3 5H1MA 5FQDA 4PBZA 1RI6A 3IJ1A 2XL2A 1U4CA 3NVXA 4YVDA 3OTTA 2AQ5A 4A2LA 1YFQA 1K32A 2Z2PA 4IMMA 2H6KA 2H9MA 4PBYA 3L4MD 5HE1B 4J8BA 3VGZA 1PGUA 3V7DB 4H5IA 4BUJC 4D0KA 1NR0A 4A09B 4O1QD 3EI3A 2PM9B 2TRCB 3RRMC 4J77A 2YB8B 2P9KC 4J8GA 2OK6A 3SBQA 2XL3A 5FKTA 5I5IA 3DWLC 4KFMB 2YNNA 2H6QA 4J81A 4PC0A 1S4UX 3EWEA 4Z8LA 2HYEA 4QL1A 5EMJB 5TEFA 2P9SC 2YBAA 4FA1D 3P4FA 3PVUB 3SWSD 2IWFA 2I0SA 4PNKB 3I7NA 2PM6B 2OJYA 4JSVC 3I7LA 5EMKB 4IA9A 3MXXA 3AL8B 3ZWLB 4ES0A 3W15A 1PEVA 5CXBA 5IJ7E 2OVRB 3K27A 4GM8A 2XU7A 4O9DA 5EAPA 4JD2C 3EI1B 4E5ZB 5IGQA 2H9LA 2BBKH 3RMZD 4FA9D 1XHMA 3RFHA 3OL2A 4QQEA 2OIZA 5C9ZB 3IIYA 3MKSB 4L3HD 2HJ4A 2H47A 5TF2A 3IKOA 4A08A 1VYHC 5GXIA 3ORVD 5K19A 5THAA 4L9OA 3EMHA 2Z2OA 4XEIC 3C9CA 1XIPA 5KDOB 3VH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OVP B;  4ZN4 A;  1N6E A;  4ESG A;  4GZ8 A;  3VA6 A;  4CI2 A;  2YMU A;  2MTA H;  2B4E A;  4TZ4 A;  1N6D A;  5HE0 B;  3EI4 B;  4HDJ A;  2YNP A;  2PM7 B;  3F3P A;  4O3T B;  2B5L A;  3PXW D;  1R5M A;  4FHL A;  4ERZ A;  5CXC A;  4GGC A;  1N6F A;  1MDA H;  5EAM A;  3GRE A;  3N0E A;  3NVQ A;  4J73 A;  2H9P A;  2H68 A;  5FKR A;  4FB1 D;  4H5J A;  2IUR A;  2J57 G;  4ERQ A;  3EI2 A;  5GXH A;  3OKW A;  4ZOV A;  2OK4 A;  4A2M A;  4ZOZ A;  3JRO A;  2QXV A;  3JZH A;  4AEZ A;  2CO0 A;  4A7J A;  2HJB A;  4O3U B;  2CE8 A;  2P9N C;  4CI8 A;  1P22 A;  1JJU B;  3IJC A;  4X61 B;  2B5N A;  3EI3 B;  3U4Y A;  5HE2 B;  4A0A A;  1JMZ B;  3IJ0 A;  3PE7 A;  3RN0 D;  3AFC A;  3JPX A;  3UVL A;  2GNQ A;  4G56 B;  5EML B;  3RFG A;  3I8C A;  5EMM B;  3IIW A;  2B5M A;  5IC7 A;  4J0W A;  5AJA A;  3I7O A;  2IUQ A;  4JSN C;  5IGO A;  4ZOY A;  2O9K A;  4J0X A;  4JSP C;  2EBS A;  3L4O D;  3C99 A;  3I7K A;  3RSE C;  4PSX B;  3GFC A;  1JOF A;  2H9N A;  4J79 A;  4Y5R D;  4X60 B;  3JAM g;  3SBP A;  4ZOX A;  3PVW B;  3V5W B;  5CXB B;  2W18 A;  5HE3 B;  4E54 A;  4A0B A;  4ERY A;  5FLX g;  1QNI A;  4L1Q D;  2HXC A;  4Y7R A;  3OL2 B;  3UVN A;  2UZY B;  3FGB A;  2G9A A;  1B9Y A;  4X63 B;  5I5M A;  4FAN D;  2AGZ A;  3SCY A;  4A08 B;  1TYQ C;  3OKY A;  3JRP A;  4BH6 A;  3F3F A;  5JWZ A;  3DM0 A;  3PXS D;  2HES X;  2UZX B;  5AMS A;  2CO0 C;  3UVO A;  4NSX A;  5FKS A;  1PBY B;  4FA5 D;  2IUV A;  3C75 H;  3K26 A;  4L3G D;  4CI3 A;  5EM2 A;  3ODT A;  2BCJ B;  1GP2 B;  5CXC B;  5CYK A;  4XYI A;  4LGN A;  2P9P C;  2GC7 A;  3PSC B;  5HYN B;  2H6N A;  1B9X A;  3PXT D;  4GQ1 A;  5EAL A;  4A11 A;  2AGL A;  3EI2 B;  1XKS A;  4CY1 A;  4JT6 C;  5A2Q g;  2I0R A;  3ULE C;  5TDH B;  3I8E A;  5FXY A;  5EAR A;  3OW8 A;  1GG2 B;  2IAA A;  4X3E A;  3CFV A;  5H17 A;  2I0T A;  4GMB A;  4GM3 A;  2CE9 A;  4MK0 B;  3I2N A;  2OVQ B;  3DXK C;  2H14 A;  3V9F A;  4CZX A;  3NVN A;  4A0A B;  2AH0 A;  4J84 A;  3KRW B;  2Q7Q A;  2CN3 A;  3OKT A;  3EU7 A;  2Z2N A;  3F3G A;  3DSM A;  2J55 H;  5C2W B;  4JXM A;  4PSW B;  3AH8 B;  3JB9 L;  5H14 A;  3FM0 A;  1MG3 A;  3SLE D;  4FWW A;  5K1C C;  3SVW D;  2HKM A;  4CY3 A;  2GC4 A;  1A0R B;  4U1E I;  3MZK A;  4U7A A;  3CFS B;  5I5J A;  3J81 g;  3JZG A;  3UVM A;  2XYI A;  3BWS A;  4CY2 A;  2G99 A;  4E54 B;  5IT9 g;  4A0B B;  3FRX A;  4O45 A;  4J86 A;  3SHF A;  3C5M A;  3DXM C;  4R7A B;  1L0Q A;  4CY5 A;  3UR4 A;  2J56 H;  3SJL D;  4JT5 C;  1K8K C;  4A09 A;  2IWK A;  2PM9 A;  2CN2 A;  2I3T A;  1FWX A;  1U2V C;  3OKY B;  2P9U C;  3B7F A;  3N0D A;  5TEE A;  4AOW A;  3I7P A;  3MMY A;  4J87 A;  4OZU A;  4GM9 A;  3JZN A;  4I79 A;  4XYH A;  2HKR A;  3BG0 A;  3AL9 A;  4FAV D;  1NEX B;  3I7H A;  4GGA A;  4GQB B;  3MZL A;  4K3J B;  3SXT D;  3CIK B;  4GQ2 P;  1OMW B;  2P9L C;  4UI9 R;  3EG6 A;  5EM2 B;  3AL8 A;  4EWR A;  1SQ9 A;  5CYK B;  3SFZ A;  1GOT B;  5GMK n;  5FA5 B;  5C2V B;  5B4W A;  1PI6 A;  2AGW A;  1ERJ A;  3EI1 A;  2AGY A;  4CI1 A;  4GGD A;  4JSX C;  4E5Z A;  4A11 B;  1SQJ A;  3I89 A;  2P9I C;  3PSL A;  4OWR A;  3RLM D;  3E0C A;  2I3S A;  4K3I D;  2H13 A;  4QT8 A;  3BG1 A;  5IJ8 E;  4D6V A;  2AGX A;  4CZY A;  5GSA A;  3UKR C;  3HFQ A;  2YNO A;  3UKU C;  1GXR A;  5HQG A;  4CZV A;  3MKQ A;  2IUP A;  1TBG A;  2H3X A;  4J78 A;  4PXW A;  1OLZ A;  4LG8 A;  4FA4 D;  5FKQ A;  1MG2 A;  3EI4 A;  3KRX B;  4J82 A;  3A0F A;  1Q47 A;  3SMR A;  1SHY B;  4QRJ A;  3UVK A;  2AH1 A;  3SBR A;  4LG9 A;  3SN6 B;  2CNX A;  3RN1 D;  4BL0 A;  3J80 g;  2QC5 A;  4CC9 A;  2PBI B;  5SXM A;  4N14 A;  1JMX B;  5AFU 3;  5H1M A;  5FQD A;  4PBZ A;  1RI6 A;  3IJ1 A;  2XL2 A;  1U4C A;  3NVX A;  4YVD A;  3OTT A;  2AQ5 A;  4A2L A;  1YFQ A;  1K32 A;  2Z2P A;  4IMM A;  2H6K A;  2H9M A;  4PBY A;  3L4M D;  5HE1 B;  4J8B A;  3VGZ A;  1PGU A;  3V7D B;  4H5I A;  4BUJ C;  4D0K A;  1NR0 A;  4A09 B;  4O1Q D;  3EI3 A;  2PM9 B;  2TRC B;  3RRM C;  4J77 A;  2YB8 B;  2P9K C;  4J8G A;  2OK6 A;  3SBQ A;  2XL3 A;  5FKT A;  5I5I A;  3DWL C;  4KFM B;  2YNN A;  2H6Q A;  4J81 A;  4PC0 A;  1S4U X;  3EWE A;  4Z8L A;  2HYE A;  4QL1 A;  5EMJ B;  5TEF A;  2P9S C;  2YBA A;  4FA1 D;  3P4F A;  3PVU B;  3SWS D;  2IWF A;  2I0S A;  4PNK B;  3I7N A;  2PM6 B;  2OJY A;  4JSV C;  3I7L A;  5EMK B;  4IA9 A;  3MXX A;  3AL8 B;  3ZWL B;  4ES0 A;  3W15 A;  1PEV A;  5CXB A;  5IJ7 E;  2OVR B;  3K27 A;  4GM8 A;  2XU7 A;  4O9D A;  5EAP A;  4JD2 C;  3EI1 B;  4E5Z B;  5IGQ A;  2H9L A;  2BBK H;  3RMZ D;  4FA9 D;  1XHM A;  3RFH A;  3OL2 A;  4QQE A;  2OIZ A;  5C9Z B;  3IIY A;  3MKS B;  4L3H D;  2HJ4 A;  2H47 A;  5TF2 A;  3IKO A;  4A08 A;  1VYH C;  5GXI A;  3ORV D;  5K19 A;  5THA A;  4L9O A;  3EMH A;  2Z2O A;  4XEI C;  3C9C A;  1XIP A;  5KDO B;  3VH0 A; 
#chains in the Genus database with same CATH topology
 2OVP B;  4ZN4 A;  1N6E A;  4ESG A;  4GZ8 A;  3EQ8 A;  3VA6 A;  1GOG A;  4CI2 A;  2YMU A;  2MTA H;  2B4E A;  4Z7N A;  3IUJ A;  2WQ8 A;  4TZ4 A;  1N6D A;  5HE0 B;  2VDQ A;  3EI4 B;  4HDJ A;  2YNP A;  2PM7 B;  3F3P A;  4O3T B;  2B5L A;  3NID A;  3PXW D;  1R5M A;  4BCC A;  4FHL A;  4ERZ A;  5CXC A;  4GGC A;  4UM9 A;  1C9L A;  1N6F A;  1MDA H;  5EAM A;  3GRE A;  3N0E A;  3NVQ A;  4J73 A;  2H9P A;  3IVM A;  2H68 A;  5FKR A;  4FB1 D;  4H5J A;  2IUR A;  2J57 G;  4ERQ A;  3EI2 A;  5GXH A;  5M5R A;  3OKW A;  4ZOV A;  2OK4 A;  4A2M A;  1VZ3 A;  4ZOZ A;  1E8N A;  3JRO A;  2QXV A;  3JZH A;  2VDO A;  4AEZ A;  2EIC A;  2CO0 A;  4A7J A;  2HJB A;  4O3U B;  1VE6 A;  2CE8 A;  2P9N C;  4CI8 A;  1P22 A;  1JJU B;  3IJC A;  4X61 B;  2B5N A;  3IUM A;  3EI3 B;  3NIF A;  3U4Y A;  5HE2 B;  4A0A A;  3MUN A;  1JMZ B;  4D9S A;  3GD1 I;  3IJ0 A;  3PE7 A;  3T3M A;  3RN0 D;  3AFC A;  3JPX A;  3UVL A;  2GNQ A;  4G56 B;  5EML B;  3RFG A;  3I8C A;  5EMM B;  3IIW A;  3NIG A;  2B5M A;  5IC7 A;  4J0W A;  5AJA A;  3I7O A;  2IUQ A;  4JSN C;  5IGO A;  4ZOY A;  4MMX A;  2O9K A;  4J0X A;  4UM8 A;  4G1E A;  4JSP C;  4DNV A;  2EBS A;  3L4O D;  3C99 A;  3I7K A;  3RSE C;  4PSX B;  3GFC A;  1JOF A;  2H9N A;  4J79 A;  4Y5R D;  3OF7 A;  4X60 B;  3JAM g;  5M5S A;  3SBP A;  1VZ2 A;  4ZOX A;  1H2X A;  3PVW B;  3V5W B;  5CXB B;  2W18 A;  5HE3 B;  4E54 A;  4A0B A;  4AN0 A;  1H2W A;  2EIB A;  4ERY A;  5FLX g;  1QNI A;  3O4J A;  4L1Q D;  2HXC A;  4Y7R A;  3OL2 B;  3UVN A;  4AMY A;  2UZY B;  3FGB A;  2G9A A;  1B9Y A;  4X63 B;  5I5M A;  4FAN D;  2AGZ A;  3SCY A;  2HU7 A;  3O4H A;  1UTC A;  4A08 B;  1TYQ C;  3OKY A;  3JRP A;  2QR5 A;  4BH6 A;  3F3F A;  5JWZ A;  2JKX A;  3DM0 A;  3PXS D;  2HES X;  2UZX B;  5C86 A;  5AMS A;  2CO0 C;  3UVO A;  2XDW A;  2VDK A;  4NSX A;  5FKS A;  1PBY B;  4FA5 D;  2IUV A;  3C75 H;  3K26 A;  4L3G D;  4CI3 A;  4JHN A;  5EM2 A;  3ODT A;  2BCJ B;  1GP2 B;  5CXC B;  5CYK A;  4XYI A;  4LGN A;  1TYE A;  2P9P C;  2GC7 A;  3PSC B;  5HYN B;  3IUN A;  2H6N A;  1O6F A;  4NBM A;  1M1X A;  4NC4 A;  1B9X A;  3PXT D;  4GQ1 A;  5EAL A;  4WK0 A;  4A11 A;  2AGL A;  3EI2 B;  1XKS A;  1BPO A;  5FFG A;  4BP9 A;  4CY1 A;  4JT6 C;  5A2Q g;  3O4G A;  2I0R A;  2QZP A;  2EIE A;  4O02 A;  3ULE C;  5TDH B;  3ZE1 A;  4QAM A;  3V4P A;  1GOF A;  3I8E A;  5FXY A;  5EAR A;  3OW8 A;  1GG2 B;  2IAA A;  4X3E A;  3VI4 A;  3CFV A;  5H17 A;  2I0T A;  4GMB A;  5M5U A;  4GM3 A;  3V4V A;  1VE7 A;  2CE9 A;  4MK0 B;  3I2N A;  2OVQ B;  3DXK C;  2H14 A;  2XZG A;  3V9F A;  4CZX A;  3NVN A;  5M61 A;  2AH0 A;  4A0A B;  1T2X A;  4J84 A;  1GOH A;  3KRW B;  2Q7Q A;  2CN3 A;  3OKT A;  3EU7 A;  5C92 A;  2Z2N A;  3F3G A;  3DSM A;  2J55 H;  5C2W B;  4JXM A;  4PSW B;  5FFO A;  3AH8 B;  3JB9 L;  5H14 A;  3FM0 A;  1MG3 A;  3SLE D;  4FWW A;  5K1C C;  3SVW D;  2HKM A;  3EQ7 A;  4CY3 A;  2GC4 A;  1A0R B;  4U1E I;  3MZK A;  4U7A A;  3CFS B;  5I5J A;  3J81 g;  3JZG A;  1O6G A;  3UVM A;  2XYI A;  3BWS A;  4CY2 A;  2G99 A;  4E54 B;  5IT9 g;  4A0B B;  3VI3 A;  3FRX A;  3ZDZ A;  4O45 A;  4J86 A;  3SHF A;  3C5M A;  3DXM C;  4R7A B;  1L0Q A;  4CY5 A;  1E5T A;  3ZDX A;  3UR4 A;  2J56 H;  3SJL D;  4JT5 C;  1K8K C;  4A09 A;  2IWK A;  3MUO A;  2PM9 A;  2CN2 A;  2VC2 A;  2I3T A;  1FWX A;  1U2V C;  2VDP A;  3OKY B;  3IUL A;  2P9U C;  2VDR A;  3B7F A;  3N0D A;  5TEE A;  4AOW A;  3I7P A;  3MMY A;  4J87 A;  4OZU A;  1U8C A;  4GM9 A;  3JZN A;  4I79 A;  4XYH A;  2HKR A;  3BG0 A;  3AL9 A;  4FAV D;  1NEX B;  2VZ1 A;  3I7H A;  4GGA A;  4GQB B;  3MZL A;  4K3J B;  3SXT D;  2VDN A;  4NAA A;  2EID A;  3CIK B;  4WK4 A;  4GQ2 P;  1OMW B;  2P9L C;  4UI9 R;  3EG6 A;  5EM2 B;  4DNW A;  3AL8 A;  4EWR A;  1SQ9 A;  5CYK B;  3SFZ A;  1GOT B;  5E6R A;  5GMK n;  5FA5 B;  5C2V B;  5B4W A;  1PI6 A;  1QFS A;  1H2Z A;  2AGW A;  1ERJ A;  3EI1 A;  2AGY A;  4CI1 A;  4GGD A;  4JSX C;  4E5Z A;  4A11 B;  1SQJ A;  3I89 A;  2P9I C;  3PSL A;  4OWR A;  3RLM D;  3E0C A;  2I3S A;  4K3I D;  2H13 A;  1C9I A;  4QT8 A;  3BG1 A;  5IJ8 E;  4D6V A;  2AGX A;  4CZY A;  5GSA A;  3K6S A;  4MMZ A;  3UKR C;  2HU5 A;  3HFQ A;  2YNO A;  3UKU C;  1GXR A;  5HQG A;  4CZV A;  2VDL A;  3MKQ A;  5E6S A;  4WK2 A;  2IUP A;  1TBG A;  2XE4 A;  2H3X A;  4J78 A;  4PXW A;  1OLZ A;  4LG8 A;  5E6U A;  4FA4 D;  5FKQ A;  1MG2 A;  3EI4 A;  3KRX B;  4J82 A;  3A0F A;  1Q47 A;  3SMR A;  1SHY B;  4QRJ A;  3DDU A;  3UVK A;  3O4I A;  2AH1 A;  4IRZ A;  4MMY A;  4LG9 A;  3SBR A;  1QFM A;  3SN6 B;  4AX4 A;  2CNX A;  3RN1 D;  4BL0 A;  3J80 g;  2QC5 A;  4CC9 A;  2PBI B;  5SXM A;  4N14 A;  1JMX B;  5AFU 3;  5H1M A;  5FQD A;  4PBZ A;  4WJK A;  3T3P A;  4Z7Q A;  1RI6 A;  3IJ1 A;  2XL2 A;  4BP8 A;  1U4C A;  3NVX A;  4YVD A;  3ZDY A;  3OTT A;  4AN1 A;  2AQ5 A;  2BKL A;  4A2L A;  1YFQ A;  4JHP C;  4NEN A;  1JTD B;  3FCS A;  1K32 A;  4G55 A;  2Z2P A;  4IMM A;  2H6K A;  2H9M A;  4PBY A;  3L4M D;  5HE1 B;  3EQ9 A;  3QI0 A;  1JV2 A;  4J8B A;  3VGZ A;  1K3I A;  1PGU A;  3V7D B;  4H5I A;  1I2M B;  1UOQ A;  4BUJ C;  4D0K A;  1YR2 A;  1NR0 A;  4A09 B;  4O1Q D;  3IJE A;  3EI3 A;  2PM9 B;  2TRC B;  3RRM C;  4J77 A;  2YB8 B;  2P9K C;  4J8G A;  2OK6 A;  3SBQ A;  2XL3 A;  5FKT A;  5I5I A;  4DNU A;  4G1M A;  3DWL C;  4RE5 A;  4L1M A;  4KFM B;  1E8M A;  5HDB A;  2YNN A;  2H6Q A;  4J81 A;  4PC0 A;  1S4U X;  2HU8 A;  3EWE A;  4Z8L A;  5M5T A;  2HYE A;  3MVD K;  4QL1 A;  5EMJ B;  5TEF A;  2P9S C;  2YBA A;  4FA1 D;  3P4F A;  3PVU B;  3SWS D;  2IWF A;  2I0S A;  4PNK B;  3I7N A;  2PM6 B;  1L5G A;  2OJY A;  4JSV C;  3I7L A;  5EMK B;  1H2Y A;  3IUR A;  3K71 A;  4IA9 A;  3MXX A;  4O2W A;  4RE6 A;  2VZ3 A;  3AL8 B;  3ZWL B;  4ES0 A;  3W15 A;  5M5V A;  1PEV A;  5CXB A;  4AMZ A;  2OVR B;  3K27 A;  4GM8 A;  5IJ7 E;  2XU7 A;  3FCU A;  3GC3 B;  4BCB A;  4O9D A;  4Z7O A;  5EAP A;  4JD2 C;  3EI1 B;  4E5Z B;  3ZE2 A;  5IGQ A;  2H9L A;  2BBK H;  3RMZ D;  4FA9 D;  1XHM A;  3RFH A;  4BCD A;  3IUQ A;  1UOO A;  1A12 A;  3OL2 A;  4QQE A;  1UOP A;  2OIZ A;  2VDM A;  5C9Z B;  3IIY A;  3MKS B;  4L3H D;  3K72 A;  2HJ4 A;  2H47 A;  5TF2 A;  3IKO A;  4A08 A;  1VYH C;  3QHY B;  3KCI A;  5GXI A;  3ORV D;  5K19 A;  5THA A;  4L9O A;  3ZE0 A;  3EMH A;  2Z2O A;  4XEI C;  3C9C A;  1XIP A;  5KDO B;  3VH0 A; 
#chains in the Genus database with same CATH homology
 2OVP B;  4ZN4 A;  1N6E A;  4ESG A;  4GZ8 A;  3VA6 A;  4CI2 A;  2YMU A;  2MTA H;  2B4E A;  4TZ4 A;  1N6D A;  5HE0 B;  3EI4 B;  4HDJ A;  2YNP A;  2PM7 B;  3F3P A;  4O3T B;  2B5L A;  3PXW D;  1R5M A;  4FHL A;  4ERZ A;  5CXC A;  4GGC A;  1N6F A;  1MDA H;  5EAM A;  3GRE A;  3N0E A;  3NVQ A;  4J73 A;  2H9P A;  2H68 A;  5FKR A;  4FB1 D;  4H5J A;  2IUR A;  2J57 G;  4ERQ A;  3EI2 A;  5GXH A;  3OKW A;  4ZOV A;  2OK4 A;  4A2M A;  4ZOZ A;  3JRO A;  2QXV A;  3JZH A;  4AEZ A;  2CO0 A;  4A7J A;  2HJB A;  4O3U B;  2CE8 A;  2P9N C;  4CI8 A;  1P22 A;  1JJU B;  3IJC A;  4X61 B;  2B5N A;  3EI3 B;  3U4Y A;  5HE2 B;  4A0A A;  1JMZ B;  3IJ0 A;  3PE7 A;  3RN0 D;  3AFC A;  3JPX A;  3UVL A;  2GNQ A;  4G56 B;  5EML B;  3RFG A;  3I8C A;  5EMM B;  3IIW A;  2B5M A;  5IC7 A;  4J0W A;  5AJA A;  3I7O A;  2IUQ A;  4JSN C;  5IGO A;  4ZOY A;  2O9K A;  4J0X A;  4JSP C;  2EBS A;  3L4O D;  3C99 A;  3I7K A;  3RSE C;  4PSX B;  3GFC A;  1JOF A;  2H9N A;  4J79 A;  4Y5R D;  4X60 B;  3JAM g;  3SBP A;  4ZOX A;  3PVW B;  3V5W B;  5CXB B;  2W18 A;  5HE3 B;  4E54 A;  4A0B A;  4ERY A;  5FLX g;  1QNI A;  4L1Q D;  2HXC A;  4Y7R A;  3OL2 B;  3UVN A;  2UZY B;  3FGB A;  2G9A A;  1B9Y A;  4X63 B;  5I5M A;  4FAN D;  2AGZ A;  3SCY A;  4A08 B;  1TYQ C;  3OKY A;  3JRP A;  4BH6 A;  3F3F A;  5JWZ A;  3DM0 A;  3PXS D;  2HES X;  2UZX B;  5AMS A;  2CO0 C;  3UVO A;  4NSX A;  5FKS A;  1PBY B;  4FA5 D;  2IUV A;  3C75 H;  3K26 A;  4L3G D;  4CI3 A;  5EM2 A;  3ODT A;  2BCJ B;  1GP2 B;  5CXC B;  5CYK A;  4XYI A;  4LGN A;  2P9P C;  2GC7 A;  3PSC B;  5HYN B;  2H6N A;  1B9X A;  3PXT D;  4GQ1 A;  5EAL A;  4A11 A;  2AGL A;  3EI2 B;  1XKS A;  4CY1 A;  4JT6 C;  5A2Q g;  2I0R A;  3ULE C;  5TDH B;  3I8E A;  5FXY A;  5EAR A;  3OW8 A;  1GG2 B;  2IAA A;  4X3E A;  3CFV A;  5H17 A;  2I0T A;  4GMB A;  4GM3 A;  2CE9 A;  4MK0 B;  3I2N A;  2OVQ B;  3DXK C;  2H14 A;  3V9F A;  4CZX A;  3NVN A;  4A0A B;  2AH0 A;  4J84 A;  3KRW B;  2Q7Q A;  2CN3 A;  3OKT A;  3EU7 A;  2Z2N A;  3F3G A;  3DSM A;  2J55 H;  5C2W B;  4JXM A;  4PSW B;  3AH8 B;  3JB9 L;  5H14 A;  3FM0 A;  1MG3 A;  3SLE D;  4FWW A;  5K1C C;  3SVW D;  2HKM A;  4CY3 A;  2GC4 A;  1A0R B;  4U1E I;  3MZK A;  4U7A A;  3CFS B;  5I5J A;  3J81 g;  3JZG A;  3UVM A;  2XYI A;  3BWS A;  4CY2 A;  2G99 A;  4E54 B;  5IT9 g;  4A0B B;  3FRX A;  4O45 A;  4J86 A;  3SHF A;  3C5M A;  3DXM C;  4R7A B;  1L0Q A;  4CY5 A;  3UR4 A;  2J56 H;  3SJL D;  4JT5 C;  1K8K C;  4A09 A;  2IWK A;  2PM9 A;  2CN2 A;  2I3T A;  1FWX A;  1U2V C;  3OKY B;  2P9U C;  3B7F A;  3N0D A;  5TEE A;  4AOW A;  3I7P A;  3MMY A;  4J87 A;  4OZU A;  4GM9 A;  3JZN A;  4I79 A;  4XYH A;  2HKR A;  3BG0 A;  3AL9 A;  4FAV D;  1NEX B;  3I7H A;  4GGA A;  4GQB B;  3MZL A;  4K3J B;  3SXT D;  3CIK B;  4GQ2 P;  1OMW B;  2P9L C;  4UI9 R;  3EG6 A;  5EM2 B;  3AL8 A;  4EWR A;  1SQ9 A;  5CYK B;  3SFZ A;  1GOT B;  5GMK n;  5FA5 B;  5C2V B;  5B4W A;  1PI6 A;  2AGW A;  1ERJ A;  3EI1 A;  2AGY A;  4CI1 A;  4GGD A;  4JSX C;  4E5Z A;  4A11 B;  1SQJ A;  3I89 A;  2P9I C;  3PSL A;  4OWR A;  3RLM D;  3E0C A;  2I3S A;  4K3I D;  2H13 A;  4QT8 A;  3BG1 A;  5IJ8 E;  4D6V A;  2AGX A;  4CZY A;  5GSA A;  3UKR C;  3HFQ A;  2YNO A;  3UKU C;  1GXR A;  5HQG A;  4CZV A;  3MKQ A;  2IUP A;  1TBG A;  2H3X A;  4J78 A;  4PXW A;  1OLZ A;  4LG8 A;  4FA4 D;  5FKQ A;  1MG2 A;  3EI4 A;  3KRX B;  4J82 A;  3A0F A;  1Q47 A;  3SMR A;  1SHY B;  4QRJ A;  3UVK A;  2AH1 A;  3SBR A;  4LG9 A;  3SN6 B;  2CNX A;  3RN1 D;  4BL0 A;  3J80 g;  2QC5 A;  4CC9 A;  2PBI B;  5SXM A;  4N14 A;  1JMX B;  5AFU 3;  5H1M A;  5FQD A;  4PBZ A;  1RI6 A;  3IJ1 A;  2XL2 A;  1U4C A;  3NVX A;  4YVD A;  3OTT A;  2AQ5 A;  4A2L A;  1YFQ A;  1K32 A;  2Z2P A;  4IMM A;  2H6K A;  2H9M A;  4PBY A;  3L4M D;  5HE1 B;  4J8B A;  3VGZ A;  1PGU A;  3V7D B;  4H5I A;  4BUJ C;  4D0K A;  1NR0 A;  4A09 B;  4O1Q D;  3EI3 A;  2PM9 B;  2TRC B;  3RRM C;  4J77 A;  2YB8 B;  2P9K C;  4J8G A;  2OK6 A;  3SBQ A;  2XL3 A;  5FKT A;  5I5I A;  3DWL C;  4KFM B;  2YNN A;  2H6Q A;  4J81 A;  4PC0 A;  1S4U X;  3EWE A;  4Z8L A;  2HYE A;  4QL1 A;  5EMJ B;  5TEF A;  2P9S C;  2YBA A;  4FA1 D;  3P4F A;  3PVU B;  3SWS D;  2IWF A;  2I0S A;  4PNK B;  3I7N A;  2PM6 B;  2OJY A;  4JSV C;  3I7L A;  5EMK B;  4IA9 A;  3MXX A;  3AL8 B;  3ZWL B;  4ES0 A;  3W15 A;  1PEV A;  5CXB A;  5IJ7 E;  2OVR B;  3K27 A;  4GM8 A;  2XU7 A;  4O9D A;  5EAP A;  4JD2 C;  3EI1 B;  4E5Z B;  5IGQ A;  2H9L A;  2BBK H;  3RMZ D;  4FA9 D;  1XHM A;  3RFH A;  3OL2 A;  4QQE A;  2OIZ A;  5C9Z B;  3IIY A;  3MKS B;  4L3H D;  2HJ4 A;  2H47 A;  5TF2 A;  3IKO A;  4A08 A;  1VYH C;  5GXI A;  3ORV D;  5K19 A;  5THA A;  4L9O A;  3EMH A;  2Z2O A;  4XEI C;  3C9C A;  1XIP A;  5KDO B;  3VH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...