2GC4A

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
total genus 93
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gc4A00
4GZ8A 2OK6A 1JMZB 2YNNA 4O45A 2OJYA 4O3TB 4D6VA 3BG1A 4E5ZB 3I8CA 1K32A 4BH6A 5CXCA 2AQ5A 3L4MD 3I7KA 3EI4B 3BWSA 4A0AB 2AGYA 4QL1A 4EWRA 1XKSA 3EG6A 3K27A 5C2VB 2P9PC 4A11B 2XYIA 3J81g 5IGOA 2P9KC 2TRCB 4JT5C 5A2Qg 3N0EA 4PNKB 5I5JA 3C9CA 4IMMA 2Q7QA 3I2NA 4GQ1A 5HQGA 3OKYA 4J73A 4PBYA 1FWXA 3P4FA 5IGQA 4QRJA 2I3SA 3UKRC 3UR4A 2HKRA 3CIKB 4A11A 3W15A 3NVQA 4CY5A 2G9AA 4GQBB 3RMZD 3I7LA 4MK0B 3OW8A 2HESX 1ERJA 2GNQA 4ZOVA 4A0BB 2QC5A 3SBPA 2GC4A 5HE1B 5GXIA 3C75H 4JT6C 4JXMA 3ODTA 5HE0B 3JZNA 3MZLA 5SXMA 4I79A 2AGXA 4FA1D 4A08B 3V9FA 3EI3A 5TEEA 5EMKB 4CI1A 3SCYA 3F3GA 3EWEA 2HJBA 1JMXB 4JSXC 3RN1D 4Y7RA 2P9IC 1A0RB 4J82A 1OLZA 3SN6B 4U1EI 4J86A 3UVOA 3AL8B 4GGAA 2H68A 4D0KA 5HYNB 4GM3A 3SBQA 5I5MA 3C99A 3EU7A 3EI4A 3EI3B 4ZOYA 4J0XA 5CYKA 5C9ZB 3PE7A 2H9PA 5B4WA 2MTAH 3IIWA 4A7JA 4GGDA 2HYEA 3RSEC 3FM0A 4NSXA 2H6QA 4J8BA 2CE8A 3OL2B 1N6FA 2I0RA 4L3GD 2H47A 1U4CA 4X61B 4OWRA 3VGZA 4G56B 5CXCB 3VA6A 2IUQA 5GMKn 2IURA 3MXXA 2CNXA 4X60B 4A08A 3UVNA 2H6KA 3PXWD 3OKWA 1YFQA 1PEVA 5IT9g 1R5MA 1XHMA 3UVMA 3DWLC 2BCJB 4HDJA 4CY3A 3OL2A 3IIYA 3EI1A 3JROA 2OK4A 3SWSD 4E54A 2B5MA 2CE9A 1OMWB 4XYIA 2P9LC 5EAPA 3I8EA 3PSCB 3K26A 1SQ9A 1TBGA 3I7HA 4KFMB 4J0WA 4CY1A 1MG3A 3DSMA 5THAA 3IJ0A 1K8KC 4CC9A 3SFZA 3FRXA 4CY2A 2GC7A 4GGCA 1VYHC 5H17A 5TDHB 5GXHA 2IWFA 5EMMB 3JPXA 3MMYA 4FA4D 3JAMg 2CO0C 4GM9A 2H14A 5IC7A 2XL2A 4GQ2P 3N0DA 3SBRA 3SLED 3NVNA 3F3FA 4FWWA 4JD2C 3EI1B 4XEIC 3PXTD 3J80g 4J84A 2YNOA 4H5IA 5CYKB 3EMHA 4J8GA 3ULEC 3SMRA 4FA5D 5AFU3 3PVUB 1MDAH 2J55H 3UVLA 3EI2A 1P22A 2W18A 3JRPA 5IJ7E 3SJLD 1JJUB 3RLMD 2UZXB 1Q47A 3HFQA 3KRWB 3AL9A 3IJ1A 1L0QA 5K1CC 4AEZA 2B4EA 2HJ4A 3DM0A 3DXKC 3BG0A 4JSPC 4FA9D 4QQEA 3RFHA 1N6EA 2XL3A 5K19A 1B9YA 3AH8B 3RRMC 3I7OA 4PC0A 2OVRB 3CFVA 2I0TA 3UKUC 3JZHA 2G99A 2O9KA 5IJ8E 4XYHA 3RFGA 1PI6A 3DXMC 5EALA 3ZWLB 3EI2B 3PVWB 2PBIB 1GP2B 5FKSA 4O1QD 3AL8A 4ERQA 5EMLB 1JOFA 5AJAA 2H6NA 3E0CA 2OVQB 3RN0D 4A2LA 2H9NA 4K3JB 2P9UC 4LG9A 2QXVA 3MZKA 2IUVA 5FKTA 5TEFA 4CI2A 3SHFA 3C5MA 3PSLA 1U2VC 4A2MA 5FXYA 3ORVD 5CXBB 4J77A 2I3TA 2PM7B 3KRXB 4QT8A 1XIPA 4UI9R 1MG2A 4E5ZA 3GREA 4E54B 4N14A 3NVXA 2J56H 2P9SC 3V5WB 4FAND 3FGBA 3IJCA 3OTTA 3SXTD 2OIZA 4ZOZA 3GFCA 1SHYB 2EBSA 4AOWA 4L1QD 3IKOA 5FKRA 3AFCA 2Z2OA 5FQDA 4GMBA 5HE3B 3U4YA 4TZ4A 2OVPB 4CI8A 4OZUA 2BBKH 2YNPA 3MKSB 5FKQA 1PGUA 5AMSA 5FA5B 4YVDA 4LGNA 4Y5RD 3CFSB 1SQJA 5EMJB 1GXRA 4A09A 4K3ID 1RI6A 2IWKA 4J78A 2PM6B 4CZVA 4L3HD 2H9LA 1PBYB 4ESGA 5H14A 4BUJC 2YB8B 3VH0A 4ERYA 4BL0A 5EARA 3F3PA 2YMUA 1N6DA 2PM9A 2AH0A 4O9DA 4FB1D 2J57G 4Z8LA 1QNIA 1NEXB 1GG2B 3OKTA 4X63B 4CZXA 2AGLA 2YBAA 2AGZA 2Z2NA 5I5IA 4PSXB 5CXBA 2H3XA 2B5NA 5EAMA 3SVWD 3I7NA 4O3UB 1B9XA 5EM2A 4JSNC 4A09B 5KDOB 4PSWB 2IUPA 1NR0A 4ZN4A 2H9MA 3PXSD 5TF2A 5H1MA 2AH1A 4FAVD 2CN2A 4FHLA 5JWZA 3A0FA 4ZOXA 3B7FA 3MKQA 2B5LA 3I89A 4PBZA 5FLXg 4X3EA 4H5JA 4GM8A 1GOTB 2HXCA 4L9OA 2PM9B 3UVKA 2CN3A 5GSAA 4LG8A 3V7DB 5HE2B 2UZYB 3L4OD 2XU7A 4R7AB 4A0BA 4ES0A 3JB9L 4IA9A 4CI3A 4ERZA 2H13A 4J87A 4A0AA 2IAAA 5EM2B 4U7AA 3JZGA 4CZYA 2I0SA 2P9NC 1TYQC 3OKYB 2AGWA 2HKMA 4PXWA 2CO0A 3I7PA 1S4UX 2Z2PA 4J81A 4J79A 4JSVC 5C2WB
chains in the Genus database with same CATH superfamily
4GZ8A 5I5IA 2OK6A 1JMZB 2YNNA 4O45A 2OJYA 4O3TB 4D6VA 3BG1A 4E5ZB 3I8CA 1K32A 4BH6A 5CXCA 2AQ5A 3L4MD 3I7KA 3EI4B 3BWSA 4A0AB 2AGYA 4QL1A 4EWRA 2VZ1A 1XKSA 4L1MA 3EG6A 3K27A 3ZDXA 5C2VB 4O2WA 2P9PC 2VDOA 4A11B 2XYIA 3IUMA 3V4PA 3DDUA 3J81g 1UOQA 4DNVA 5IGOA 1GOHA 2P9KC 2TRCB 4JT5C 2WQ8A 3ZDZA 5A2Qg 3N0EA 3K71A 4PNKB 5I5JA 3C9CA 2Q7QA 3I2NA 4IMMA 4GQ1A 5HQGA 2VDMA 3OKYA 4J73A 4PBYA 1FWXA 3P4FA 5IGQA 2VDQA 4QRJA 2I3SA 3UKRC 3FCUA 3UR4A 4Z7QA 2HKRA 3CIKB 3V4VA 4A11A 3W15A 4G55A 3NVQA 3T3MA 4CY5A 2G9AA 5M61A 4GQBB 3RMZD 3I7LA 4MK0B 1H2ZA 3OW8A 2HESX 1ERJA 2GNQA 4ZOVA 4A0BB 2QC5A 3SBPA 2GC4A 5HE1B 5M5TA 5GXIA 1K3IA 3C75H 4JT6C 4JXMA 3ODTA 5HE0B 3JZNA 3MZLA 5SXMA 1I2MB 4I79A 2AGXA 3IUNA 1H2XA 4FA1D 4A08B 3V9FA 3EI3A 5TEEA 5EMKB 4CI1A 3SCYA 3F3GA 3EWEA 2HJBA 1JMXB 4JSXC 3RN1D 1C9LA 1M1XA 4Y7RA 2P9IC 4AX4A 1A0RB 4J82A 3IULA 1O6FA 1OLZA 3SN6B 4U1EI 4J86A 3UVOA 2VZ3A 3AL8B 4GGAA 2H68A 4D0KA 5HYNB 3QI0A 4GM3A 3SBQA 4NAAA 5I5MA 4MMXA 3C99A 1YR2A 3EU7A 3EI4A 5FFOA 3EI3B 3KCIA 4ZOYA 4J0XA 5CYKA 5C9ZB 3PE7A 2H9PA 5B4WA 2MTAH 3IIWA 3IJEA 4A7JA 4GGDA 2HYEA 3RSEC 3FM0A 1U8CA 4NSXA 3IUQA 2H6QA 4UM8A 4J8BA 2CE8A 3OL2B 1N6FA 2I0RA 4L3GD 2H47A 1U4CA 4X61B 4OWRA 3VGZA 1JV2A 1QFMA 4G56B 5CXCB 2IUQA 3VA6A 5GMKn 3MXXA 2IURA 2CNXA 4X60B 4A08A 3UVNA 2H6KA 3O4GA 3PXWD 3OKWA 1YFQA 4BCCA 1PEVA 5IT9g 1R5MA 1XHMA 3UVMA 3DWLC 2BCJB 4HDJA 4CY3A 1L5GA 3OL2A 3IIYA 3EI1A 3JROA 2OK4A 4NC4A 3SWSD 4E54A 2B5MA 4O02A 2CE9A 1OMWB 4XYIA 2EIEA 2P9LC 2VDLA 5EAPA 3I8EA 1H2WA 3PSCB 3K26A 4MMYA 1SQ9A 4IRZA 1TBGA 3I7HA 4KFMB 4J0WA 4CY1A 1UOPA 1MG3A 3DSMA 5THAA 3IJ0A 1K8KC 4CC9A 3SFZA 1UTCA 3FRXA 4CY2A 2GC7A 4GGCA 1VYHC 5H17A 5TDHB 5GXHA 1VZ3A 4G1MA 3K6SA 2IWFA 5EMMB 3JPXA 3MMYA 4FA4D 3JAMg 2CO0C 4GM9A 2H14A 5IC7A 2XL2A 4GQ2P 3N0DA 3SBRA 3SLED 5E6RA 3NVNA 3F3FA 4G1EA 4FWWA 4JD2C 3EI1B 1TYEA 4XEIC 4WK2A 3PXTD 3J80g 4J84A 2YNOA 2VC2A 2HU5A 4H5IA 5CYKB 3EMHA 4J8GA 4NENA 3ULEC 1E8NA 3SMRA 3IVMA 4FA5D 5AFU3 3ZE2A 3PVUB 3T3PA 1MDAH 4RE6A 2J55H 3UVLA 3EI2A 1P22A 2W18A 3JRPA 5IJ7E 3SJLD 5M5SA 1JJUB 3RLMD 2UZXB 2VDNA 1Q47A 3HFQA 3KRWB 3AL9A 4Z7OA 3IJ1A 3ZE1A 1L0QA 3NIDA 5K1CC 4AEZA 2B4EA 2HJ4A 2HU8A 3DM0A 3DXKC 3BG0A 3K72A 4JSPC 4FA9D 4QQEA 3RFHA 1N6EA 2XL3A 1UOOA 3VI4A 5K19A 1B9YA 3AH8B 4AMZA 5E6UA 5M5VA 3RRMC 3I7OA 5FFGA 4PC0A 4D9SA 1GOFA 4JHPC 2OVRB 3CFVA 2I0TA 3UKUC 3JZHA 4BP8A 2G99A 2O9KA 5IJ8E 4XYHA 3RFGA 1PI6A 3DXMC 5EALA 2VDRA 3ZWLB 3EI2B 3PVWB 2XE4A 2PBIB 1GP2B 5FKSA 4O1QD 3AL8A 4ERQA 1VE6A 5EMLB 1JOFA 5AJAA 2H6NA 3E0CA 2OVQB 3RN0D 4A2LA 2H9NA 4K3JB 2P9UC 4LG9A 2QXVA 3MZKA 2IUVA 5FKTA 5TEFA 4JHNA 3EQ7A 4CI2A 3SHFA 3C5MA 3PSLA 1U2VC 4A2MA 1BPOA 3O4IA 5FXYA 3ORVD 5CXBB 4J77A 2QR5A 2I3TA 2PM7B 3KRXB 4QT8A 3MUOA 1XIPA 1MG2A 4UI9R 4E5ZA 3GREA 4E54B 1E5TA 4N14A 3NVXA 2J56H 2P9SC 3V5WB 2XZGA 4FAND 3FGBA 5M5UA 3IJCA 3OTTA 4BCBA 1H2YA 3SXTD 1VE7A 2OIZA 4ZOZA 3GFCA 1SHYB 4AMYA 2EBSA 4AOWA 4L1QD 3IKOA 1QFSA 5FKRA 3AFCA 2Z2OA 5FQDA 4GMBA 5HE3B 3U4YA 4BCDA 3IUJA 4TZ4A 2OVPB 4CI8A 4OZUA 3NIFA 2BBKH 2YNPA 3MKSB 5FKQA 1PGUA 5AMSA 5FA5B 4YVDA 5M5RA 4LGNA 4Y5RD 3CFSB 1SQJA 5EMJB 1GXRA 4RE5A 4A09A 4K3ID 2EICA 3QHYB 3O4JA 1RI6A 2XDWA 2IWKA 1C9IA 4J78A 2PM6B 4CZVA 4L3HD 2H9LA 1PBYB 4ESGA 3MUNA 1E8MA 5H14A 4BUJC 2BKLA 2YB8B 3VH0A 4ERYA 4BL0A 5EARA 3F3PA 2YMUA 1N6DA 2PM9A 2AH0A 4O9DA 4FB1D 2J57G 4Z8LA 5HDBA 1QNIA 1GG2B 3OKTA 1NEXB 2QZPA 4NBMA 2AGLA 2YBAA 2AGZA 2Z2NA 4X63B 4PSXB 5CXBA 4CZXA 3GC3B 4DNUA 2H3XA 2B5NA 2VDKA 3GD1I 5EAMA 4BP9A 3SVWD 3I7NA 4O3UB 1B9XA 5C86A 5EM2A 1T2XA 4JSNC 4QAMA 5KDOB 4A09B 4PSWB 2IUPA 1NR0A 2EIBA 4ZN4A 3VI3A 2VDPA 3O4HA 2H9MA 3PXSD 5TF2A 3IURA 5H1MA 2AH1A 4FAVD 3EQ9A 2HU7A 2CN2A 4FHLA 4DNWA 1JTDB 5JWZA 3A0FA 4ZOXA 3B7FA 3MKQA 2B5LA 3I89A 4PBZA 5FLXg 4X3EA 4H5JA 4UM9A 4GM8A 1GOTB 2HXCA 4L9OA 3ZDYA 3MVDK 2PM9B 3UVKA 2CN3A 5GSAA 1VZ2A 1O6GA 3ZE0A 4LG8A 4WK4A 5HE2B 2EIDA 3V7DB 5C92A 2UZYB 3L4OD 2XU7A 4WK0A 4R7AB 4A0BA 4ES0A 3JB9L 4IA9A 4CI3A 3NIGA 4ERZA 2H13A 4J87A 4A0AA 2IAAA 5EM2B 4U7AA 3JZGA 4WJKA 4AN1A 4CZYA 2I0SA 2P9NC 1TYQC 5E6SA 3OKYB 2AGWA 2HKMA 4PXWA 3OF7A 2CO0A 3I7PA 1S4UX 2Z2PA 1A12A 4MMZA 4Z7NA 4J81A 4J79A 3FCSA 4JSVC 3EQ8A 5C2WB 4AN0A 1GOGA 2JKXA
chains in the Genus database with same CATH topology
4GZ8A 2OK6A 1JMZB 2YNNA 4O45A 2OJYA 4O3TB 4D6VA 3BG1A 4E5ZB 3I8CA 1K32A 4BH6A 5CXCA 2AQ5A 3L4MD 3I7KA 3EI4B 3BWSA 4A0AB 2AGYA 4QL1A 4EWRA 1XKSA 3EG6A 3K27A 5C2VB 2P9PC 4A11B 2XYIA 3J81g 5IGOA 2P9KC 2TRCB 4JT5C 5A2Qg 3N0EA 4PNKB 5I5JA 3C9CA 4IMMA 2Q7QA 3I2NA 4GQ1A 5HQGA 3OKYA 4J73A 4PBYA 1FWXA 3P4FA 5IGQA 4QRJA 2I3SA 3UKRC 3UR4A 2HKRA 3CIKB 4A11A 3W15A 3NVQA 4CY5A 2G9AA 4GQBB 3RMZD 3I7LA 4MK0B 3OW8A 2HESX 1ERJA 2GNQA 4ZOVA 4A0BB 2QC5A 3SBPA 2GC4A 5HE1B 5GXIA 3C75H 4JT6C 4JXMA 3ODTA 5HE0B 3JZNA 3MZLA 5SXMA 4I79A 2AGXA 4FA1D 4A08B 3V9FA 3EI3A 5TEEA 5EMKB 4CI1A 3SCYA 3F3GA 3EWEA 2HJBA 1JMXB 4JSXC 3RN1D 4Y7RA 2P9IC 1A0RB 4J82A 1OLZA 3SN6B 4U1EI 4J86A 3UVOA 3AL8B 4GGAA 2H68A 4D0KA 5HYNB 4GM3A 3SBQA 5I5MA 3C99A 3EU7A 3EI4A 3EI3B 4ZOYA 4J0XA 5CYKA 5C9ZB 3PE7A 2H9PA 5B4WA 2MTAH 3IIWA 4A7JA 4GGDA 2HYEA 3RSEC 3FM0A 4NSXA 2H6QA 4J8BA 2CE8A 3OL2B 1N6FA 2I0RA 4L3GD 2H47A 1U4CA 4X61B 4OWRA 3VGZA 4G56B 5CXCB 3VA6A 2IUQA 5GMKn 2IURA 3MXXA 2CNXA 4X60B 4A08A 3UVNA 2H6KA 3PXWD 3OKWA 1YFQA 1PEVA 5IT9g 1R5MA 1XHMA 3UVMA 3DWLC 2BCJB 4HDJA 4CY3A 3OL2A 3IIYA 3EI1A 3JROA 2OK4A 3SWSD 4E54A 2B5MA 2CE9A 1OMWB 4XYIA 2P9LC 5EAPA 3I8EA 3PSCB 3K26A 1SQ9A 1TBGA 3I7HA 4KFMB 4J0WA 4CY1A 1MG3A 3DSMA 5THAA 3IJ0A 1K8KC 4CC9A 3SFZA 3FRXA 4CY2A 2GC7A 4GGCA 1VYHC 5H17A 5TDHB 5GXHA 2IWFA 5EMMB 3JPXA 3MMYA 4FA4D 3JAMg 2CO0C 4GM9A 2H14A 5IC7A 2XL2A 4GQ2P 3N0DA 3SBRA 3SLED 3NVNA 3F3FA 4FWWA 4JD2C 3EI1B 4XEIC 3PXTD 3J80g 4J84A 2YNOA 4H5IA 5CYKB 3EMHA 4J8GA 3ULEC 3SMRA 4FA5D 5AFU3 3PVUB 1MDAH 2J55H 3UVLA 3EI2A 1P22A 2W18A 3JRPA 5IJ7E 3SJLD 1JJUB 3RLMD 2UZXB 1Q47A 3HFQA 3KRWB 3AL9A 3IJ1A 1L0QA 5K1CC 4AEZA 2B4EA 2HJ4A 3DM0A 3DXKC 3BG0A 4JSPC 4FA9D 4QQEA 3RFHA 1N6EA 2XL3A 5K19A 1B9YA 3AH8B 3RRMC 3I7OA 4PC0A 2OVRB 3CFVA 2I0TA 3UKUC 3JZHA 2G99A 2O9KA 5IJ8E 4XYHA 3RFGA 1PI6A 3DXMC 5EALA 3ZWLB 3EI2B 3PVWB 2PBIB 1GP2B 5FKSA 4O1QD 3AL8A 4ERQA 5EMLB 1JOFA 5AJAA 2H6NA 3E0CA 2OVQB 3RN0D 4A2LA 2H9NA 4K3JB 2P9UC 4LG9A 2QXVA 3MZKA 2IUVA 5FKTA 5TEFA 4CI2A 3SHFA 3C5MA 3PSLA 1U2VC 4A2MA 5FXYA 3ORVD 5CXBB 4J77A 2I3TA 2PM7B 3KRXB 4QT8A 1XIPA 4UI9R 1MG2A 4E5ZA 3GREA 4E54B 4N14A 3NVXA 2J56H 2P9SC 3V5WB 4FAND 3FGBA 3IJCA 3OTTA 3SXTD 2OIZA 4ZOZA 3GFCA 1SHYB 2EBSA 4AOWA 4L1QD 3IKOA 5FKRA 3AFCA 2Z2OA 5FQDA 4GMBA 5HE3B 3U4YA 4TZ4A 2OVPB 4CI8A 4OZUA 2BBKH 2YNPA 3MKSB 5FKQA 1PGUA 5AMSA 5FA5B 4YVDA 4LGNA 4Y5RD 3CFSB 1SQJA 5EMJB 1GXRA 4A09A 4K3ID 1RI6A 2IWKA 4J78A 2PM6B 4CZVA 4L3HD 2H9LA 1PBYB 4ESGA 5H14A 4BUJC 2YB8B 3VH0A 4ERYA 4BL0A 5EARA 3F3PA 2YMUA 1N6DA 2PM9A 2AH0A 4O9DA 4FB1D 2J57G 4Z8LA 1QNIA 1NEXB 1GG2B 3OKTA 4X63B 4CZXA 2AGLA 2YBAA 2AGZA 2Z2NA 5I5IA 4PSXB 5CXBA 2H3XA 2B5NA 5EAMA 3SVWD 3I7NA 4O3UB 1B9XA 5EM2A 4JSNC 4A09B 5KDOB 4PSWB 2IUPA 1NR0A 4ZN4A 2H9MA 3PXSD 5TF2A 5H1MA 2AH1A 4FAVD 2CN2A 4FHLA 5JWZA 3A0FA 4ZOXA 3B7FA 3MKQA 2B5LA 3I89A 4PBZA 5FLXg 4X3EA 4H5JA 4GM8A 1GOTB 2HXCA 4L9OA 2PM9B 3UVKA 2CN3A 5GSAA 4LG8A 3V7DB 5HE2B 2UZYB 3L4OD 2XU7A 4R7AB 4A0BA 4ES0A 3JB9L 4IA9A 4CI3A 4ERZA 2H13A 4J87A 4A0AA 2IAAA 5EM2B 4U7AA 3JZGA 4CZYA 2I0SA 2P9NC 1TYQC 3OKYB 2AGWA 2HKMA 4PXWA 2CO0A 3I7PA 1S4UX 2Z2PA 4J81A 4J79A 4JSVC 5C2WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZ8 A;  2OK6 A;  1JMZ B;  2YNN A;  4O45 A;  2OJY A;  4O3T B;  4D6V A;  3BG1 A;  4E5Z B;  3I8C A;  1K32 A;  4BH6 A;  5CXC A;  2AQ5 A;  3L4M D;  3I7K A;  3EI4 B;  3BWS A;  4A0A B;  2AGY A;  4QL1 A;  4EWR A;  1XKS A;  3EG6 A;  3K27 A;  5C2V B;  2P9P C;  4A11 B;  2XYI A;  3J81 g;  5IGO A;  2P9K C;  2TRC B;  4JT5 C;  5A2Q g;  3N0E A;  4PNK B;  5I5J A;  3C9C A;  4IMM A;  2Q7Q A;  3I2N A;  4GQ1 A;  5HQG A;  3OKY A;  4J73 A;  4PBY A;  1FWX A;  3P4F A;  5IGQ A;  4QRJ A;  2I3S A;  3UKR C;  3UR4 A;  2HKR A;  3CIK B;  4A11 A;  3W15 A;  3NVQ A;  4CY5 A;  2G9A A;  4GQB B;  3RMZ D;  3I7L A;  4MK0 B;  3OW8 A;  2HES X;  1ERJ A;  2GNQ A;  4ZOV A;  4A0B B;  2QC5 A;  3SBP A;  2GC4 A;  5HE1 B;  5GXI A;  3C75 H;  4JT6 C;  4JXM A;  3ODT A;  5HE0 B;  3JZN A;  3MZL A;  5SXM A;  4I79 A;  2AGX A;  4FA1 D;  4A08 B;  3V9F A;  3EI3 A;  5TEE A;  5EMK B;  4CI1 A;  3SCY A;  3F3G A;  3EWE A;  2HJB A;  1JMX B;  4JSX C;  3RN1 D;  4Y7R A;  2P9I C;  1A0R B;  4J82 A;  1OLZ A;  3SN6 B;  4U1E I;  4J86 A;  3UVO A;  3AL8 B;  4GGA A;  2H68 A;  4D0K A;  5HYN B;  4GM3 A;  3SBQ A;  5I5M A;  3C99 A;  3EU7 A;  3EI4 A;  3EI3 B;  4ZOY A;  4J0X A;  5CYK A;  5C9Z B;  3PE7 A;  2H9P A;  5B4W A;  2MTA H;  3IIW A;  4A7J A;  4GGD A;  2HYE A;  3RSE C;  3FM0 A;  4NSX A;  2H6Q A;  4J8B A;  2CE8 A;  3OL2 B;  1N6F A;  2I0R A;  4L3G D;  2H47 A;  1U4C A;  4X61 B;  4OWR A;  3VGZ A;  4G56 B;  5CXC B;  3VA6 A;  2IUQ A;  5GMK n;  2IUR A;  3MXX A;  2CNX A;  4X60 B;  4A08 A;  3UVN A;  2H6K A;  3PXW D;  3OKW A;  1YFQ A;  1PEV A;  5IT9 g;  1R5M A;  1XHM A;  3UVM A;  3DWL C;  2BCJ B;  4HDJ A;  4CY3 A;  3OL2 A;  3IIY A;  3EI1 A;  3JRO A;  2OK4 A;  3SWS D;  4E54 A;  2B5M A;  2CE9 A;  1OMW B;  4XYI A;  2P9L C;  5EAP A;  3I8E A;  3PSC B;  3K26 A;  1SQ9 A;  1TBG A;  3I7H A;  4KFM B;  4J0W A;  4CY1 A;  1MG3 A;  3DSM A;  5THA A;  3IJ0 A;  1K8K C;  4CC9 A;  3SFZ A;  3FRX A;  4CY2 A;  2GC7 A;  4GGC A;  1VYH C;  5H17 A;  5TDH B;  5GXH A;  2IWF A;  5EMM B;  3JPX A;  3MMY A;  4FA4 D;  3JAM g;  2CO0 C;  4GM9 A;  2H14 A;  5IC7 A;  2XL2 A;  4GQ2 P;  3N0D A;  3SBR A;  3SLE D;  3NVN A;  3F3F A;  4FWW A;  4JD2 C;  3EI1 B;  4XEI C;  3PXT D;  3J80 g;  4J84 A;  2YNO A;  4H5I A;  5CYK B;  3EMH A;  4J8G A;  3ULE C;  3SMR A;  4FA5 D;  5AFU 3;  3PVU B;  1MDA H;  2J55 H;  3UVL A;  3EI2 A;  1P22 A;  2W18 A;  3JRP A;  5IJ7 E;  3SJL D;  1JJU B;  3RLM D;  2UZX B;  1Q47 A;  3HFQ A;  3KRW B;  3AL9 A;  3IJ1 A;  1L0Q A;  5K1C C;  4AEZ A;  2B4E A;  2HJ4 A;  3DM0 A;  3DXK C;  3BG0 A;  4JSP C;  4FA9 D;  4QQE A;  3RFH A;  1N6E A;  2XL3 A;  5K19 A;  1B9Y A;  3AH8 B;  3RRM C;  3I7O A;  4PC0 A;  2OVR B;  3CFV A;  2I0T A;  3UKU C;  3JZH A;  2G99 A;  2O9K A;  5IJ8 E;  4XYH A;  3RFG A;  1PI6 A;  3DXM C;  5EAL A;  3ZWL B;  3EI2 B;  3PVW B;  2PBI B;  1GP2 B;  5FKS A;  4O1Q D;  3AL8 A;  4ERQ A;  5EML B;  1JOF A;  5AJA A;  2H6N A;  3E0C A;  2OVQ B;  3RN0 D;  4A2L A;  2H9N A;  4K3J B;  2P9U C;  4LG9 A;  2QXV A;  3MZK A;  2IUV A;  5FKT A;  5TEF A;  4CI2 A;  3SHF A;  3C5M A;  3PSL A;  1U2V C;  4A2M A;  5FXY A;  3ORV D;  5CXB B;  4J77 A;  2I3T A;  2PM7 B;  3KRX B;  4QT8 A;  1XIP A;  4UI9 R;  1MG2 A;  4E5Z A;  3GRE A;  4E54 B;  4N14 A;  3NVX A;  2J56 H;  2P9S C;  3V5W B;  4FAN D;  3FGB A;  3IJC A;  3OTT A;  3SXT D;  2OIZ A;  4ZOZ A;  3GFC A;  1SHY B;  2EBS A;  4AOW A;  4L1Q D;  3IKO A;  5FKR A;  3AFC A;  2Z2O A;  5FQD A;  4GMB A;  5HE3 B;  3U4Y A;  4TZ4 A;  2OVP B;  4CI8 A;  4OZU A;  2BBK H;  2YNP A;  3MKS B;  5FKQ A;  1PGU A;  5AMS A;  5FA5 B;  4YVD A;  4LGN A;  4Y5R D;  3CFS B;  1SQJ A;  5EMJ B;  1GXR A;  4A09 A;  4K3I D;  1RI6 A;  2IWK A;  4J78 A;  2PM6 B;  4CZV A;  4L3H D;  2H9L A;  1PBY B;  4ESG A;  5H14 A;  4BUJ C;  2YB8 B;  3VH0 A;  4ERY A;  4BL0 A;  5EAR A;  3F3P A;  2YMU A;  1N6D A;  2PM9 A;  2AH0 A;  4O9D A;  4FB1 D;  2J57 G;  4Z8L A;  1QNI A;  1NEX B;  1GG2 B;  3OKT A;  4X63 B;  4CZX A;  2AGL A;  2YBA A;  2AGZ A;  2Z2N A;  5I5I A;  4PSX B;  5CXB A;  2H3X A;  2B5N A;  5EAM A;  3SVW D;  3I7N A;  4O3U B;  1B9X A;  5EM2 A;  4JSN C;  4A09 B;  5KDO B;  4PSW B;  2IUP A;  1NR0 A;  4ZN4 A;  2H9M A;  3PXS D;  5TF2 A;  5H1M A;  2AH1 A;  4FAV D;  2CN2 A;  4FHL A;  5JWZ A;  3A0F A;  4ZOX A;  3B7F A;  3MKQ A;  2B5L A;  3I89 A;  4PBZ A;  5FLX g;  4X3E A;  4H5J A;  4GM8 A;  1GOT B;  2HXC A;  4L9O A;  2PM9 B;  3UVK A;  2CN3 A;  5GSA A;  4LG8 A;  3V7D B;  5HE2 B;  2UZY B;  3L4O D;  2XU7 A;  4R7A B;  4A0B A;  4ES0 A;  3JB9 L;  4IA9 A;  4CI3 A;  4ERZ A;  2H13 A;  4J87 A;  4A0A A;  2IAA A;  5EM2 B;  4U7A A;  3JZG A;  4CZY A;  2I0S A;  2P9N C;  1TYQ C;  3OKY B;  2AGW A;  2HKM A;  4PXW A;  2CO0 A;  3I7P A;  1S4U X;  2Z2P A;  4J81 A;  4J79 A;  4JSV C;  5C2W B; 
#chains in the Genus database with same CATH topology
 4GZ8 A;  5I5I A;  2OK6 A;  1JMZ B;  2YNN A;  4O45 A;  2OJY A;  4O3T B;  4D6V A;  3BG1 A;  4E5Z B;  3I8C A;  1K32 A;  4BH6 A;  5CXC A;  2AQ5 A;  3L4M D;  3I7K A;  3EI4 B;  3BWS A;  4A0A B;  2AGY A;  4QL1 A;  4EWR A;  2VZ1 A;  1XKS A;  4L1M A;  3EG6 A;  3K27 A;  3ZDX A;  5C2V B;  4O2W A;  2P9P C;  2VDO A;  4A11 B;  2XYI A;  3IUM A;  3V4P A;  3DDU A;  3J81 g;  1UOQ A;  4DNV A;  5IGO A;  1GOH A;  2P9K C;  2TRC B;  4JT5 C;  2WQ8 A;  3ZDZ A;  5A2Q g;  3N0E A;  3K71 A;  4PNK B;  5I5J A;  3C9C A;  2Q7Q A;  3I2N A;  4IMM A;  4GQ1 A;  5HQG A;  2VDM A;  3OKY A;  4J73 A;  4PBY A;  1FWX A;  3P4F A;  5IGQ A;  2VDQ A;  4QRJ A;  2I3S A;  3UKR C;  3FCU A;  3UR4 A;  4Z7Q A;  2HKR A;  3CIK B;  3V4V A;  4A11 A;  3W15 A;  4G55 A;  3NVQ A;  3T3M A;  4CY5 A;  2G9A A;  5M61 A;  4GQB B;  3RMZ D;  3I7L A;  4MK0 B;  1H2Z A;  3OW8 A;  2HES X;  1ERJ A;  2GNQ A;  4ZOV A;  4A0B B;  2QC5 A;  3SBP A;  2GC4 A;  5HE1 B;  5M5T A;  5GXI A;  1K3I A;  3C75 H;  4JT6 C;  4JXM A;  3ODT A;  5HE0 B;  3JZN A;  3MZL A;  5SXM A;  1I2M B;  4I79 A;  2AGX A;  3IUN A;  1H2X A;  4FA1 D;  4A08 B;  3V9F A;  3EI3 A;  5TEE A;  5EMK B;  4CI1 A;  3SCY A;  3F3G A;  3EWE A;  2HJB A;  1JMX B;  4JSX C;  3RN1 D;  1C9L A;  1M1X A;  4Y7R A;  2P9I C;  4AX4 A;  1A0R B;  4J82 A;  3IUL A;  1O6F A;  1OLZ A;  3SN6 B;  4U1E I;  4J86 A;  3UVO A;  2VZ3 A;  3AL8 B;  4GGA A;  2H68 A;  4D0K A;  5HYN B;  3QI0 A;  4GM3 A;  3SBQ A;  4NAA A;  5I5M A;  4MMX A;  3C99 A;  1YR2 A;  3EU7 A;  3EI4 A;  5FFO A;  3EI3 B;  3KCI A;  4ZOY A;  4J0X A;  5CYK A;  5C9Z B;  3PE7 A;  2H9P A;  5B4W A;  2MTA H;  3IIW A;  3IJE A;  4A7J A;  4GGD A;  2HYE A;  3RSE C;  3FM0 A;  1U8C A;  4NSX A;  3IUQ A;  2H6Q A;  4UM8 A;  4J8B A;  2CE8 A;  3OL2 B;  1N6F A;  2I0R A;  4L3G D;  2H47 A;  1U4C A;  4X61 B;  4OWR A;  3VGZ A;  1JV2 A;  1QFM A;  4G56 B;  5CXC B;  2IUQ A;  3VA6 A;  5GMK n;  3MXX A;  2IUR A;  2CNX A;  4X60 B;  4A08 A;  3UVN A;  2H6K A;  3O4G A;  3PXW D;  3OKW A;  1YFQ A;  4BCC A;  1PEV A;  5IT9 g;  1R5M A;  1XHM A;  3UVM A;  3DWL C;  2BCJ B;  4HDJ A;  4CY3 A;  1L5G A;  3OL2 A;  3IIY A;  3EI1 A;  3JRO A;  2OK4 A;  4NC4 A;  3SWS D;  4E54 A;  2B5M A;  4O02 A;  2CE9 A;  1OMW B;  4XYI A;  2EIE A;  2P9L C;  2VDL A;  5EAP A;  3I8E A;  1H2W A;  3PSC B;  3K26 A;  4MMY A;  1SQ9 A;  4IRZ A;  1TBG A;  3I7H A;  4KFM B;  4J0W A;  4CY1 A;  1UOP A;  1MG3 A;  3DSM A;  5THA A;  3IJ0 A;  1K8K C;  4CC9 A;  3SFZ A;  1UTC A;  3FRX A;  4CY2 A;  2GC7 A;  4GGC A;  1VYH C;  5H17 A;  5TDH B;  5GXH A;  1VZ3 A;  4G1M A;  3K6S A;  2IWF A;  5EMM B;  3JPX A;  3MMY A;  4FA4 D;  3JAM g;  2CO0 C;  4GM9 A;  2H14 A;  5IC7 A;  2XL2 A;  4GQ2 P;  3N0D A;  3SBR A;  3SLE D;  5E6R A;  3NVN A;  3F3F A;  4G1E A;  4FWW A;  4JD2 C;  3EI1 B;  1TYE A;  4XEI C;  4WK2 A;  3PXT D;  3J80 g;  4J84 A;  2YNO A;  2VC2 A;  2HU5 A;  4H5I A;  5CYK B;  3EMH A;  4J8G A;  4NEN A;  3ULE C;  1E8N A;  3SMR A;  3IVM A;  4FA5 D;  5AFU 3;  3ZE2 A;  3PVU B;  3T3P A;  1MDA H;  4RE6 A;  2J55 H;  3UVL A;  3EI2 A;  1P22 A;  2W18 A;  3JRP A;  5IJ7 E;  3SJL D;  5M5S A;  1JJU B;  3RLM D;  2UZX B;  2VDN A;  1Q47 A;  3HFQ A;  3KRW B;  3AL9 A;  4Z7O A;  3IJ1 A;  3ZE1 A;  1L0Q A;  3NID A;  5K1C C;  4AEZ A;  2B4E A;  2HJ4 A;  2HU8 A;  3DM0 A;  3DXK C;  3BG0 A;  3K72 A;  4JSP C;  4FA9 D;  4QQE A;  3RFH A;  1N6E A;  2XL3 A;  1UOO A;  3VI4 A;  5K19 A;  1B9Y A;  3AH8 B;  4AMZ A;  5E6U A;  5M5V A;  3RRM C;  3I7O A;  5FFG A;  4PC0 A;  4D9S A;  1GOF A;  4JHP C;  2OVR B;  3CFV A;  2I0T A;  3UKU C;  3JZH A;  4BP8 A;  2G99 A;  2O9K A;  5IJ8 E;  4XYH A;  3RFG A;  1PI6 A;  3DXM C;  5EAL A;  2VDR A;  3ZWL B;  3EI2 B;  3PVW B;  2XE4 A;  2PBI B;  1GP2 B;  5FKS A;  4O1Q D;  3AL8 A;  4ERQ A;  1VE6 A;  5EML B;  1JOF A;  5AJA A;  2H6N A;  3E0C A;  2OVQ B;  3RN0 D;  4A2L A;  2H9N A;  4K3J B;  2P9U C;  4LG9 A;  2QXV A;  3MZK A;  2IUV A;  5FKT A;  5TEF A;  4JHN A;  3EQ7 A;  4CI2 A;  3SHF A;  3C5M A;  3PSL A;  1U2V C;  4A2M A;  1BPO A;  3O4I A;  5FXY A;  3ORV D;  5CXB B;  4J77 A;  2QR5 A;  2I3T A;  2PM7 B;  3KRX B;  4QT8 A;  3MUO A;  1XIP A;  1MG2 A;  4UI9 R;  4E5Z A;  3GRE A;  4E54 B;  1E5T A;  4N14 A;  3NVX A;  2J56 H;  2P9S C;  3V5W B;  2XZG A;  4FAN D;  3FGB A;  5M5U A;  3IJC A;  3OTT A;  4BCB A;  1H2Y A;  3SXT D;  1VE7 A;  2OIZ A;  4ZOZ A;  3GFC A;  1SHY B;  4AMY A;  2EBS A;  4AOW A;  4L1Q D;  3IKO A;  1QFS A;  5FKR A;  3AFC A;  2Z2O A;  5FQD A;  4GMB A;  5HE3 B;  3U4Y A;  4BCD A;  3IUJ A;  4TZ4 A;  2OVP B;  4CI8 A;  4OZU A;  3NIF A;  2BBK H;  2YNP A;  3MKS B;  5FKQ A;  1PGU A;  5AMS A;  5FA5 B;  4YVD A;  5M5R A;  4LGN A;  4Y5R D;  3CFS B;  1SQJ A;  5EMJ B;  1GXR A;  4RE5 A;  4A09 A;  4K3I D;  2EIC A;  3QHY B;  3O4J A;  1RI6 A;  2XDW A;  2IWK A;  1C9I A;  4J78 A;  2PM6 B;  4CZV A;  4L3H D;  2H9L A;  1PBY B;  4ESG A;  3MUN A;  1E8M A;  5H14 A;  4BUJ C;  2BKL A;  2YB8 B;  3VH0 A;  4ERY A;  4BL0 A;  5EAR A;  3F3P A;  2YMU A;  1N6D A;  2PM9 A;  2AH0 A;  4O9D A;  4FB1 D;  2J57 G;  4Z8L A;  5HDB A;  1QNI A;  1GG2 B;  3OKT A;  1NEX B;  2QZP A;  4NBM A;  2AGL A;  2YBA A;  2AGZ A;  2Z2N A;  4X63 B;  4PSX B;  5CXB A;  4CZX A;  3GC3 B;  4DNU A;  2H3X A;  2B5N A;  2VDK A;  3GD1 I;  5EAM A;  4BP9 A;  3SVW D;  3I7N A;  4O3U B;  1B9X A;  5C86 A;  5EM2 A;  1T2X A;  4JSN C;  4QAM A;  5KDO B;  4A09 B;  4PSW B;  2IUP A;  1NR0 A;  2EIB A;  4ZN4 A;  3VI3 A;  2VDP A;  3O4H A;  2H9M A;  3PXS D;  5TF2 A;  3IUR A;  5H1M A;  2AH1 A;  4FAV D;  3EQ9 A;  2HU7 A;  2CN2 A;  4FHL A;  4DNW A;  1JTD B;  5JWZ A;  3A0F A;  4ZOX A;  3B7F A;  3MKQ A;  2B5L A;  3I89 A;  4PBZ A;  5FLX g;  4X3E A;  4H5J A;  4UM9 A;  4GM8 A;  1GOT B;  2HXC A;  4L9O A;  3ZDY A;  3MVD K;  2PM9 B;  3UVK A;  2CN3 A;  5GSA A;  1VZ2 A;  1O6G A;  3ZE0 A;  4LG8 A;  4WK4 A;  5HE2 B;  2EID A;  3V7D B;  5C92 A;  2UZY B;  3L4O D;  2XU7 A;  4WK0 A;  4R7A B;  4A0B A;  4ES0 A;  3JB9 L;  4IA9 A;  4CI3 A;  3NIG A;  4ERZ A;  2H13 A;  4J87 A;  4A0A A;  2IAA A;  5EM2 B;  4U7A A;  3JZG A;  4WJK A;  4AN1 A;  4CZY A;  2I0S A;  2P9N C;  1TYQ C;  5E6S A;  3OKY B;  2AGW A;  2HKM A;  4PXW A;  3OF7 A;  2CO0 A;  3I7P A;  1S4U X;  2Z2P A;  1A12 A;  4MMZ A;  4Z7N A;  4J81 A;  4J79 A;  3FCS A;  4JSV C;  3EQ8 A;  5C2W B;  4AN0 A;  1GOG A;  2JKX A; 
#chains in the Genus database with same CATH homology
 4GZ8 A;  2OK6 A;  1JMZ B;  2YNN A;  4O45 A;  2OJY A;  4O3T B;  4D6V A;  3BG1 A;  4E5Z B;  3I8C A;  1K32 A;  4BH6 A;  5CXC A;  2AQ5 A;  3L4M D;  3I7K A;  3EI4 B;  3BWS A;  4A0A B;  2AGY A;  4QL1 A;  4EWR A;  1XKS A;  3EG6 A;  3K27 A;  5C2V B;  2P9P C;  4A11 B;  2XYI A;  3J81 g;  5IGO A;  2P9K C;  2TRC B;  4JT5 C;  5A2Q g;  3N0E A;  4PNK B;  5I5J A;  3C9C A;  4IMM A;  2Q7Q A;  3I2N A;  4GQ1 A;  5HQG A;  3OKY A;  4J73 A;  4PBY A;  1FWX A;  3P4F A;  5IGQ A;  4QRJ A;  2I3S A;  3UKR C;  3UR4 A;  2HKR A;  3CIK B;  4A11 A;  3W15 A;  3NVQ A;  4CY5 A;  2G9A A;  4GQB B;  3RMZ D;  3I7L A;  4MK0 B;  3OW8 A;  2HES X;  1ERJ A;  2GNQ A;  4ZOV A;  4A0B B;  2QC5 A;  3SBP A;  2GC4 A;  5HE1 B;  5GXI A;  3C75 H;  4JT6 C;  4JXM A;  3ODT A;  5HE0 B;  3JZN A;  3MZL A;  5SXM A;  4I79 A;  2AGX A;  4FA1 D;  4A08 B;  3V9F A;  3EI3 A;  5TEE A;  5EMK B;  4CI1 A;  3SCY A;  3F3G A;  3EWE A;  2HJB A;  1JMX B;  4JSX C;  3RN1 D;  4Y7R A;  2P9I C;  1A0R B;  4J82 A;  1OLZ A;  3SN6 B;  4U1E I;  4J86 A;  3UVO A;  3AL8 B;  4GGA A;  2H68 A;  4D0K A;  5HYN B;  4GM3 A;  3SBQ A;  5I5M A;  3C99 A;  3EU7 A;  3EI4 A;  3EI3 B;  4ZOY A;  4J0X A;  5CYK A;  5C9Z B;  3PE7 A;  2H9P A;  5B4W A;  2MTA H;  3IIW A;  4A7J A;  4GGD A;  2HYE A;  3RSE C;  3FM0 A;  4NSX A;  2H6Q A;  4J8B A;  2CE8 A;  3OL2 B;  1N6F A;  2I0R A;  4L3G D;  2H47 A;  1U4C A;  4X61 B;  4OWR A;  3VGZ A;  4G56 B;  5CXC B;  3VA6 A;  2IUQ A;  5GMK n;  2IUR A;  3MXX A;  2CNX A;  4X60 B;  4A08 A;  3UVN A;  2H6K A;  3PXW D;  3OKW A;  1YFQ A;  1PEV A;  5IT9 g;  1R5M A;  1XHM A;  3UVM A;  3DWL C;  2BCJ B;  4HDJ A;  4CY3 A;  3OL2 A;  3IIY A;  3EI1 A;  3JRO A;  2OK4 A;  3SWS D;  4E54 A;  2B5M A;  2CE9 A;  1OMW B;  4XYI A;  2P9L C;  5EAP A;  3I8E A;  3PSC B;  3K26 A;  1SQ9 A;  1TBG A;  3I7H A;  4KFM B;  4J0W A;  4CY1 A;  1MG3 A;  3DSM A;  5THA A;  3IJ0 A;  1K8K C;  4CC9 A;  3SFZ A;  3FRX A;  4CY2 A;  2GC7 A;  4GGC A;  1VYH C;  5H17 A;  5TDH B;  5GXH A;  2IWF A;  5EMM B;  3JPX A;  3MMY A;  4FA4 D;  3JAM g;  2CO0 C;  4GM9 A;  2H14 A;  5IC7 A;  2XL2 A;  4GQ2 P;  3N0D A;  3SBR A;  3SLE D;  3NVN A;  3F3F A;  4FWW A;  4JD2 C;  3EI1 B;  4XEI C;  3PXT D;  3J80 g;  4J84 A;  2YNO A;  4H5I A;  5CYK B;  3EMH A;  4J8G A;  3ULE C;  3SMR A;  4FA5 D;  5AFU 3;  3PVU B;  1MDA H;  2J55 H;  3UVL A;  3EI2 A;  1P22 A;  2W18 A;  3JRP A;  5IJ7 E;  3SJL D;  1JJU B;  3RLM D;  2UZX B;  1Q47 A;  3HFQ A;  3KRW B;  3AL9 A;  3IJ1 A;  1L0Q A;  5K1C C;  4AEZ A;  2B4E A;  2HJ4 A;  3DM0 A;  3DXK C;  3BG0 A;  4JSP C;  4FA9 D;  4QQE A;  3RFH A;  1N6E A;  2XL3 A;  5K19 A;  1B9Y A;  3AH8 B;  3RRM C;  3I7O A;  4PC0 A;  2OVR B;  3CFV A;  2I0T A;  3UKU C;  3JZH A;  2G99 A;  2O9K A;  5IJ8 E;  4XYH A;  3RFG A;  1PI6 A;  3DXM C;  5EAL A;  3ZWL B;  3EI2 B;  3PVW B;  2PBI B;  1GP2 B;  5FKS A;  4O1Q D;  3AL8 A;  4ERQ A;  5EML B;  1JOF A;  5AJA A;  2H6N A;  3E0C A;  2OVQ B;  3RN0 D;  4A2L A;  2H9N A;  4K3J B;  2P9U C;  4LG9 A;  2QXV A;  3MZK A;  2IUV A;  5FKT A;  5TEF A;  4CI2 A;  3SHF A;  3C5M A;  3PSL A;  1U2V C;  4A2M A;  5FXY A;  3ORV D;  5CXB B;  4J77 A;  2I3T A;  2PM7 B;  3KRX B;  4QT8 A;  1XIP A;  4UI9 R;  1MG2 A;  4E5Z A;  3GRE A;  4E54 B;  4N14 A;  3NVX A;  2J56 H;  2P9S C;  3V5W B;  4FAN D;  3FGB A;  3IJC A;  3OTT A;  3SXT D;  2OIZ A;  4ZOZ A;  3GFC A;  1SHY B;  2EBS A;  4AOW A;  4L1Q D;  3IKO A;  5FKR A;  3AFC A;  2Z2O A;  5FQD A;  4GMB A;  5HE3 B;  3U4Y A;  4TZ4 A;  2OVP B;  4CI8 A;  4OZU A;  2BBK H;  2YNP A;  3MKS B;  5FKQ A;  1PGU A;  5AMS A;  5FA5 B;  4YVD A;  4LGN A;  4Y5R D;  3CFS B;  1SQJ A;  5EMJ B;  1GXR A;  4A09 A;  4K3I D;  1RI6 A;  2IWK A;  4J78 A;  2PM6 B;  4CZV A;  4L3H D;  2H9L A;  1PBY B;  4ESG A;  5H14 A;  4BUJ C;  2YB8 B;  3VH0 A;  4ERY A;  4BL0 A;  5EAR A;  3F3P A;  2YMU A;  1N6D A;  2PM9 A;  2AH0 A;  4O9D A;  4FB1 D;  2J57 G;  4Z8L A;  1QNI A;  1NEX B;  1GG2 B;  3OKT A;  4X63 B;  4CZX A;  2AGL A;  2YBA A;  2AGZ A;  2Z2N A;  5I5I A;  4PSX B;  5CXB A;  2H3X A;  2B5N A;  5EAM A;  3SVW D;  3I7N A;  4O3U B;  1B9X A;  5EM2 A;  4JSN C;  4A09 B;  5KDO B;  4PSW B;  2IUP A;  1NR0 A;  4ZN4 A;  2H9M A;  3PXS D;  5TF2 A;  5H1M A;  2AH1 A;  4FAV D;  2CN2 A;  4FHL A;  5JWZ A;  3A0F A;  4ZOX A;  3B7F A;  3MKQ A;  2B5L A;  3I89 A;  4PBZ A;  5FLX g;  4X3E A;  4H5J A;  4GM8 A;  1GOT B;  2HXC A;  4L9O A;  2PM9 B;  3UVK A;  2CN3 A;  5GSA A;  4LG8 A;  3V7D B;  5HE2 B;  2UZY B;  3L4O D;  2XU7 A;  4R7A B;  4A0B A;  4ES0 A;  3JB9 L;  4IA9 A;  4CI3 A;  4ERZ A;  2H13 A;  4J87 A;  4A0A A;  2IAA A;  5EM2 B;  4U7A A;  3JZG A;  4CZY A;  2I0S A;  2P9N C;  1TYQ C;  3OKY B;  2AGW A;  2HKM A;  4PXW A;  2CO0 A;  3I7P A;  1S4U X;  2Z2P A;  4J81 A;  4J79 A;  4JSV C;  5C2W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...