4GGDA

Structural analysis of human cdc20 supports multisite degron recognition by apc/c.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
312
structure length
312
Chain Sequence
CRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell division cycle protein 20 homolog
publication title Structural analysis of human Cdc20 supports multisite degron recognition by APC/C.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ggdA00
1NR0A 3ULEC 2AGZA 5HE3B 3JPXA 4I79A 3UVMA 3U4YA 4JT6C 1B9YA 5GXIA 5C2VB 3JB9L 2OIZA 2HJ4A 4XEIC 3RMZD 3I89A 3I7LA 4A2MA 3SVWD 2OK4A 4D0KA 4Y7RA 3PSLA 3SJLD 3KRXB 3RSEC 3OL2B 3SHFA 4GGCA 1PGUA 2HJBA 5EM2A 4A0AB 1PI6A 4J87A 4J79A 1NEXB 5H1MA 3UVLA 5H14A 4AOWA 3F3PA 3VGZA 5FA5B 4J0WA 3EWEA 4E5ZA 1U4CA 2XYIA 3EI2A 2BBKH 2P9PC 2UZYB 2HESX 2PM7B 2IUVA 4CY1A 2AQ5A 4PNKB 2BCJB 2Q7QA 2UZXB 2XU7A 5IJ8E 2AH1A 3MZKA 5FLXg 3J80g 3AL8A 5K1CC 4ES0A 4LG8A 4R7AB 4A11A 3DXMC 4J86A 4O45A 3PXTD 4GMBA 5B4WA 2H14A 2CNXA 4O1QD 5EM2B 1JJUB 5THAA 5CXBA 2IUQA 4MK0B 3BG1A 4CY2A 2HKMA 5FQDA 3ORVD 3PVUB 1VYHC 4ERZA 2P9SC 3OW8A 4H5JA 1MG3A 4J8GA 4GM9A 3KRWB 4QT8A 4A09A 4FWWA 3C5MA 3OTTA 2QXVA 4E5ZB 1N6FA 4K3ID 1QNIA 2G9AA 5HE2B 3SBRA 4KFMB 2YBAA 4GGAA 4J78A 3JAMg 3EI2B 2GC4A 3L4MD 4ERYA 3PVWB 3AFCA 4PC0A 5CXCA 3SN6B 3NVNA 2P9LC 2IAAA 3MKQA 5C2WB 5HQGA 1JMZB 3SMRA 3AL8B 3MZLA 4FHLA 4ZOZA 3IJ0A 5GMKn 2OK6A 5IT9g 3UVOA 4CI1A 4A11B 4ZOVA 2Z2OA 3PE7A 3SBPA 5TF2A 3C75H 4O3TB 4YVDA 2H13A 4FAND 3RN1D 2IURA 1GP2B 3C99A 4XYHA 4X63B 3V7DB 4A09B 2P9NC 4GM3A 3AL9A 1PEVA 3I7HA 3DXKC 4CY3A 4PBZA 1RI6A 5CXCB 3FGBA 5I5JA 3UVNA 2YMUA 4GM8A 3MMYA 4ZOXA 4GZ8A 4GQ2P 2H6KA 4GQBB 5EMKB 2O9KA 2B4EA 3IJ1A 5EMJB 3B7FA 4X3EA 1B9XA 2CO0C 5EMMB 1GOTB 4UI9R 3JZGA 3OKWA 3SLED 3DSMA 5CYKA 2IUPA 4QQEA 4AEZA 3I7PA 3F3GA 1A0RB 1XHMA 2YB8B 4J77A 2YNNA 4ERQA 3RFHA 4OZUA 4EWRA 2Z2NA 4FAVD 2H47A 5TEFA 4FB1D 2H9NA 1N6DA 1TBGA 3NVXA 2H9PA 2OVPB 3V5WB 3FRXA 2YNPA 2HYEA 3RRMC 2H6NA 3MKSB 2AGYA 2H9MA 2QC5A 1JOFA 3E0CA 4CZVA 2I3TA 2I0SA 5K19A 3EI4A 3K27A 5FKQA 4A0BA 4O3UB 5A2Qg 4CI8A 2IWFA 4N14A 3MXXA 2CN2A 3K26A 4J73A 3BWSA 5IGQA 4PBYA 2XL2A 2P9IC 4PSWB 5CYKB 4L9OA 4JXMA 2B5MA 2OVQB 1OLZA 3I7KA 3PSCB 3EG6A 1XKSA 4JSPC 4L3GD 4ESGA 2W18A 3CIKB 4HDJA 4PXWA 5SXMA 2OJYA 4PSXB 5IGOA 2AH0A 1SQ9A 3EI3A 1ERJA 3VH0A 2P9KC 3FM0A 3UR4A 3JZNA 3I7OA 5IC7A 3UVKA 4BH6A 4JSVC 3C9CA 4J0XA 3PXSD 4J8BA 4G56B 2OVRB 4X60B 5HE1B 2H3XA 3SXTD 4BUJC 1K32A 3JROA 3ZWLB 2PBIB 5EAPA 3EI4B 3I8CA 4NSXA 4A0BB 4QL1A 3RFGA 3EU7A 5EMLB 5AJAA 1GXRA 5I5IA 4Z8LA 2J55H 3EI1A 2HXCA 2AGXA 1GG2B 4JT5C 3SCYA 4XYIA 4QRJA 2J57G 3SWSD 2CE8A 3IIWA 3EI3B 3SFZA 1TYQC 5HYNB 3DM0A 4JD2C 1JMXB 4CC9A 3BG0A 2P9UC 3RN0D 2H68A 3AH8B 2PM9A 2GNQA 4IMMA 1YFQA 3IKOA 5FKTA 4CZXA 5GXHA 5EAMA 1MG2A 3RLMD 5FKRA 2CE9A 3NVQA 3IIYA 4LG9A 5AMSA 2H6QA 5TDHB 3W15A 3ODTA 4FA4D 2H9LA 4U7AA 5C9ZB 5I5MA 2I0TA 4FA9D 5TEEA 2AGWA 1PBYB 3OKYA 4ZOYA 3I8EA 5IJ7E 2EBSA 3EI1B 4BL0A 5AFU3 5GSAA 4FA5D 3GREA 2TRCB 3CFVA 4E54A 5JWZA 5KDOB 4TZ4A 4CY5A 1P22A 1MDAH 4CZYA 3HFQA 4OWRA 2MTAH 3A0FA 2PM6B 1N6EA 3IJCA 2Z2PA 2PM9B 5HE0B 3DWLC 2XL3A 4H5IA 3P4FA 4Y5RD 2I3SA 1R5MA 4L3HD 4GQ1A 1SHYB 3VA6A 1S4UX 1U2VC 4A08A 3I2NA 3PXWD 4J84A 3OKYB 2CN3A 2J56H 3I7NA 3F3FA 4D6VA 3UKUC 2CO0A 4E54B 2HKRA 5EARA 5H17A 4J81A 2G99A 3UKRC 2I0RA 3N0DA 3EMHA 1OMWB 3GFCA 2B5LA 2YNOA 3OKTA 1K8KC 2AGLA 3L4OD 4X61B 2B5NA 5FKSA 4U1EI 3V9FA 4JSNC 1Q47A 2IWKA 4JSXC 4K3JB 1L0QA 1XIPA 1FWXA 4FA1D 4A08B 3CFSB 4O9DA 3OL2A 4CI2A 4IA9A 3N0EA 4A7JA 4GGDA 4CI3A 4L1QD 4ZN4A 3JRPA 4J82A 4A2LA 4A0AA 1SQJA 3SBQA 3JZHA 4LGNA 2GC7A 5EALA 3J81g 5FXYA 5CXBB
chains in the Genus database with same CATH superfamily
1NR0A 3ULEC 2AGZA 5HE3B 3JPXA 4G1EA 1JTDB 4I79A 3UVMA 3U4YA 4JT6C 1B9YA 5GXIA 5E6RA 5C2VB 3JB9L 2OIZA 2HJ4A 4XEIC 3RMZD 3I89A 3I7LA 4A2MA 4DNWA 4Z7OA 5HDBA 3SVWD 2VZ3A 5M61A 2OK4A 4D0KA 4Y7RA 4O2WA 3PSLA 3SJLD 3KRXB 3RSEC 3OL2B 3SHFA 4GGCA 1PGUA 1E8NA 2HJBA 5EM2A 1VE7A 5M5UA 4A0AB 1PI6A 4J87A 4J79A 1NEXB 3IUQA 5H1MA 5H14A 3UVLA 4AOWA 1UOPA 3F3PA 3VGZA 5FA5B 4J0WA 3EWEA 4QAMA 4E5ZA 5M5SA 3GD1I 3FCSA 1QFMA 1U4CA 2XYIA 3EI2A 2BBKH 2P9PC 2EIBA 2UZYB 1L5GA 2HESX 2PM7B 2IUVA 4WJKA 4CY1A 2AQ5A 4PNKB 2BCJB 3O4HA 2Q7QA 2UZXB 2XU7A 5IJ8E 1A12A 2AH1A 3MZKA 5FLXg 3J80g 3AL8A 5K1CC 4ES0A 4LG8A 4R7AB 1VZ2A 4A11A 2XE4A 3DXMC 4J86A 4O45A 3PXTD 4GMBA 5B4WA 3MVDK 3MUNA 2H14A 2CNXA 4O1QD 5EM2B 1JJUB 5M5RA 5CXBA 5THAA 2IUQA 1E5TA 4MK0B 3BG1A 4CY2A 2HKMA 5FQDA 3ORVD 3PVUB 1VYHC 4ERZA 2P9SC 3OW8A 4H5JA 1MG3A 4J8GA 4GM9A 3KRWB 4QT8A 2EIEA 4FWWA 4A09A 3C5MA 3OTTA 2QXVA 4E5ZB 1N6FA 3KCIA 4K3ID 1QNIA 2G9AA 5HE2B 3SBRA 4KFMB 2YBAA 4GGAA 4J78A 3JAMg 3EI2B 2GC4A 3L4MD 1H2XA 1T2XA 4ERYA 3AFCA 3PVWB 4PC0A 5CXCA 4UM9A 3SN6B 4BCDA 4D9SA 3ZE1A 1U8CA 3NVNA 1I2MB 2P9LC 2IAAA 3MKQA 5C2WB 5HQGA 1JMZB 3SMRA 3AL8B 3MZLA 4FHLA 4ZOZA 1M1XA 3IJ0A 5GMKn 2OK6A 5IT9g 3UVOA 4CI1A 2VDPA 4A11B 3K6SA 4IRZA 4ZOVA 2Z2OA 3PE7A 3SBPA 4NAAA 5TF2A 1QFSA 3C75H 1BPOA 3GC3B 4O3TB 4WK0A 4YVDA 3K71A 2H13A 4FAND 3RN1D 2IURA 1GP2B 3C99A 4XYHA 4X63B 3V7DB 3O4GA 4A09B 2P9NC 1E8MA 4GM3A 3AL9A 3T3PA 1PEVA 3I7HA 3DXKC 4CY3A 4PBZA 1RI6A 2VDOA 5CXCB 3FGBA 5I5JA 3UVNA 2YMUA 1C9IA 3MMYA 4GM8A 4ZOXA 1UTCA 2HU8A 4GQ2P 4GZ8A 2H6KA 4GQBB 5EMKB 2O9KA 1VE6A 2B4EA 3IJ1A 5EMJB 3B7FA 4X3EA 1B9XA 2CO0C 5EMMB 1GOTB 4UI9R 3NIGA 3JZGA 3OKWA 3SLED 3DSMA 5CYKA 2IUPA 4QQEA 4JHNA 4AEZA 3I7PA 2VZ1A 3F3GA 1A0RB 1UOOA 1XHMA 2YB8B 3IULA 2VDQA 4J77A 2YNNA 4ERQA 3RFHA 4MMXA 4OZUA 4EWRA 2Z2NA 1VZ3A 5M5TA 4FAVD 2H47A 5TEFA 2EICA 4FB1D 2H9NA 1N6DA 1TBGA 3NVXA 2H9PA 2OVPB 3ZE0A 3V5WB 3FRXA 2YNPA 3V4VA 2HYEA 3RRMC 2H6NA 3MKSB 2AGYA 2H9MA 2QC5A 1JOFA 3E0CA 4RE6A 4CZVA 2I3TA 2I0SA 3ZDZA 5K19A 3EI4A 3K27A 5FKQA 1YR2A 1GOHA 4A0BA 4O3UB 1O6GA 5A2Qg 4CI8A 2IWFA 4N14A 3MXXA 2CN2A 3K26A 4J73A 3BWSA 3EQ8A 4PBYA 5IGQA 1TYEA 2P9IC 2XL2A 4PSWB 5CYKB 3IURA 4L9OA 4JXMA 1H2YA 2B5MA 1K3IA 2VDLA 2OVQB 1OLZA 3I7KA 3PSCB 3EG6A 4MMYA 1XKSA 3IVMA 3O4JA 4JSPC 4L3GD 4ESGA 2W18A 3CIKB 4HDJA 4PXWA 5FFOA 5SXMA 2OJYA 4PSXB 5IGOA 2AH0A 1SQ9A 3IUMA 3EI3A 1ERJA 2WQ8A 3VH0A 2P9KC 3FM0A 5E6UA 3UR4A 3JZNA 4AMZA 3I7OA 5IC7A 3UVKA 4BH6A 4JSVC 1JV2A 3V4PA 3ZDXA 3C9CA 4J0XA 2VDKA 3PXSD 4J8BA 4G56B 2OVRB 4WK2A 4X60B 5HE1B 4WK4A 2H3XA 3SXTD 4BUJC 1K32A 3JROA 3ZWLB 2PBIB 2QR5A 5EAPA 3EI4B 3I8CA 4NSXA 4A0BB 4QL1A 3RFGA 3EU7A 5EMLB 5AJAA 1GXRA 5I5IA 4Z8LA 4G55A 2J55H 4RE5A 3EI1A 2HXCA 2AGXA 1GG2B 4JT5C 3SCYA 4XYIA 3DDUA 4QRJA 2J57G 3SWSD 3QI0A 2CE8A 3O4IA 1UOQA 4DNUA 3IIWA 3EI3B 3SFZA 1TYQC 5HYNB 3DM0A 4JD2C 1JMXB 4CC9A 3BG0A 2P9UC 3RN0D 4NENA 1GOFA 2H68A 3AH8B 2PM9A 2GNQA 4IMMA 1YFQA 3IKOA 5FKTA 4CZXA 5GXHA 5EAMA 3EQ7A 1MG2A 3RLMD 2EIDA 3IUJA 2VC2A 5FKRA 2CE9A 1H2WA 1O6FA 3NVQA 3IIYA 4JHPC 4AMYA 4LG9A 5AMSA 2H6QA 5TDHB 3W15A 3ODTA 4FA4D 2H9LA 5C86A 4U7AA 3VI4A 5C9ZB 2VDMA 5I5MA 2I0TA 4FA9D 5TEEA 2AGWA 4AN1A 1GOGA 1PBYB 3OKYA 4ZOYA 3I8EA 5IJ7E 2EBSA 3EI1B 4BL0A 5AFU3 5GSAA 3T3MA 4FA5D 3GREA 2TRCB 3CFVA 1H2ZA 4E54A 5JWZA 5KDOB 5M5VA 4TZ4A 4CY5A 2JKXA 1P22A 1MDAH 4CZYA 3HFQA 4OWRA 3ZDYA 2MTAH 3A0FA 2PM6B 1N6EA 4MMZA 4BP8A 3IJCA 4BP9A 2Z2PA 2PM9B 2XZGA 5HE0B 3DWLC 4NBMA 2XL3A 4H5IA 3P4FA 4Y5RD 2I3SA 4BCBA 3QHYB 5FFGA 3OF7A 1R5MA 4L3HD 3MUOA 2XDWA 4GQ1A 1SHYB 1C9LA 1S4UX 3VA6A 1U2VC 4A08A 3I2NA 3PXWD 2QZPA 4J84A 3OKYB 2CN3A 2J56H 3I7NA 3F3FA 3NIFA 4D6VA 4L1MA 4Z7QA 3UKUC 2CO0A 4E54B 2HKRA 3VI3A 4Z7NA 5EARA 4AN0A 5H17A 4G1MA 4O02A 4BCCA 4J81A 2G99A 4NC4A 3UKRC 2I0RA 3N0DA 3EMHA 1OMWB 3EQ9A 3GFCA 2B5LA 2YNOA 3OKTA 3ZE2A 1K8KC 2AGLA 3L4OD 4X61B 4UM8A 2B5NA 5FKSA 4DNVA 4U1EI 3V9FA 4JSNC 1Q47A 5E6SA 2IWKA 4JSXC 4K3JB 2HU7A 1L0QA 1XIPA 1FWXA 4FA1D 4A08B 3CFSB 4O9DA 2VDNA 3OL2A 3NIDA 4CI2A 3FCUA 4IA9A 2BKLA 3N0EA 4A7JA 4GGDA 4CI3A 4L1QD 2VDRA 3JRPA 4J82A 4ZN4A 2HU5A 4A2LA 5C92A 4A0AA 3IUNA 1SQJA 3SBQA 3JZHA 4LGNA 2GC7A 3K72A 5EALA 3J81g 5FXYA 5CXBB 3IJEA 4AX4A
chains in the Genus database with same CATH topology
1NR0A 3ULEC 2AGZA 5HE3B 3JPXA 4I79A 3UVMA 3U4YA 4JT6C 1B9YA 5GXIA 5C2VB 3JB9L 2OIZA 2HJ4A 4XEIC 3RMZD 3I89A 3I7LA 4A2MA 3SVWD 2OK4A 4D0KA 4Y7RA 3PSLA 3SJLD 3KRXB 3RSEC 3OL2B 3SHFA 4GGCA 1PGUA 2HJBA 5EM2A 4A0AB 1PI6A 4J87A 4J79A 1NEXB 5H1MA 3UVLA 5H14A 4AOWA 3F3PA 3VGZA 5FA5B 4J0WA 3EWEA 4E5ZA 1U4CA 2XYIA 3EI2A 2BBKH 2P9PC 2UZYB 2HESX 2PM7B 2IUVA 4CY1A 2AQ5A 4PNKB 2BCJB 2Q7QA 2UZXB 2XU7A 5IJ8E 2AH1A 3MZKA 5FLXg 3J80g 3AL8A 5K1CC 4ES0A 4LG8A 4R7AB 4A11A 3DXMC 4J86A 4O45A 3PXTD 4GMBA 5B4WA 2H14A 2CNXA 4O1QD 5EM2B 1JJUB 5THAA 5CXBA 2IUQA 4MK0B 3BG1A 4CY2A 2HKMA 5FQDA 3ORVD 3PVUB 1VYHC 4ERZA 2P9SC 3OW8A 4H5JA 1MG3A 4J8GA 4GM9A 3KRWB 4QT8A 4A09A 4FWWA 3C5MA 3OTTA 2QXVA 4E5ZB 1N6FA 4K3ID 1QNIA 2G9AA 5HE2B 3SBRA 4KFMB 2YBAA 4GGAA 4J78A 3JAMg 3EI2B 2GC4A 3L4MD 4ERYA 3PVWB 3AFCA 4PC0A 5CXCA 3SN6B 3NVNA 2P9LC 2IAAA 3MKQA 5C2WB 5HQGA 1JMZB 3SMRA 3AL8B 3MZLA 4FHLA 4ZOZA 3IJ0A 5GMKn 2OK6A 5IT9g 3UVOA 4CI1A 4A11B 4ZOVA 2Z2OA 3PE7A 3SBPA 5TF2A 3C75H 4O3TB 4YVDA 2H13A 4FAND 3RN1D 2IURA 1GP2B 3C99A 4XYHA 4X63B 3V7DB 4A09B 2P9NC 4GM3A 3AL9A 1PEVA 3I7HA 3DXKC 4CY3A 4PBZA 1RI6A 5CXCB 3FGBA 5I5JA 3UVNA 2YMUA 4GM8A 3MMYA 4ZOXA 4GZ8A 4GQ2P 2H6KA 4GQBB 5EMKB 2O9KA 2B4EA 3IJ1A 5EMJB 3B7FA 4X3EA 1B9XA 2CO0C 5EMMB 1GOTB 4UI9R 3JZGA 3OKWA 3SLED 3DSMA 5CYKA 2IUPA 4QQEA 4AEZA 3I7PA 3F3GA 1A0RB 1XHMA 2YB8B 4J77A 2YNNA 4ERQA 3RFHA 4OZUA 4EWRA 2Z2NA 4FAVD 2H47A 5TEFA 4FB1D 2H9NA 1N6DA 1TBGA 3NVXA 2H9PA 2OVPB 3V5WB 3FRXA 2YNPA 2HYEA 3RRMC 2H6NA 3MKSB 2AGYA 2H9MA 2QC5A 1JOFA 3E0CA 4CZVA 2I3TA 2I0SA 5K19A 3EI4A 3K27A 5FKQA 4A0BA 4O3UB 5A2Qg 4CI8A 2IWFA 4N14A 3MXXA 2CN2A 3K26A 4J73A 3BWSA 5IGQA 4PBYA 2XL2A 2P9IC 4PSWB 5CYKB 4L9OA 4JXMA 2B5MA 2OVQB 1OLZA 3I7KA 3PSCB 3EG6A 1XKSA 4JSPC 4L3GD 4ESGA 2W18A 3CIKB 4HDJA 4PXWA 5SXMA 2OJYA 4PSXB 5IGOA 2AH0A 1SQ9A 3EI3A 1ERJA 3VH0A 2P9KC 3FM0A 3UR4A 3JZNA 3I7OA 5IC7A 3UVKA 4BH6A 4JSVC 3C9CA 4J0XA 3PXSD 4J8BA 4G56B 2OVRB 4X60B 5HE1B 2H3XA 3SXTD 4BUJC 1K32A 3JROA 3ZWLB 2PBIB 5EAPA 3EI4B 3I8CA 4NSXA 4A0BB 4QL1A 3RFGA 3EU7A 5EMLB 5AJAA 1GXRA 5I5IA 4Z8LA 2J55H 3EI1A 2HXCA 2AGXA 1GG2B 4JT5C 3SCYA 4XYIA 4QRJA 2J57G 3SWSD 2CE8A 3IIWA 3EI3B 3SFZA 1TYQC 5HYNB 3DM0A 4JD2C 1JMXB 4CC9A 3BG0A 2P9UC 3RN0D 2H68A 3AH8B 2PM9A 2GNQA 4IMMA 1YFQA 3IKOA 5FKTA 4CZXA 5GXHA 5EAMA 1MG2A 3RLMD 5FKRA 2CE9A 3NVQA 3IIYA 4LG9A 5AMSA 2H6QA 5TDHB 3W15A 3ODTA 4FA4D 2H9LA 4U7AA 5C9ZB 5I5MA 2I0TA 4FA9D 5TEEA 2AGWA 1PBYB 3OKYA 4ZOYA 3I8EA 5IJ7E 2EBSA 3EI1B 4BL0A 5AFU3 5GSAA 4FA5D 3GREA 2TRCB 3CFVA 4E54A 5JWZA 5KDOB 4TZ4A 4CY5A 1P22A 1MDAH 4CZYA 3HFQA 4OWRA 2MTAH 3A0FA 2PM6B 1N6EA 3IJCA 2Z2PA 2PM9B 5HE0B 3DWLC 2XL3A 4H5IA 3P4FA 4Y5RD 2I3SA 1R5MA 4L3HD 4GQ1A 1SHYB 3VA6A 1S4UX 1U2VC 4A08A 3I2NA 3PXWD 4J84A 3OKYB 2CN3A 2J56H 3I7NA 3F3FA 4D6VA 3UKUC 2CO0A 4E54B 2HKRA 5EARA 5H17A 4J81A 2G99A 3UKRC 2I0RA 3N0DA 3EMHA 1OMWB 3GFCA 2B5LA 2YNOA 3OKTA 1K8KC 2AGLA 3L4OD 4X61B 2B5NA 5FKSA 4U1EI 3V9FA 4JSNC 1Q47A 2IWKA 4JSXC 4K3JB 1L0QA 1XIPA 1FWXA 4FA1D 4A08B 3CFSB 4O9DA 3OL2A 4CI2A 4IA9A 3N0EA 4A7JA 4GGDA 4CI3A 4L1QD 4ZN4A 3JRPA 4J82A 4A2LA 4A0AA 1SQJA 3SBQA 3JZHA 4LGNA 2GC7A 5EALA 3J81g 5FXYA 5CXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR0 A;  3ULE C;  2AGZ A;  5HE3 B;  3JPX A;  4I79 A;  3UVM A;  3U4Y A;  4JT6 C;  1B9Y A;  5GXI A;  5C2V B;  3JB9 L;  2OIZ A;  2HJ4 A;  4XEI C;  3RMZ D;  3I89 A;  3I7L A;  4A2M A;  3SVW D;  2OK4 A;  4D0K A;  4Y7R A;  3PSL A;  3SJL D;  3KRX B;  3RSE C;  3OL2 B;  3SHF A;  4GGC A;  1PGU A;  2HJB A;  5EM2 A;  4A0A B;  1PI6 A;  4J87 A;  4J79 A;  1NEX B;  5H1M A;  3UVL A;  5H14 A;  4AOW A;  3F3P A;  3VGZ A;  5FA5 B;  4J0W A;  3EWE A;  4E5Z A;  1U4C A;  2XYI A;  3EI2 A;  2BBK H;  2P9P C;  2UZY B;  2HES X;  2PM7 B;  2IUV A;  4CY1 A;  2AQ5 A;  4PNK B;  2BCJ B;  2Q7Q A;  2UZX B;  2XU7 A;  5IJ8 E;  2AH1 A;  3MZK A;  5FLX g;  3J80 g;  3AL8 A;  5K1C C;  4ES0 A;  4LG8 A;  4R7A B;  4A11 A;  3DXM C;  4J86 A;  4O45 A;  3PXT D;  4GMB A;  5B4W A;  2H14 A;  2CNX A;  4O1Q D;  5EM2 B;  1JJU B;  5THA A;  5CXB A;  2IUQ A;  4MK0 B;  3BG1 A;  4CY2 A;  2HKM A;  5FQD A;  3ORV D;  3PVU B;  1VYH C;  4ERZ A;  2P9S C;  3OW8 A;  4H5J A;  1MG3 A;  4J8G A;  4GM9 A;  3KRW B;  4QT8 A;  4A09 A;  4FWW A;  3C5M A;  3OTT A;  2QXV A;  4E5Z B;  1N6F A;  4K3I D;  1QNI A;  2G9A A;  5HE2 B;  3SBR A;  4KFM B;  2YBA A;  4GGA A;  4J78 A;  3JAM g;  3EI2 B;  2GC4 A;  3L4M D;  4ERY A;  3PVW B;  3AFC A;  4PC0 A;  5CXC A;  3SN6 B;  3NVN A;  2P9L C;  2IAA A;  3MKQ A;  5C2W B;  5HQG A;  1JMZ B;  3SMR A;  3AL8 B;  3MZL A;  4FHL A;  4ZOZ A;  3IJ0 A;  5GMK n;  2OK6 A;  5IT9 g;  3UVO A;  4CI1 A;  4A11 B;  4ZOV A;  2Z2O A;  3PE7 A;  3SBP A;  5TF2 A;  3C75 H;  4O3T B;  4YVD A;  2H13 A;  4FAN D;  3RN1 D;  2IUR A;  1GP2 B;  3C99 A;  4XYH A;  4X63 B;  3V7D B;  4A09 B;  2P9N C;  4GM3 A;  3AL9 A;  1PEV A;  3I7H A;  3DXK C;  4CY3 A;  4PBZ A;  1RI6 A;  5CXC B;  3FGB A;  5I5J A;  3UVN A;  2YMU A;  4GM8 A;  3MMY A;  4ZOX A;  4GZ8 A;  4GQ2 P;  2H6K A;  4GQB B;  5EMK B;  2O9K A;  2B4E A;  3IJ1 A;  5EMJ B;  3B7F A;  4X3E A;  1B9X A;  2CO0 C;  5EMM B;  1GOT B;  4UI9 R;  3JZG A;  3OKW A;  3SLE D;  3DSM A;  5CYK A;  2IUP A;  4QQE A;  4AEZ A;  3I7P A;  3F3G A;  1A0R B;  1XHM A;  2YB8 B;  4J77 A;  2YNN A;  4ERQ A;  3RFH A;  4OZU A;  4EWR A;  2Z2N A;  4FAV D;  2H47 A;  5TEF A;  4FB1 D;  2H9N A;  1N6D A;  1TBG A;  3NVX A;  2H9P A;  2OVP B;  3V5W B;  3FRX A;  2YNP A;  2HYE A;  3RRM C;  2H6N A;  3MKS B;  2AGY A;  2H9M A;  2QC5 A;  1JOF A;  3E0C A;  4CZV A;  2I3T A;  2I0S A;  5K19 A;  3EI4 A;  3K27 A;  5FKQ A;  4A0B A;  4O3U B;  5A2Q g;  4CI8 A;  2IWF A;  4N14 A;  3MXX A;  2CN2 A;  3K26 A;  4J73 A;  3BWS A;  5IGQ A;  4PBY A;  2XL2 A;  2P9I C;  4PSW B;  5CYK B;  4L9O A;  4JXM A;  2B5M A;  2OVQ B;  1OLZ A;  3I7K A;  3PSC B;  3EG6 A;  1XKS A;  4JSP C;  4L3G D;  4ESG A;  2W18 A;  3CIK B;  4HDJ A;  4PXW A;  5SXM A;  2OJY A;  4PSX B;  5IGO A;  2AH0 A;  1SQ9 A;  3EI3 A;  1ERJ A;  3VH0 A;  2P9K C;  3FM0 A;  3UR4 A;  3JZN A;  3I7O A;  5IC7 A;  3UVK A;  4BH6 A;  4JSV C;  3C9C A;  4J0X A;  3PXS D;  4J8B A;  4G56 B;  2OVR B;  4X60 B;  5HE1 B;  2H3X A;  3SXT D;  4BUJ C;  1K32 A;  3JRO A;  3ZWL B;  2PBI B;  5EAP A;  3EI4 B;  3I8C A;  4NSX A;  4A0B B;  4QL1 A;  3RFG A;  3EU7 A;  5EML B;  5AJA A;  1GXR A;  5I5I A;  4Z8L A;  2J55 H;  3EI1 A;  2HXC A;  2AGX A;  1GG2 B;  4JT5 C;  3SCY A;  4XYI A;  4QRJ A;  2J57 G;  3SWS D;  2CE8 A;  3IIW A;  3EI3 B;  3SFZ A;  1TYQ C;  5HYN B;  3DM0 A;  4JD2 C;  1JMX B;  4CC9 A;  3BG0 A;  2P9U C;  3RN0 D;  2H68 A;  3AH8 B;  2PM9 A;  2GNQ A;  4IMM A;  1YFQ A;  3IKO A;  5FKT A;  4CZX A;  5GXH A;  5EAM A;  1MG2 A;  3RLM D;  5FKR A;  2CE9 A;  3NVQ A;  3IIY A;  4LG9 A;  5AMS A;  2H6Q A;  5TDH B;  3W15 A;  3ODT A;  4FA4 D;  2H9L A;  4U7A A;  5C9Z B;  5I5M A;  2I0T A;  4FA9 D;  5TEE A;  2AGW A;  1PBY B;  3OKY A;  4ZOY A;  3I8E A;  5IJ7 E;  2EBS A;  3EI1 B;  4BL0 A;  5AFU 3;  5GSA A;  4FA5 D;  3GRE A;  2TRC B;  3CFV A;  4E54 A;  5JWZ A;  5KDO B;  4TZ4 A;  4CY5 A;  1P22 A;  1MDA H;  4CZY A;  3HFQ A;  4OWR A;  2MTA H;  3A0F A;  2PM6 B;  1N6E A;  3IJC A;  2Z2P A;  2PM9 B;  5HE0 B;  3DWL C;  2XL3 A;  4H5I A;  3P4F A;  4Y5R D;  2I3S A;  1R5M A;  4L3H D;  4GQ1 A;  1SHY B;  3VA6 A;  1S4U X;  1U2V C;  4A08 A;  3I2N A;  3PXW D;  4J84 A;  3OKY B;  2CN3 A;  2J56 H;  3I7N A;  3F3F A;  4D6V A;  3UKU C;  2CO0 A;  4E54 B;  2HKR A;  5EAR A;  5H17 A;  4J81 A;  2G99 A;  3UKR C;  2I0R A;  3N0D A;  3EMH A;  1OMW B;  3GFC A;  2B5L A;  2YNO A;  3OKT A;  1K8K C;  2AGL A;  3L4O D;  4X61 B;  2B5N A;  5FKS A;  4U1E I;  3V9F A;  4JSN C;  1Q47 A;  2IWK A;  4JSX C;  4K3J B;  1L0Q A;  1XIP A;  1FWX A;  4FA1 D;  4A08 B;  3CFS B;  4O9D A;  3OL2 A;  4CI2 A;  4IA9 A;  3N0E A;  4A7J A;  4GGD A;  4CI3 A;  4L1Q D;  4ZN4 A;  3JRP A;  4J82 A;  4A2L A;  4A0A A;  1SQJ A;  3SBQ A;  3JZH A;  4LGN A;  2GC7 A;  5EAL A;  3J81 g;  5FXY A;  5CXB B; 
#chains in the Genus database with same CATH topology
 1NR0 A;  3ULE C;  2AGZ A;  5HE3 B;  3JPX A;  4G1E A;  1JTD B;  4I79 A;  3UVM A;  3U4Y A;  4JT6 C;  1B9Y A;  5GXI A;  5E6R A;  5C2V B;  3JB9 L;  2OIZ A;  2HJ4 A;  4XEI C;  3RMZ D;  3I89 A;  3I7L A;  4A2M A;  4DNW A;  4Z7O A;  5HDB A;  3SVW D;  2VZ3 A;  5M61 A;  2OK4 A;  4D0K A;  4Y7R A;  4O2W A;  3PSL A;  3SJL D;  3KRX B;  3RSE C;  3OL2 B;  3SHF A;  4GGC A;  1PGU A;  1E8N A;  2HJB A;  5EM2 A;  1VE7 A;  5M5U A;  4A0A B;  1PI6 A;  4J87 A;  4J79 A;  1NEX B;  3IUQ A;  5H1M A;  5H14 A;  3UVL A;  4AOW A;  1UOP A;  3F3P A;  3VGZ A;  5FA5 B;  4J0W A;  3EWE A;  4QAM A;  4E5Z A;  5M5S A;  3GD1 I;  3FCS A;  1QFM A;  1U4C A;  2XYI A;  3EI2 A;  2BBK H;  2P9P C;  2EIB A;  2UZY B;  1L5G A;  2HES X;  2PM7 B;  2IUV A;  4WJK A;  4CY1 A;  2AQ5 A;  4PNK B;  2BCJ B;  3O4H A;  2Q7Q A;  2UZX B;  2XU7 A;  5IJ8 E;  1A12 A;  2AH1 A;  3MZK A;  5FLX g;  3J80 g;  3AL8 A;  5K1C C;  4ES0 A;  4LG8 A;  4R7A B;  1VZ2 A;  4A11 A;  2XE4 A;  3DXM C;  4J86 A;  4O45 A;  3PXT D;  4GMB A;  5B4W A;  3MVD K;  3MUN A;  2H14 A;  2CNX A;  4O1Q D;  5EM2 B;  1JJU B;  5M5R A;  5CXB A;  5THA A;  2IUQ A;  1E5T A;  4MK0 B;  3BG1 A;  4CY2 A;  2HKM A;  5FQD A;  3ORV D;  3PVU B;  1VYH C;  4ERZ A;  2P9S C;  3OW8 A;  4H5J A;  1MG3 A;  4J8G A;  4GM9 A;  3KRW B;  4QT8 A;  2EIE A;  4FWW A;  4A09 A;  3C5M A;  3OTT A;  2QXV A;  4E5Z B;  1N6F A;  3KCI A;  4K3I D;  1QNI A;  2G9A A;  5HE2 B;  3SBR A;  4KFM B;  2YBA A;  4GGA A;  4J78 A;  3JAM g;  3EI2 B;  2GC4 A;  3L4M D;  1H2X A;  1T2X A;  4ERY A;  3AFC A;  3PVW B;  4PC0 A;  5CXC A;  4UM9 A;  3SN6 B;  4BCD A;  4D9S A;  3ZE1 A;  1U8C A;  3NVN A;  1I2M B;  2P9L C;  2IAA A;  3MKQ A;  5C2W B;  5HQG A;  1JMZ B;  3SMR A;  3AL8 B;  3MZL A;  4FHL A;  4ZOZ A;  1M1X A;  3IJ0 A;  5GMK n;  2OK6 A;  5IT9 g;  3UVO A;  4CI1 A;  2VDP A;  4A11 B;  3K6S A;  4IRZ A;  4ZOV A;  2Z2O A;  3PE7 A;  3SBP A;  4NAA A;  5TF2 A;  1QFS A;  3C75 H;  1BPO A;  3GC3 B;  4O3T B;  4WK0 A;  4YVD A;  3K71 A;  2H13 A;  4FAN D;  3RN1 D;  2IUR A;  1GP2 B;  3C99 A;  4XYH A;  4X63 B;  3V7D B;  3O4G A;  4A09 B;  2P9N C;  1E8M A;  4GM3 A;  3AL9 A;  3T3P A;  1PEV A;  3I7H A;  3DXK C;  4CY3 A;  4PBZ A;  1RI6 A;  2VDO A;  5CXC B;  3FGB A;  5I5J A;  3UVN A;  2YMU A;  1C9I A;  3MMY A;  4GM8 A;  4ZOX A;  1UTC A;  2HU8 A;  4GQ2 P;  4GZ8 A;  2H6K A;  4GQB B;  5EMK B;  2O9K A;  1VE6 A;  2B4E A;  3IJ1 A;  5EMJ B;  3B7F A;  4X3E A;  1B9X A;  2CO0 C;  5EMM B;  1GOT B;  4UI9 R;  3NIG A;  3JZG A;  3OKW A;  3SLE D;  3DSM A;  5CYK A;  2IUP A;  4QQE A;  4JHN A;  4AEZ A;  3I7P A;  2VZ1 A;  3F3G A;  1A0R B;  1UOO A;  1XHM A;  2YB8 B;  3IUL A;  2VDQ A;  4J77 A;  2YNN A;  4ERQ A;  3RFH A;  4MMX A;  4OZU A;  4EWR A;  2Z2N A;  1VZ3 A;  5M5T A;  4FAV D;  2H47 A;  5TEF A;  2EIC A;  4FB1 D;  2H9N A;  1N6D A;  1TBG A;  3NVX A;  2H9P A;  2OVP B;  3ZE0 A;  3V5W B;  3FRX A;  2YNP A;  3V4V A;  2HYE A;  3RRM C;  2H6N A;  3MKS B;  2AGY A;  2H9M A;  2QC5 A;  1JOF A;  3E0C A;  4RE6 A;  4CZV A;  2I3T A;  2I0S A;  3ZDZ A;  5K19 A;  3EI4 A;  3K27 A;  5FKQ A;  1YR2 A;  1GOH A;  4A0B A;  4O3U B;  1O6G A;  5A2Q g;  4CI8 A;  2IWF A;  4N14 A;  3MXX A;  2CN2 A;  3K26 A;  4J73 A;  3BWS A;  3EQ8 A;  4PBY A;  5IGQ A;  1TYE A;  2P9I C;  2XL2 A;  4PSW B;  5CYK B;  3IUR A;  4L9O A;  4JXM A;  1H2Y A;  2B5M A;  1K3I A;  2VDL A;  2OVQ B;  1OLZ A;  3I7K A;  3PSC B;  3EG6 A;  4MMY A;  1XKS A;  3IVM A;  3O4J A;  4JSP C;  4L3G D;  4ESG A;  2W18 A;  3CIK B;  4HDJ A;  4PXW A;  5FFO A;  5SXM A;  2OJY A;  4PSX B;  5IGO A;  2AH0 A;  1SQ9 A;  3IUM A;  3EI3 A;  1ERJ A;  2WQ8 A;  3VH0 A;  2P9K C;  3FM0 A;  5E6U A;  3UR4 A;  3JZN A;  4AMZ A;  3I7O A;  5IC7 A;  3UVK A;  4BH6 A;  4JSV C;  1JV2 A;  3V4P A;  3ZDX A;  3C9C A;  4J0X A;  2VDK A;  3PXS D;  4J8B A;  4G56 B;  2OVR B;  4WK2 A;  4X60 B;  5HE1 B;  4WK4 A;  2H3X A;  3SXT D;  4BUJ C;  1K32 A;  3JRO A;  3ZWL B;  2PBI B;  2QR5 A;  5EAP A;  3EI4 B;  3I8C A;  4NSX A;  4A0B B;  4QL1 A;  3RFG A;  3EU7 A;  5EML B;  5AJA A;  1GXR A;  5I5I A;  4Z8L A;  4G55 A;  2J55 H;  4RE5 A;  3EI1 A;  2HXC A;  2AGX A;  1GG2 B;  4JT5 C;  3SCY A;  4XYI A;  3DDU A;  4QRJ A;  2J57 G;  3SWS D;  3QI0 A;  2CE8 A;  3O4I A;  1UOQ A;  4DNU A;  3IIW A;  3EI3 B;  3SFZ A;  1TYQ C;  5HYN B;  3DM0 A;  4JD2 C;  1JMX B;  4CC9 A;  3BG0 A;  2P9U C;  3RN0 D;  4NEN A;  1GOF A;  2H68 A;  3AH8 B;  2PM9 A;  2GNQ A;  4IMM A;  1YFQ A;  3IKO A;  5FKT A;  4CZX A;  5GXH A;  5EAM A;  3EQ7 A;  1MG2 A;  3RLM D;  2EID A;  3IUJ A;  2VC2 A;  5FKR A;  2CE9 A;  1H2W A;  1O6F A;  3NVQ A;  3IIY A;  4JHP C;  4AMY A;  4LG9 A;  5AMS A;  2H6Q A;  5TDH B;  3W15 A;  3ODT A;  4FA4 D;  2H9L A;  5C86 A;  4U7A A;  3VI4 A;  5C9Z B;  2VDM A;  5I5M A;  2I0T A;  4FA9 D;  5TEE A;  2AGW A;  4AN1 A;  1GOG A;  1PBY B;  3OKY A;  4ZOY A;  3I8E A;  5IJ7 E;  2EBS A;  3EI1 B;  4BL0 A;  5AFU 3;  5GSA A;  3T3M A;  4FA5 D;  3GRE A;  2TRC B;  3CFV A;  1H2Z A;  4E54 A;  5JWZ A;  5KDO B;  5M5V A;  4TZ4 A;  4CY5 A;  2JKX A;  1P22 A;  1MDA H;  4CZY A;  3HFQ A;  4OWR A;  3ZDY A;  2MTA H;  3A0F A;  2PM6 B;  1N6E A;  4MMZ A;  4BP8 A;  3IJC A;  4BP9 A;  2Z2P A;  2PM9 B;  2XZG A;  5HE0 B;  3DWL C;  4NBM A;  2XL3 A;  4H5I A;  3P4F A;  4Y5R D;  2I3S A;  4BCB A;  3QHY B;  5FFG A;  3OF7 A;  1R5M A;  4L3H D;  3MUO A;  2XDW A;  4GQ1 A;  1SHY B;  1C9L A;  1S4U X;  3VA6 A;  1U2V C;  4A08 A;  3I2N A;  3PXW D;  2QZP A;  4J84 A;  3OKY B;  2CN3 A;  2J56 H;  3I7N A;  3F3F A;  3NIF A;  4D6V A;  4L1M A;  4Z7Q A;  3UKU C;  2CO0 A;  4E54 B;  2HKR A;  3VI3 A;  4Z7N A;  5EAR A;  4AN0 A;  5H17 A;  4G1M A;  4O02 A;  4BCC A;  4J81 A;  2G99 A;  4NC4 A;  3UKR C;  2I0R A;  3N0D A;  3EMH A;  1OMW B;  3EQ9 A;  3GFC A;  2B5L A;  2YNO A;  3OKT A;  3ZE2 A;  1K8K C;  2AGL A;  3L4O D;  4X61 B;  4UM8 A;  2B5N A;  5FKS A;  4DNV A;  4U1E I;  3V9F A;  4JSN C;  1Q47 A;  5E6S A;  2IWK A;  4JSX C;  4K3J B;  2HU7 A;  1L0Q A;  1XIP A;  1FWX A;  4FA1 D;  4A08 B;  3CFS B;  4O9D A;  2VDN A;  3OL2 A;  3NID A;  4CI2 A;  3FCU A;  4IA9 A;  2BKL A;  3N0E A;  4A7J A;  4GGD A;  4CI3 A;  4L1Q D;  2VDR A;  3JRP A;  4J82 A;  4ZN4 A;  2HU5 A;  4A2L A;  5C92 A;  4A0A A;  3IUN A;  1SQJ A;  3SBQ A;  3JZH A;  4LGN A;  2GC7 A;  3K72 A;  5EAL A;  3J81 g;  5FXY A;  5CXB B;  3IJE A;  4AX4 A; 
#chains in the Genus database with same CATH homology
 1NR0 A;  3ULE C;  2AGZ A;  5HE3 B;  3JPX A;  4I79 A;  3UVM A;  3U4Y A;  4JT6 C;  1B9Y A;  5GXI A;  5C2V B;  3JB9 L;  2OIZ A;  2HJ4 A;  4XEI C;  3RMZ D;  3I89 A;  3I7L A;  4A2M A;  3SVW D;  2OK4 A;  4D0K A;  4Y7R A;  3PSL A;  3SJL D;  3KRX B;  3RSE C;  3OL2 B;  3SHF A;  4GGC A;  1PGU A;  2HJB A;  5EM2 A;  4A0A B;  1PI6 A;  4J87 A;  4J79 A;  1NEX B;  5H1M A;  3UVL A;  5H14 A;  4AOW A;  3F3P A;  3VGZ A;  5FA5 B;  4J0W A;  3EWE A;  4E5Z A;  1U4C A;  2XYI A;  3EI2 A;  2BBK H;  2P9P C;  2UZY B;  2HES X;  2PM7 B;  2IUV A;  4CY1 A;  2AQ5 A;  4PNK B;  2BCJ B;  2Q7Q A;  2UZX B;  2XU7 A;  5IJ8 E;  2AH1 A;  3MZK A;  5FLX g;  3J80 g;  3AL8 A;  5K1C C;  4ES0 A;  4LG8 A;  4R7A B;  4A11 A;  3DXM C;  4J86 A;  4O45 A;  3PXT D;  4GMB A;  5B4W A;  2H14 A;  2CNX A;  4O1Q D;  5EM2 B;  1JJU B;  5THA A;  5CXB A;  2IUQ A;  4MK0 B;  3BG1 A;  4CY2 A;  2HKM A;  5FQD A;  3ORV D;  3PVU B;  1VYH C;  4ERZ A;  2P9S C;  3OW8 A;  4H5J A;  1MG3 A;  4J8G A;  4GM9 A;  3KRW B;  4QT8 A;  4A09 A;  4FWW A;  3C5M A;  3OTT A;  2QXV A;  4E5Z B;  1N6F A;  4K3I D;  1QNI A;  2G9A A;  5HE2 B;  3SBR A;  4KFM B;  2YBA A;  4GGA A;  4J78 A;  3JAM g;  3EI2 B;  2GC4 A;  3L4M D;  4ERY A;  3PVW B;  3AFC A;  4PC0 A;  5CXC A;  3SN6 B;  3NVN A;  2P9L C;  2IAA A;  3MKQ A;  5C2W B;  5HQG A;  1JMZ B;  3SMR A;  3AL8 B;  3MZL A;  4FHL A;  4ZOZ A;  3IJ0 A;  5GMK n;  2OK6 A;  5IT9 g;  3UVO A;  4CI1 A;  4A11 B;  4ZOV A;  2Z2O A;  3PE7 A;  3SBP A;  5TF2 A;  3C75 H;  4O3T B;  4YVD A;  2H13 A;  4FAN D;  3RN1 D;  2IUR A;  1GP2 B;  3C99 A;  4XYH A;  4X63 B;  3V7D B;  4A09 B;  2P9N C;  4GM3 A;  3AL9 A;  1PEV A;  3I7H A;  3DXK C;  4CY3 A;  4PBZ A;  1RI6 A;  5CXC B;  3FGB A;  5I5J A;  3UVN A;  2YMU A;  4GM8 A;  3MMY A;  4ZOX A;  4GZ8 A;  4GQ2 P;  2H6K A;  4GQB B;  5EMK B;  2O9K A;  2B4E A;  3IJ1 A;  5EMJ B;  3B7F A;  4X3E A;  1B9X A;  2CO0 C;  5EMM B;  1GOT B;  4UI9 R;  3JZG A;  3OKW A;  3SLE D;  3DSM A;  5CYK A;  2IUP A;  4QQE A;  4AEZ A;  3I7P A;  3F3G A;  1A0R B;  1XHM A;  2YB8 B;  4J77 A;  2YNN A;  4ERQ A;  3RFH A;  4OZU A;  4EWR A;  2Z2N A;  4FAV D;  2H47 A;  5TEF A;  4FB1 D;  2H9N A;  1N6D A;  1TBG A;  3NVX A;  2H9P A;  2OVP B;  3V5W B;  3FRX A;  2YNP A;  2HYE A;  3RRM C;  2H6N A;  3MKS B;  2AGY A;  2H9M A;  2QC5 A;  1JOF A;  3E0C A;  4CZV A;  2I3T A;  2I0S A;  5K19 A;  3EI4 A;  3K27 A;  5FKQ A;  4A0B A;  4O3U B;  5A2Q g;  4CI8 A;  2IWF A;  4N14 A;  3MXX A;  2CN2 A;  3K26 A;  4J73 A;  3BWS A;  5IGQ A;  4PBY A;  2XL2 A;  2P9I C;  4PSW B;  5CYK B;  4L9O A;  4JXM A;  2B5M A;  2OVQ B;  1OLZ A;  3I7K A;  3PSC B;  3EG6 A;  1XKS A;  4JSP C;  4L3G D;  4ESG A;  2W18 A;  3CIK B;  4HDJ A;  4PXW A;  5SXM A;  2OJY A;  4PSX B;  5IGO A;  2AH0 A;  1SQ9 A;  3EI3 A;  1ERJ A;  3VH0 A;  2P9K C;  3FM0 A;  3UR4 A;  3JZN A;  3I7O A;  5IC7 A;  3UVK A;  4BH6 A;  4JSV C;  3C9C A;  4J0X A;  3PXS D;  4J8B A;  4G56 B;  2OVR B;  4X60 B;  5HE1 B;  2H3X A;  3SXT D;  4BUJ C;  1K32 A;  3JRO A;  3ZWL B;  2PBI B;  5EAP A;  3EI4 B;  3I8C A;  4NSX A;  4A0B B;  4QL1 A;  3RFG A;  3EU7 A;  5EML B;  5AJA A;  1GXR A;  5I5I A;  4Z8L A;  2J55 H;  3EI1 A;  2HXC A;  2AGX A;  1GG2 B;  4JT5 C;  3SCY A;  4XYI A;  4QRJ A;  2J57 G;  3SWS D;  2CE8 A;  3IIW A;  3EI3 B;  3SFZ A;  1TYQ C;  5HYN B;  3DM0 A;  4JD2 C;  1JMX B;  4CC9 A;  3BG0 A;  2P9U C;  3RN0 D;  2H68 A;  3AH8 B;  2PM9 A;  2GNQ A;  4IMM A;  1YFQ A;  3IKO A;  5FKT A;  4CZX A;  5GXH A;  5EAM A;  1MG2 A;  3RLM D;  5FKR A;  2CE9 A;  3NVQ A;  3IIY A;  4LG9 A;  5AMS A;  2H6Q A;  5TDH B;  3W15 A;  3ODT A;  4FA4 D;  2H9L A;  4U7A A;  5C9Z B;  5I5M A;  2I0T A;  4FA9 D;  5TEE A;  2AGW A;  1PBY B;  3OKY A;  4ZOY A;  3I8E A;  5IJ7 E;  2EBS A;  3EI1 B;  4BL0 A;  5AFU 3;  5GSA A;  4FA5 D;  3GRE A;  2TRC B;  3CFV A;  4E54 A;  5JWZ A;  5KDO B;  4TZ4 A;  4CY5 A;  1P22 A;  1MDA H;  4CZY A;  3HFQ A;  4OWR A;  2MTA H;  3A0F A;  2PM6 B;  1N6E A;  3IJC A;  2Z2P A;  2PM9 B;  5HE0 B;  3DWL C;  2XL3 A;  4H5I A;  3P4F A;  4Y5R D;  2I3S A;  1R5M A;  4L3H D;  4GQ1 A;  1SHY B;  3VA6 A;  1S4U X;  1U2V C;  4A08 A;  3I2N A;  3PXW D;  4J84 A;  3OKY B;  2CN3 A;  2J56 H;  3I7N A;  3F3F A;  4D6V A;  3UKU C;  2CO0 A;  4E54 B;  2HKR A;  5EAR A;  5H17 A;  4J81 A;  2G99 A;  3UKR C;  2I0R A;  3N0D A;  3EMH A;  1OMW B;  3GFC A;  2B5L A;  2YNO A;  3OKT A;  1K8K C;  2AGL A;  3L4O D;  4X61 B;  2B5N A;  5FKS A;  4U1E I;  3V9F A;  4JSN C;  1Q47 A;  2IWK A;  4JSX C;  4K3J B;  1L0Q A;  1XIP A;  1FWX A;  4FA1 D;  4A08 B;  3CFS B;  4O9D A;  3OL2 A;  4CI2 A;  4IA9 A;  3N0E A;  4A7J A;  4GGD A;  4CI3 A;  4L1Q D;  4ZN4 A;  3JRP A;  4J82 A;  4A2L A;  4A0A A;  1SQJ A;  3SBQ A;  3JZH A;  4LGN A;  2GC7 A;  5EAL A;  3J81 g;  5FXY A;  5CXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...