2GC4A

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
total genus 93
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gc4A00
2PM7B 3P4FA 3UVOA 4Z8LA 2CE9A 3EI4B 3BWSA 4OWRA 1SQJA 2PM6B 3CFSB 3RN0D 4PSXB 4X61B 3KRWB 2HJBA 4O3TB 4J82A 4A11B 2H3XA 5B4WA 2AH1A 2HESX 5KDOB 4D6VA 2HKMA 2CO0C 2H68A 4CI2A 1XHMA 5HQGA 3SBRA 2YNOA 4J8BA 4PBZA 4GQ1A 4J0WA 4ZOYA 3I8EA 5IC7A 3DXKC 4E54A 3CFVA 4CZYA 2OIZA 3UVMA 2OK4A 1GG2B 3F3FA 3GREA 3FGBA 4GGCA 4GMBA 3SLED 4GGDA 1JMZB 1OLZA 1XKSA 3PXWD 3SWSD 3UKRC 3F3GA 3EWEA 4A08A 5FKTA 5GXIA 5AJAA 4A2LA 2Z2NA 5I5MA 5GSAA 5EM2B 5CXBA 2IUQA 3MKSB 2YB8B 2AH0A 5HYNB 2I0RA 4OZUA 3MMYA 1TYQC 2I3TA 3J81g 2IWKA 3JPXA 3OL2B 4PXWA 1PEVA 2I0SA 2HJ4A 4J77A 3OKWA 3JRPA 4CZVA 4XYHA 5IGOA 2IWFA 3SHFA 5CXCB 4BUJC 3SN6B 4E5ZA 4N14A 4J78A 4L3GD 5EALA 2G99A 3IKOA 4PSWB 5FKRA 4I79A 3C99A 2Z2OA 3MZLA 5EMLB 4ESGA 4X63B 3OKYB 3JROA 5FA5B 3RMZD 2XYIA 3VA6A 2UZYB 3ZWLB 1SQ9A 1SHYB 4MK0B 4XEIC 3I7OA 2GC4A 4ZOXA 3I7PA 1PGUA 5IJ7E 2AGXA 2OVPB 4QQEA 3UVNA 5HE2B 5IT9g 3V7DB 4CI3A 3C75H 4JSNC 5H1MA 4ERYA 3ULEC 3K26A 3EI4A 1JMXB 3C9CA 5I5IA 2Z2PA 4J8GA 3SMRA 1JJUB 4ES0A 4FA5D 4ERZA 5IGQA 4FA9D 2OVRB 2AGZA 5HE0B 5SXMA 5K19A 3RFGA 2BCJB 3RFHA 1B9YA 5FXYA 4FB1D 3ORVD 4CY3A 4A0BB 3SBQA 3I2NA 3HFQA 4L3HD 4GM3A 3V5WB 3DM0A 2GNQA 3IJ1A 3PE7A 5CYKA 4FAND 2H14A 3UR4A 3I7LA 2O9KA 3F3PA 3JB9L 1JOFA 3I7KA 4H5JA 4J86A 2QC5A 1YFQA 1FWXA 3MXXA 5EAPA 3SFZA 3A0FA 4HDJA 2HKRA 3OTTA 3JAMg 1R5MA 4Y5RD 1GOTB 4LG9A 4O1QD 1U4CA 3SJLD 2P9IC 3NVNA 2CN3A 1P22A 4GM9A 1N6FA 2AQ5A 3BG0A 2IURA 2YNNA 3EI2B 4J79A 4JXMA 3JZHA 1B9XA 3NVQA 4LGNA 5CXCA 3AL8A 2OVQB 3IIWA 3V9FA 4JSVC 4L1QD 3UKUC 5TEEA 5FLXg 2XL3A 2IAAA 4Y7RA 1MDAH 2H6NA 4U7AA 4X3EA 2AGYA 2P9LC 3OKYA 4CY5A 3ODTA 4ZOVA 1PI6A 3EG6A 4YVDA 4GQBB 4JSXC 2AGWA 3K27A 5IJ8E 3UVLA 2H9LA 2PBIB 3VH0A 3EI3B 3JZNA 2Q7QA 2TRCB 5EMMB 2J57G 4GM8A 3SBPA 4FA1D 4AOWA 2YMUA 5TF2A 3JZGA 1Q47A 2H13A 2I0TA 3RSEC 4JT6C 2IUPA 2PM9B 5FKSA 3N0EA 3MKQA 3W15A 5A2Qg 4CY1A 3AH8B 4CY2A 4CC9A 2UZXB 4QT8A 4J81A 3CIKB 1TBGA 4J87A 3PSLA 2B5MA 2OK6A 3FM0A 4XYIA 1RI6A 3B7FA 2B5NA 3BG1A 4CI8A 3IJ0A 3GFCA 4A0BA 1GP2B 2EBSA 4A11A 2CN2A 3SCYA 2QXVA 3DWLC 5HE3B 3RN1D 4A09B 4ERQA 3DSMA 3PSCB 1NEXB 4LG8A 1K32A 3IIYA 2AGLA 5FQDA 5K1CC 4O45A 1A0RB 3RRMC 3PXSD 4A0AB 4GZ8A 1N6EA 3N0DA 2H9MA 4A7JA 5C2WB 4JD2C 4FAVD 1XIPA 3PVUB 4TZ4A 3EMHA 1PBYB 1S4UX 3I7HA 2YNPA 4J73A 5THAA 4D0KA 3NVXA 2P9NC 3EI1B 4H5IA 4O9DA 5HE1B 5EMJB 3SXTD 4IMMA 3IJCA 5JWZA 4ZOZA 3EI2A 3I7NA 5EM2A 4U1EI 5C2VB 3EU7A 4BL0A 2H6QA 3MZKA 1U2VC 5EAMA 3E0CA 5GXHA 2CO0A 4KFMB 2BBKH 3OL2A 4QRJA 3J80g 2P9PC 4PC0A 2IUVA 3RLMD 5CYKB 2HXCA 2H9PA 2B5LA 3KRXB 4GGAA 4JSPC 5EARA 4L9OA 2OJYA 5AFU3 2CNXA 3C5MA 1N6DA 3OW8A 3EI3A 3I89A 5H17A 4AEZA 2P9KC 3PVWB 2G9AA 4E54B 2H9NA 4O3UB 2J56H 4IA9A 5FKQA 1MG3A 4J0XA 4GQ2P 2XU7A 4FA4D 2XL2A 2PM9A 3L4MD 1L0QA 3UVKA 4CI1A 4A08B 1MG2A 1NR0A 2J55H 5TEFA 3AFCA 5CXBB 4FWWA 2I3SA 4PBYA 5EMKB 4A2MA 3AL8B 5GMKn 4BH6A 2CE8A 3I8CA 5I5JA 2P9UC 2MTAH 1OMWB 4JT5C 4K3JB 3PXTD 4K3ID 3SVWD 2B4EA 2YBAA 4PNKB 1QNIA 2GC7A 4A09A 4E5ZB 3AL9A 4CZXA 4J84A 3OKTA 3FRXA 3L4OD 4NSXA 4A0AA 1K8KC 4QL1A 4G56B 2H6KA 2W18A 1GXRA 4UI9R 5TDHB 3VGZA 4X60B 2P9SC 4ZN4A 2H47A 4FHLA 4R7AB 5AMSA 4EWRA 3EI1A 2HYEA 1VYHC 1ERJA 5H14A 5C9ZB 3U4YA 3DXMC
chains in the Genus database with same CATH superfamily
2PM7B 3P4FA 3UVOA 4Z8LA 2CE9A 3EI4B 3BWSA 4OWRA 1SQJA 1E5TA 2VDMA 3V4VA 2PM6B 3CFSB 3RN0D 4PSXB 4X61B 1VE7A 2HJBA 3KRWB 4O3TB 4J82A 4A11B 2H3XA 5B4WA 2AH1A 5HDBA 2HESX 5KDOB 4D6VA 4MMYA 2HKMA 2CO0C 2H68A 4CI2A 1XHMA 5HQGA 3SBRA 2YNOA 4J8BA 4PBZA 4AMYA 4GQ1A 3V4PA 4J0WA 4WK2A 4ZOYA 3I8EA 5IC7A 4D9SA 3DXKC 2EIBA 4E54A 3CFVA 4CZYA 2OIZA 3NIDA 3T3MA 3UVMA 3IJEA 2OK4A 5E6UA 1GG2B 3F3FA 3GREA 3FGBA 4GGCA 4GMBA 3SLED 1I2MB 1JMZB 4GGDA 1OLZA 1JTDB 1XKSA 3PXWD 3SWSD 3UKRC 3F3GA 3EWEA 4A08A 5FKTA 5GXIA 5AJAA 4A2LA 2Z2NA 5I5MA 5GSAA 5EM2B 5CXBA 2IUQA 3MKSB 2YB8B 3ZE1A 2AH0A 5M5RA 1YR2A 5HYNB 3ZE2A 2I0RA 4OZUA 1BPOA 3MMYA 1VZ3A 1TYQC 2I3TA 3J81g 2IWKA 3JPXA 3OL2B 4PXWA 1PEVA 2I0SA 3IUJA 2HJ4A 4J77A 3OKWA 3JRPA 4RE5A 4BCCA 4CZVA 4XYHA 1T2XA 5IGOA 2IWFA 3SHFA 5CXCB 4BUJC 3SN6B 4E5ZA 2XDWA 3IUMA 4N14A 4J78A 4L3GD 5EALA 2G99A 3IKOA 4PSWB 1L5GA 5FKRA 4I79A 3C99A 3OF7A 2Z2OA 1UOPA 3MZLA 1U8CA 4MMXA 5EMLB 4ESGA 1C9LA 4X63B 1TYEA 4L1MA 4AN0A 3OKYB 3JROA 5FA5B 2EIEA 3RMZD 2XYIA 3VA6A 3ZE0A 2UZYB 4O02A 3ZWLB 1SQ9A 1SHYB 4MK0B 4XEIC 3I7OA 2GC4A 4ZOXA 3I7PA 1H2XA 1PGUA 5IJ7E 2AGXA 2OVPB 4QQEA 3UVNA 5HE2B 5IT9g 3V7DB 4CI3A 3C75H 4JSNC 5H1MA 4ERYA 1VE6A 3IULA 3ULEC 3K72A 3K26A 3EI4A 5M5SA 4IRZA 1JMXB 3C9CA 5I5IA 2Z2PA 5E6SA 4J8GA 3SMRA 1GOGA 1JJUB 4ES0A 4FA5D 4ERZA 5IGQA 5M61A 4FA9D 2OVRB 4G1MA 2AGZA 5HE0B 5SXMA 5K19A 3RFGA 2BCJB 3RFHA 1B9YA 4BCBA 1A12A 5FXYA 4FB1D 3ORVD 4CY3A 3ZDZA 3SBQA 1QFSA 3I2NA 4A0BB 3HFQA 4L3HD 4GM3A 3V5WB 3T3PA 3DM0A 2GNQA 3IJ1A 3PE7A 5CYKA 4FAND 2H14A 3UR4A 3I7LA 2O9KA 2VDNA 3F3PA 3JB9L 1JOFA 3I7KA 2VDLA 4H5JA 4J86A 4QAMA 2QC5A 1YFQA 1FWXA 3MXXA 5EAPA 3SFZA 1H2ZA 3A0FA 4HDJA 2HKRA 3OTTA 3JAMg 2QR5A 1R5MA 4Y5RD 1GOTB 4LG9A 2HU7A 3NIGA 3NIFA 4O1QD 4DNVA 1U4CA 3SJLD 1UOOA 2P9IC 3NVNA 2CN3A 1P22A 4GM9A 1N6FA 2AQ5A 3BG0A 2IURA 2YNNA 3EI2B 5FFOA 4J79A 4JXMA 1JV2A 4G55A 3JZHA 1B9XA 3NVQA 4LGNA 5CXCA 3AL8A 2OVQB 3IIWA 2HU5A 3V9FA 3GD1I 3FCSA 4JSVC 4MMZA 4L1QD 3MUNA 3UKUC 5TEEA 5FLXg 2XL3A 3QI0A 2IAAA 4Y7RA 1MDAH 2H6NA 4U7AA 4X3EA 2AGYA 2VDRA 2P9LC 3OKYA 4CY5A 2VDQA 3ODTA 4ZOVA 1PI6A 3EG6A 4YVDA 4GQBB 4JSXC 2AGWA 3K27A 5IJ8E 3UVLA 2H9LA 2PBIB 3VH0A 3KCIA 3EI3B 2BKLA 3JZNA 2Q7QA 2TRCB 3O4HA 4DNUA 2XE4A 5EMMB 2J57G 4GM8A 3O4GA 3SBPA 4FA1D 4AOWA 2YMUA 5TF2A 2VDOA 3JZGA 1Q47A 2H13A 2I0TA 3RSEC 4JT6C 2IUPA 2PM9B 5FKSA 3N0EA 3MKQA 4BP8A 4DNWA 3W15A 5A2Qg 4CY1A 3AH8B 4CY2A 4CC9A 2UZXB 4QT8A 4J81A 3CIKB 1TBGA 4J87A 3PSLA 2B5MA 2OK6A 3FM0A 4NENA 4XYIA 1RI6A 3B7FA 2B5NA 3BG1A 4CI8A 4NC4A 3IJ0A 5E6RA 3GFCA 4A0BA 1GP2B 2EBSA 4AX4A 4A11A 2CN2A 3SCYA 3K71A 2QXVA 3DWLC 5HE3B 3RN1D 3QHYB 4ERQA 3DSMA 3PSCB 1NEXB 4A09B 4LG8A 2WQ8A 2XZGA 1K32A 1H2YA 3IIYA 2AGLA 2VDKA 5FQDA 5K1CC 4O45A 1A0RB 3RRMC 5M5TA 3PXSD 4A0AB 4GZ8A 1N6EA 3N0DA 2H9MA 4UM8A 4A7JA 1O6GA 5C2WB 4JD2C 4FAVD 1XIPA 3EQ8A 3PVUB 4TZ4A 3EMHA 2VC2A 1O6FA 1PBYB 1S4UX 4RE6A 3I7HA 1QFMA 3K6SA 3MUOA 2YNPA 4J73A 5THAA 4JHPC 4D0KA 3NVXA 2P9NC 1K3IA 3EI1B 4H5IA 2QZPA 1UTCA 4O9DA 5HE1B 5EMJB 3SXTD 4IMMA 3IJCA 5JWZA 1M1XA 4ZOZA 3EI2A 3I7NA 5EM2A 4U1EI 5C2VB 3EU7A 4BL0A 2H6QA 3MZKA 1U2VC 5EAMA 3E0CA 5GXHA 2CO0A 4KFMB 2BBKH 3OL2A 3VI4A 5FFGA 4QRJA 3J80g 2P9PC 4PC0A 4BP9A 2IUVA 3RLMD 1UOQA 5CYKB 2HXCA 2H9PA 2B5LA 3KRXB 4GGAA 2VZ1A 4WK0A 4JSPC 5EARA 1E8NA 4L9OA 2OJYA 5AFU3 2CNXA 5M5VA 3C5MA 1N6DA 3OW8A 3EI3A 3I89A 5H17A 4AEZA 2P9KC 3PVWB 2EICA 2G9AA 4E54B 1VZ2A 2H9NA 4O3UB 2J56H 4IA9A 5FKQA 1MG3A 4J0XA 4GQ2P 2XU7A 3O4IA 4WJKA 4FA4D 2XL2A 2PM9A 1GOHA 3ZDXA 3FCUA 2VZ3A 3L4MD 5M5UA 1L0QA 3IURA 3UVKA 2VDPA 4AMZA 4BCDA 4CI1A 4A08B 1MG2A 1NR0A 2J55H 5TEFA 3AFCA 5CXBB 4FWWA 4WK4A 2I3SA 4PBYA 5EMKB 4A2MA 3AL8B 4AN1A 5GMKn 4BH6A 2CE8A 4Z7QA 3MVDK 3I8CA 3EQ9A 5I5JA 2P9UC 2MTAH 1OMWB 4JT5C 2JKXA 4K3JB 4G1EA 3PXTD 4UM9A 4K3ID 3SVWD 2B4EA 2YBAA 3O4JA 4O2WA 4PNKB 4Z7OA 1QNIA 2GC7A 4A09A 4E5ZB 3AL9A 3IUQA 3IVMA 4CZXA 4J84A 4Z7NA 3DDUA 3OKTA 3FRXA 3L4OD 2EIDA 4NAAA 1E8MA 4NSXA 4A0AA 3GC3B 1K8KC 4QL1A 4G56B 2H6KA 3IUNA 4JHNA 2HU8A 2W18A 1GXRA 4UI9R 3ZDYA 5TDHB 1C9IA 3VGZA 4X60B 2P9SC 4ZN4A 2H47A 3VI3A 4FHLA 5C86A 4R7AB 4NBMA 5AMSA 4EWRA 1H2WA 3EI1A 2HYEA 1VYHC 1GOFA 1ERJA 5H14A 3EQ7A 5C9ZB 3U4YA 5C92A 3DXMC
chains in the Genus database with same CATH topology
2PM7B 3P4FA 3UVOA 4Z8LA 2CE9A 3EI4B 3BWSA 4OWRA 1SQJA 2PM6B 3CFSB 3RN0D 4PSXB 4X61B 3KRWB 2HJBA 4O3TB 4J82A 4A11B 2H3XA 5B4WA 2AH1A 2HESX 5KDOB 4D6VA 2HKMA 2CO0C 2H68A 4CI2A 1XHMA 5HQGA 3SBRA 2YNOA 4J8BA 4PBZA 4GQ1A 4J0WA 4ZOYA 3I8EA 5IC7A 3DXKC 4E54A 3CFVA 4CZYA 2OIZA 3UVMA 2OK4A 1GG2B 3F3FA 3GREA 3FGBA 4GGCA 4GMBA 3SLED 4GGDA 1JMZB 1OLZA 1XKSA 3PXWD 3SWSD 3UKRC 3F3GA 3EWEA 4A08A 5FKTA 5GXIA 5AJAA 4A2LA 2Z2NA 5I5MA 5GSAA 5EM2B 5CXBA 2IUQA 3MKSB 2YB8B 2AH0A 5HYNB 2I0RA 4OZUA 3MMYA 1TYQC 2I3TA 3J81g 2IWKA 3JPXA 3OL2B 4PXWA 1PEVA 2I0SA 2HJ4A 4J77A 3OKWA 3JRPA 4CZVA 4XYHA 5IGOA 2IWFA 3SHFA 5CXCB 4BUJC 3SN6B 4E5ZA 4N14A 4J78A 4L3GD 5EALA 2G99A 3IKOA 4PSWB 5FKRA 4I79A 3C99A 2Z2OA 3MZLA 5EMLB 4ESGA 4X63B 3OKYB 3JROA 5FA5B 3RMZD 2XYIA 3VA6A 2UZYB 3ZWLB 1SQ9A 1SHYB 4MK0B 4XEIC 3I7OA 2GC4A 4ZOXA 3I7PA 1PGUA 5IJ7E 2AGXA 2OVPB 4QQEA 3UVNA 5HE2B 5IT9g 3V7DB 4CI3A 3C75H 4JSNC 5H1MA 4ERYA 3ULEC 3K26A 3EI4A 1JMXB 3C9CA 5I5IA 2Z2PA 4J8GA 3SMRA 1JJUB 4ES0A 4FA5D 4ERZA 5IGQA 4FA9D 2OVRB 2AGZA 5HE0B 5SXMA 5K19A 3RFGA 2BCJB 3RFHA 1B9YA 5FXYA 4FB1D 3ORVD 4CY3A 4A0BB 3SBQA 3I2NA 3HFQA 4L3HD 4GM3A 3V5WB 3DM0A 2GNQA 3IJ1A 3PE7A 5CYKA 4FAND 2H14A 3UR4A 3I7LA 2O9KA 3F3PA 3JB9L 1JOFA 3I7KA 4H5JA 4J86A 2QC5A 1YFQA 1FWXA 3MXXA 5EAPA 3SFZA 3A0FA 4HDJA 2HKRA 3OTTA 3JAMg 1R5MA 4Y5RD 1GOTB 4LG9A 4O1QD 1U4CA 3SJLD 2P9IC 3NVNA 2CN3A 1P22A 4GM9A 1N6FA 2AQ5A 3BG0A 2IURA 2YNNA 3EI2B 4J79A 4JXMA 3JZHA 1B9XA 3NVQA 4LGNA 5CXCA 3AL8A 2OVQB 3IIWA 3V9FA 4JSVC 4L1QD 3UKUC 5TEEA 5FLXg 2XL3A 2IAAA 4Y7RA 1MDAH 2H6NA 4U7AA 4X3EA 2AGYA 2P9LC 3OKYA 4CY5A 3ODTA 4ZOVA 1PI6A 3EG6A 4YVDA 4GQBB 4JSXC 2AGWA 3K27A 5IJ8E 3UVLA 2H9LA 2PBIB 3VH0A 3EI3B 3JZNA 2Q7QA 2TRCB 5EMMB 2J57G 4GM8A 3SBPA 4FA1D 4AOWA 2YMUA 5TF2A 3JZGA 1Q47A 2H13A 2I0TA 3RSEC 4JT6C 2IUPA 2PM9B 5FKSA 3N0EA 3MKQA 3W15A 5A2Qg 4CY1A 3AH8B 4CY2A 4CC9A 2UZXB 4QT8A 4J81A 3CIKB 1TBGA 4J87A 3PSLA 2B5MA 2OK6A 3FM0A 4XYIA 1RI6A 3B7FA 2B5NA 3BG1A 4CI8A 3IJ0A 3GFCA 4A0BA 1GP2B 2EBSA 4A11A 2CN2A 3SCYA 2QXVA 3DWLC 5HE3B 3RN1D 4A09B 4ERQA 3DSMA 3PSCB 1NEXB 4LG8A 1K32A 3IIYA 2AGLA 5FQDA 5K1CC 4O45A 1A0RB 3RRMC 3PXSD 4A0AB 4GZ8A 1N6EA 3N0DA 2H9MA 4A7JA 5C2WB 4JD2C 4FAVD 1XIPA 3PVUB 4TZ4A 3EMHA 1PBYB 1S4UX 3I7HA 2YNPA 4J73A 5THAA 4D0KA 3NVXA 2P9NC 3EI1B 4H5IA 4O9DA 5HE1B 5EMJB 3SXTD 4IMMA 3IJCA 5JWZA 4ZOZA 3EI2A 3I7NA 5EM2A 4U1EI 5C2VB 3EU7A 4BL0A 2H6QA 3MZKA 1U2VC 5EAMA 3E0CA 5GXHA 2CO0A 4KFMB 2BBKH 3OL2A 4QRJA 3J80g 2P9PC 4PC0A 2IUVA 3RLMD 5CYKB 2HXCA 2H9PA 2B5LA 3KRXB 4GGAA 4JSPC 5EARA 4L9OA 2OJYA 5AFU3 2CNXA 3C5MA 1N6DA 3OW8A 3EI3A 3I89A 5H17A 4AEZA 2P9KC 3PVWB 2G9AA 4E54B 2H9NA 4O3UB 2J56H 4IA9A 5FKQA 1MG3A 4J0XA 4GQ2P 2XU7A 4FA4D 2XL2A 2PM9A 3L4MD 1L0QA 3UVKA 4CI1A 4A08B 1MG2A 1NR0A 2J55H 5TEFA 3AFCA 5CXBB 4FWWA 2I3SA 4PBYA 5EMKB 4A2MA 3AL8B 5GMKn 4BH6A 2CE8A 3I8CA 5I5JA 2P9UC 2MTAH 1OMWB 4JT5C 4K3JB 3PXTD 4K3ID 3SVWD 2B4EA 2YBAA 4PNKB 1QNIA 2GC7A 4A09A 4E5ZB 3AL9A 4CZXA 4J84A 3OKTA 3FRXA 3L4OD 4NSXA 4A0AA 1K8KC 4QL1A 4G56B 2H6KA 2W18A 1GXRA 4UI9R 5TDHB 3VGZA 4X60B 2P9SC 4ZN4A 2H47A 4FHLA 4R7AB 5AMSA 4EWRA 3EI1A 2HYEA 1VYHC 1ERJA 5H14A 5C9ZB 3U4YA 3DXMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PM7 B;  3P4F A;  3UVO A;  4Z8L A;  2CE9 A;  3EI4 B;  3BWS A;  4OWR A;  1SQJ A;  2PM6 B;  3CFS B;  3RN0 D;  4PSX B;  4X61 B;  3KRW B;  2HJB A;  4O3T B;  4J82 A;  4A11 B;  2H3X A;  5B4W A;  2AH1 A;  2HES X;  5KDO B;  4D6V A;  2HKM A;  2CO0 C;  2H68 A;  4CI2 A;  1XHM A;  5HQG A;  3SBR A;  2YNO A;  4J8B A;  4PBZ A;  4GQ1 A;  4J0W A;  4ZOY A;  3I8E A;  5IC7 A;  3DXK C;  4E54 A;  3CFV A;  4CZY A;  2OIZ A;  3UVM A;  2OK4 A;  1GG2 B;  3F3F A;  3GRE A;  3FGB A;  4GGC A;  4GMB A;  3SLE D;  4GGD A;  1JMZ B;  1OLZ A;  1XKS A;  3PXW D;  3SWS D;  3UKR C;  3F3G A;  3EWE A;  4A08 A;  5FKT A;  5GXI A;  5AJA A;  4A2L A;  2Z2N A;  5I5M A;  5GSA A;  5EM2 B;  5CXB A;  2IUQ A;  3MKS B;  2YB8 B;  2AH0 A;  5HYN B;  2I0R A;  4OZU A;  3MMY A;  1TYQ C;  2I3T A;  3J81 g;  2IWK A;  3JPX A;  3OL2 B;  4PXW A;  1PEV A;  2I0S A;  2HJ4 A;  4J77 A;  3OKW A;  3JRP A;  4CZV A;  4XYH A;  5IGO A;  2IWF A;  3SHF A;  5CXC B;  4BUJ C;  3SN6 B;  4E5Z A;  4N14 A;  4J78 A;  4L3G D;  5EAL A;  2G99 A;  3IKO A;  4PSW B;  5FKR A;  4I79 A;  3C99 A;  2Z2O A;  3MZL A;  5EML B;  4ESG A;  4X63 B;  3OKY B;  3JRO A;  5FA5 B;  3RMZ D;  2XYI A;  3VA6 A;  2UZY B;  3ZWL B;  1SQ9 A;  1SHY B;  4MK0 B;  4XEI C;  3I7O A;  2GC4 A;  4ZOX A;  3I7P A;  1PGU A;  5IJ7 E;  2AGX A;  2OVP B;  4QQE A;  3UVN A;  5HE2 B;  5IT9 g;  3V7D B;  4CI3 A;  3C75 H;  4JSN C;  5H1M A;  4ERY A;  3ULE C;  3K26 A;  3EI4 A;  1JMX B;  3C9C A;  5I5I A;  2Z2P A;  4J8G A;  3SMR A;  1JJU B;  4ES0 A;  4FA5 D;  4ERZ A;  5IGQ A;  4FA9 D;  2OVR B;  2AGZ A;  5HE0 B;  5SXM A;  5K19 A;  3RFG A;  2BCJ B;  3RFH A;  1B9Y A;  5FXY A;  4FB1 D;  3ORV D;  4CY3 A;  4A0B B;  3SBQ A;  3I2N A;  3HFQ A;  4L3H D;  4GM3 A;  3V5W B;  3DM0 A;  2GNQ A;  3IJ1 A;  3PE7 A;  5CYK A;  4FAN D;  2H14 A;  3UR4 A;  3I7L A;  2O9K A;  3F3P A;  3JB9 L;  1JOF A;  3I7K A;  4H5J A;  4J86 A;  2QC5 A;  1YFQ A;  1FWX A;  3MXX A;  5EAP A;  3SFZ A;  3A0F A;  4HDJ A;  2HKR A;  3OTT A;  3JAM g;  1R5M A;  4Y5R D;  1GOT B;  4LG9 A;  4O1Q D;  1U4C A;  3SJL D;  2P9I C;  3NVN A;  2CN3 A;  1P22 A;  4GM9 A;  1N6F A;  2AQ5 A;  3BG0 A;  2IUR A;  2YNN A;  3EI2 B;  4J79 A;  4JXM A;  3JZH A;  1B9X A;  3NVQ A;  4LGN A;  5CXC A;  3AL8 A;  2OVQ B;  3IIW A;  3V9F A;  4JSV C;  4L1Q D;  3UKU C;  5TEE A;  5FLX g;  2XL3 A;  2IAA A;  4Y7R A;  1MDA H;  2H6N A;  4U7A A;  4X3E A;  2AGY A;  2P9L C;  3OKY A;  4CY5 A;  3ODT A;  4ZOV A;  1PI6 A;  3EG6 A;  4YVD A;  4GQB B;  4JSX C;  2AGW A;  3K27 A;  5IJ8 E;  3UVL A;  2H9L A;  2PBI B;  3VH0 A;  3EI3 B;  3JZN A;  2Q7Q A;  2TRC B;  5EMM B;  2J57 G;  4GM8 A;  3SBP A;  4FA1 D;  4AOW A;  2YMU A;  5TF2 A;  3JZG A;  1Q47 A;  2H13 A;  2I0T A;  3RSE C;  4JT6 C;  2IUP A;  2PM9 B;  5FKS A;  3N0E A;  3MKQ A;  3W15 A;  5A2Q g;  4CY1 A;  3AH8 B;  4CY2 A;  4CC9 A;  2UZX B;  4QT8 A;  4J81 A;  3CIK B;  1TBG A;  4J87 A;  3PSL A;  2B5M A;  2OK6 A;  3FM0 A;  4XYI A;  1RI6 A;  3B7F A;  2B5N A;  3BG1 A;  4CI8 A;  3IJ0 A;  3GFC A;  4A0B A;  1GP2 B;  2EBS A;  4A11 A;  2CN2 A;  3SCY A;  2QXV A;  3DWL C;  5HE3 B;  3RN1 D;  4A09 B;  4ERQ A;  3DSM A;  3PSC B;  1NEX B;  4LG8 A;  1K32 A;  3IIY A;  2AGL A;  5FQD A;  5K1C C;  4O45 A;  1A0R B;  3RRM C;  3PXS D;  4A0A B;  4GZ8 A;  1N6E A;  3N0D A;  2H9M A;  4A7J A;  5C2W B;  4JD2 C;  4FAV D;  1XIP A;  3PVU B;  4TZ4 A;  3EMH A;  1PBY B;  1S4U X;  3I7H A;  2YNP A;  4J73 A;  5THA A;  4D0K A;  3NVX A;  2P9N C;  3EI1 B;  4H5I A;  4O9D A;  5HE1 B;  5EMJ B;  3SXT D;  4IMM A;  3IJC A;  5JWZ A;  4ZOZ A;  3EI2 A;  3I7N A;  5EM2 A;  4U1E I;  5C2V B;  3EU7 A;  4BL0 A;  2H6Q A;  3MZK A;  1U2V C;  5EAM A;  3E0C A;  5GXH A;  2CO0 A;  4KFM B;  2BBK H;  3OL2 A;  4QRJ A;  3J80 g;  2P9P C;  4PC0 A;  2IUV A;  3RLM D;  5CYK B;  2HXC A;  2H9P A;  2B5L A;  3KRX B;  4GGA A;  4JSP C;  5EAR A;  4L9O A;  2OJY A;  5AFU 3;  2CNX A;  3C5M A;  1N6D A;  3OW8 A;  3EI3 A;  3I89 A;  5H17 A;  4AEZ A;  2P9K C;  3PVW B;  2G9A A;  4E54 B;  2H9N A;  4O3U B;  2J56 H;  4IA9 A;  5FKQ A;  1MG3 A;  4J0X A;  4GQ2 P;  2XU7 A;  4FA4 D;  2XL2 A;  2PM9 A;  3L4M D;  1L0Q A;  3UVK A;  4CI1 A;  4A08 B;  1MG2 A;  1NR0 A;  2J55 H;  5TEF A;  3AFC A;  5CXB B;  4FWW A;  2I3S A;  4PBY A;  5EMK B;  4A2M A;  3AL8 B;  5GMK n;  4BH6 A;  2CE8 A;  3I8C A;  5I5J A;  2P9U C;  2MTA H;  1OMW B;  4JT5 C;  4K3J B;  3PXT D;  4K3I D;  3SVW D;  2B4E A;  2YBA A;  4PNK B;  1QNI A;  2GC7 A;  4A09 A;  4E5Z B;  3AL9 A;  4CZX A;  4J84 A;  3OKT A;  3FRX A;  3L4O D;  4NSX A;  4A0A A;  1K8K C;  4QL1 A;  4G56 B;  2H6K A;  2W18 A;  1GXR A;  4UI9 R;  5TDH B;  3VGZ A;  4X60 B;  2P9S C;  4ZN4 A;  2H47 A;  4FHL A;  4R7A B;  5AMS A;  4EWR A;  3EI1 A;  2HYE A;  1VYH C;  1ERJ A;  5H14 A;  5C9Z B;  3U4Y A;  3DXM C; 
#chains in the Genus database with same CATH topology
 2PM7 B;  3P4F A;  3UVO A;  4Z8L A;  2CE9 A;  3EI4 B;  3BWS A;  4OWR A;  1SQJ A;  1E5T A;  2VDM A;  3V4V A;  2PM6 B;  3CFS B;  3RN0 D;  4PSX B;  4X61 B;  1VE7 A;  2HJB A;  3KRW B;  4O3T B;  4J82 A;  4A11 B;  2H3X A;  5B4W A;  2AH1 A;  5HDB A;  2HES X;  5KDO B;  4D6V A;  4MMY A;  2HKM A;  2CO0 C;  2H68 A;  4CI2 A;  1XHM A;  5HQG A;  3SBR A;  2YNO A;  4J8B A;  4PBZ A;  4AMY A;  4GQ1 A;  3V4P A;  4J0W A;  4WK2 A;  4ZOY A;  3I8E A;  5IC7 A;  4D9S A;  3DXK C;  2EIB A;  4E54 A;  3CFV A;  4CZY A;  2OIZ A;  3NID A;  3T3M A;  3UVM A;  3IJE A;  2OK4 A;  5E6U A;  1GG2 B;  3F3F A;  3GRE A;  3FGB A;  4GGC A;  4GMB A;  3SLE D;  1I2M B;  1JMZ B;  4GGD A;  1OLZ A;  1JTD B;  1XKS A;  3PXW D;  3SWS D;  3UKR C;  3F3G A;  3EWE A;  4A08 A;  5FKT A;  5GXI A;  5AJA A;  4A2L A;  2Z2N A;  5I5M A;  5GSA A;  5EM2 B;  5CXB A;  2IUQ A;  3MKS B;  2YB8 B;  3ZE1 A;  2AH0 A;  5M5R A;  1YR2 A;  5HYN B;  3ZE2 A;  2I0R A;  4OZU A;  1BPO A;  3MMY A;  1VZ3 A;  1TYQ C;  2I3T A;  3J81 g;  2IWK A;  3JPX A;  3OL2 B;  4PXW A;  1PEV A;  2I0S A;  3IUJ A;  2HJ4 A;  4J77 A;  3OKW A;  3JRP A;  4RE5 A;  4BCC A;  4CZV A;  4XYH A;  1T2X A;  5IGO A;  2IWF A;  3SHF A;  5CXC B;  4BUJ C;  3SN6 B;  4E5Z A;  2XDW A;  3IUM A;  4N14 A;  4J78 A;  4L3G D;  5EAL A;  2G99 A;  3IKO A;  4PSW B;  1L5G A;  5FKR A;  4I79 A;  3C99 A;  3OF7 A;  2Z2O A;  1UOP A;  3MZL A;  1U8C A;  4MMX A;  5EML B;  4ESG A;  1C9L A;  4X63 B;  1TYE A;  4L1M A;  4AN0 A;  3OKY B;  3JRO A;  5FA5 B;  2EIE A;  3RMZ D;  2XYI A;  3VA6 A;  3ZE0 A;  2UZY B;  4O02 A;  3ZWL B;  1SQ9 A;  1SHY B;  4MK0 B;  4XEI C;  3I7O A;  2GC4 A;  4ZOX A;  3I7P A;  1H2X A;  1PGU A;  5IJ7 E;  2AGX A;  2OVP B;  4QQE A;  3UVN A;  5HE2 B;  5IT9 g;  3V7D B;  4CI3 A;  3C75 H;  4JSN C;  5H1M A;  4ERY A;  1VE6 A;  3IUL A;  3ULE C;  3K72 A;  3K26 A;  3EI4 A;  5M5S A;  4IRZ A;  1JMX B;  3C9C A;  5I5I A;  2Z2P A;  5E6S A;  4J8G A;  3SMR A;  1GOG A;  1JJU B;  4ES0 A;  4FA5 D;  4ERZ A;  5IGQ A;  5M61 A;  4FA9 D;  2OVR B;  4G1M A;  2AGZ A;  5HE0 B;  5SXM A;  5K19 A;  3RFG A;  2BCJ B;  3RFH A;  1B9Y A;  4BCB A;  1A12 A;  5FXY A;  4FB1 D;  3ORV D;  4CY3 A;  3ZDZ A;  3SBQ A;  1QFS A;  3I2N A;  4A0B B;  3HFQ A;  4L3H D;  4GM3 A;  3V5W B;  3T3P A;  3DM0 A;  2GNQ A;  3IJ1 A;  3PE7 A;  5CYK A;  4FAN D;  2H14 A;  3UR4 A;  3I7L A;  2O9K A;  2VDN A;  3F3P A;  3JB9 L;  1JOF A;  3I7K A;  2VDL A;  4H5J A;  4J86 A;  4QAM A;  2QC5 A;  1YFQ A;  1FWX A;  3MXX A;  5EAP A;  3SFZ A;  1H2Z A;  3A0F A;  4HDJ A;  2HKR A;  3OTT A;  3JAM g;  2QR5 A;  1R5M A;  4Y5R D;  1GOT B;  4LG9 A;  2HU7 A;  3NIG A;  3NIF A;  4O1Q D;  4DNV A;  1U4C A;  3SJL D;  1UOO A;  2P9I C;  3NVN A;  2CN3 A;  1P22 A;  4GM9 A;  1N6F A;  2AQ5 A;  3BG0 A;  2IUR A;  2YNN A;  3EI2 B;  5FFO A;  4J79 A;  4JXM A;  1JV2 A;  4G55 A;  3JZH A;  1B9X A;  3NVQ A;  4LGN A;  5CXC A;  3AL8 A;  2OVQ B;  3IIW A;  2HU5 A;  3V9F A;  3GD1 I;  3FCS A;  4JSV C;  4MMZ A;  4L1Q D;  3MUN A;  3UKU C;  5TEE A;  5FLX g;  2XL3 A;  3QI0 A;  2IAA A;  4Y7R A;  1MDA H;  2H6N A;  4U7A A;  4X3E A;  2AGY A;  2VDR A;  2P9L C;  3OKY A;  4CY5 A;  2VDQ A;  3ODT A;  4ZOV A;  1PI6 A;  3EG6 A;  4YVD A;  4GQB B;  4JSX C;  2AGW A;  3K27 A;  5IJ8 E;  3UVL A;  2H9L A;  2PBI B;  3VH0 A;  3KCI A;  3EI3 B;  2BKL A;  3JZN A;  2Q7Q A;  2TRC B;  3O4H A;  4DNU A;  2XE4 A;  5EMM B;  2J57 G;  4GM8 A;  3O4G A;  3SBP A;  4FA1 D;  4AOW A;  2YMU A;  5TF2 A;  2VDO A;  3JZG A;  1Q47 A;  2H13 A;  2I0T A;  3RSE C;  4JT6 C;  2IUP A;  2PM9 B;  5FKS A;  3N0E A;  3MKQ A;  4BP8 A;  4DNW A;  3W15 A;  5A2Q g;  4CY1 A;  3AH8 B;  4CY2 A;  4CC9 A;  2UZX B;  4QT8 A;  4J81 A;  3CIK B;  1TBG A;  4J87 A;  3PSL A;  2B5M A;  2OK6 A;  3FM0 A;  4NEN A;  4XYI A;  1RI6 A;  3B7F A;  2B5N A;  3BG1 A;  4CI8 A;  4NC4 A;  3IJ0 A;  5E6R A;  3GFC A;  4A0B A;  1GP2 B;  2EBS A;  4AX4 A;  4A11 A;  2CN2 A;  3SCY A;  3K71 A;  2QXV A;  3DWL C;  5HE3 B;  3RN1 D;  3QHY B;  4ERQ A;  3DSM A;  3PSC B;  1NEX B;  4A09 B;  4LG8 A;  2WQ8 A;  2XZG A;  1K32 A;  1H2Y A;  3IIY A;  2AGL A;  2VDK A;  5FQD A;  5K1C C;  4O45 A;  1A0R B;  3RRM C;  5M5T A;  3PXS D;  4A0A B;  4GZ8 A;  1N6E A;  3N0D A;  2H9M A;  4UM8 A;  4A7J A;  1O6G A;  5C2W B;  4JD2 C;  4FAV D;  1XIP A;  3EQ8 A;  3PVU B;  4TZ4 A;  3EMH A;  2VC2 A;  1O6F A;  1PBY B;  1S4U X;  4RE6 A;  3I7H A;  1QFM A;  3K6S A;  3MUO A;  2YNP A;  4J73 A;  5THA A;  4JHP C;  4D0K A;  3NVX A;  2P9N C;  1K3I A;  3EI1 B;  4H5I A;  2QZP A;  1UTC A;  4O9D A;  5HE1 B;  5EMJ B;  3SXT D;  4IMM A;  3IJC A;  5JWZ A;  1M1X A;  4ZOZ A;  3EI2 A;  3I7N A;  5EM2 A;  4U1E I;  5C2V B;  3EU7 A;  4BL0 A;  2H6Q A;  3MZK A;  1U2V C;  5EAM A;  3E0C A;  5GXH A;  2CO0 A;  4KFM B;  2BBK H;  3OL2 A;  3VI4 A;  5FFG A;  4QRJ A;  3J80 g;  2P9P C;  4PC0 A;  4BP9 A;  2IUV A;  3RLM D;  1UOQ A;  5CYK B;  2HXC A;  2H9P A;  2B5L A;  3KRX B;  4GGA A;  2VZ1 A;  4WK0 A;  4JSP C;  5EAR A;  1E8N A;  4L9O A;  2OJY A;  5AFU 3;  2CNX A;  5M5V A;  3C5M A;  1N6D A;  3OW8 A;  3EI3 A;  3I89 A;  5H17 A;  4AEZ A;  2P9K C;  3PVW B;  2EIC A;  2G9A A;  4E54 B;  1VZ2 A;  2H9N A;  4O3U B;  2J56 H;  4IA9 A;  5FKQ A;  1MG3 A;  4J0X A;  4GQ2 P;  2XU7 A;  3O4I A;  4WJK A;  4FA4 D;  2XL2 A;  2PM9 A;  1GOH A;  3ZDX A;  3FCU A;  2VZ3 A;  3L4M D;  5M5U A;  1L0Q A;  3IUR A;  3UVK A;  2VDP A;  4AMZ A;  4BCD A;  4CI1 A;  4A08 B;  1MG2 A;  1NR0 A;  2J55 H;  5TEF A;  3AFC A;  5CXB B;  4FWW A;  4WK4 A;  2I3S A;  4PBY A;  5EMK B;  4A2M A;  3AL8 B;  4AN1 A;  5GMK n;  4BH6 A;  2CE8 A;  4Z7Q A;  3MVD K;  3I8C A;  3EQ9 A;  5I5J A;  2P9U C;  2MTA H;  1OMW B;  4JT5 C;  2JKX A;  4K3J B;  4G1E A;  3PXT D;  4UM9 A;  4K3I D;  3SVW D;  2B4E A;  2YBA A;  3O4J A;  4O2W A;  4PNK B;  4Z7O A;  1QNI A;  2GC7 A;  4A09 A;  4E5Z B;  3AL9 A;  3IUQ A;  3IVM A;  4CZX A;  4J84 A;  4Z7N A;  3DDU A;  3OKT A;  3FRX A;  3L4O D;  2EID A;  4NAA A;  1E8M A;  4NSX A;  4A0A A;  3GC3 B;  1K8K C;  4QL1 A;  4G56 B;  2H6K A;  3IUN A;  4JHN A;  2HU8 A;  2W18 A;  1GXR A;  4UI9 R;  3ZDY A;  5TDH B;  1C9I A;  3VGZ A;  4X60 B;  2P9S C;  4ZN4 A;  2H47 A;  3VI3 A;  4FHL A;  5C86 A;  4R7A B;  4NBM A;  5AMS A;  4EWR A;  1H2W A;  3EI1 A;  2HYE A;  1VYH C;  1GOF A;  1ERJ A;  5H14 A;  3EQ7 A;  5C9Z B;  3U4Y A;  5C92 A;  3DXM C; 
#chains in the Genus database with same CATH homology
 2PM7 B;  3P4F A;  3UVO A;  4Z8L A;  2CE9 A;  3EI4 B;  3BWS A;  4OWR A;  1SQJ A;  2PM6 B;  3CFS B;  3RN0 D;  4PSX B;  4X61 B;  3KRW B;  2HJB A;  4O3T B;  4J82 A;  4A11 B;  2H3X A;  5B4W A;  2AH1 A;  2HES X;  5KDO B;  4D6V A;  2HKM A;  2CO0 C;  2H68 A;  4CI2 A;  1XHM A;  5HQG A;  3SBR A;  2YNO A;  4J8B A;  4PBZ A;  4GQ1 A;  4J0W A;  4ZOY A;  3I8E A;  5IC7 A;  3DXK C;  4E54 A;  3CFV A;  4CZY A;  2OIZ A;  3UVM A;  2OK4 A;  1GG2 B;  3F3F A;  3GRE A;  3FGB A;  4GGC A;  4GMB A;  3SLE D;  4GGD A;  1JMZ B;  1OLZ A;  1XKS A;  3PXW D;  3SWS D;  3UKR C;  3F3G A;  3EWE A;  4A08 A;  5FKT A;  5GXI A;  5AJA A;  4A2L A;  2Z2N A;  5I5M A;  5GSA A;  5EM2 B;  5CXB A;  2IUQ A;  3MKS B;  2YB8 B;  2AH0 A;  5HYN B;  2I0R A;  4OZU A;  3MMY A;  1TYQ C;  2I3T A;  3J81 g;  2IWK A;  3JPX A;  3OL2 B;  4PXW A;  1PEV A;  2I0S A;  2HJ4 A;  4J77 A;  3OKW A;  3JRP A;  4CZV A;  4XYH A;  5IGO A;  2IWF A;  3SHF A;  5CXC B;  4BUJ C;  3SN6 B;  4E5Z A;  4N14 A;  4J78 A;  4L3G D;  5EAL A;  2G99 A;  3IKO A;  4PSW B;  5FKR A;  4I79 A;  3C99 A;  2Z2O A;  3MZL A;  5EML B;  4ESG A;  4X63 B;  3OKY B;  3JRO A;  5FA5 B;  3RMZ D;  2XYI A;  3VA6 A;  2UZY B;  3ZWL B;  1SQ9 A;  1SHY B;  4MK0 B;  4XEI C;  3I7O A;  2GC4 A;  4ZOX A;  3I7P A;  1PGU A;  5IJ7 E;  2AGX A;  2OVP B;  4QQE A;  3UVN A;  5HE2 B;  5IT9 g;  3V7D B;  4CI3 A;  3C75 H;  4JSN C;  5H1M A;  4ERY A;  3ULE C;  3K26 A;  3EI4 A;  1JMX B;  3C9C A;  5I5I A;  2Z2P A;  4J8G A;  3SMR A;  1JJU B;  4ES0 A;  4FA5 D;  4ERZ A;  5IGQ A;  4FA9 D;  2OVR B;  2AGZ A;  5HE0 B;  5SXM A;  5K19 A;  3RFG A;  2BCJ B;  3RFH A;  1B9Y A;  5FXY A;  4FB1 D;  3ORV D;  4CY3 A;  4A0B B;  3SBQ A;  3I2N A;  3HFQ A;  4L3H D;  4GM3 A;  3V5W B;  3DM0 A;  2GNQ A;  3IJ1 A;  3PE7 A;  5CYK A;  4FAN D;  2H14 A;  3UR4 A;  3I7L A;  2O9K A;  3F3P A;  3JB9 L;  1JOF A;  3I7K A;  4H5J A;  4J86 A;  2QC5 A;  1YFQ A;  1FWX A;  3MXX A;  5EAP A;  3SFZ A;  3A0F A;  4HDJ A;  2HKR A;  3OTT A;  3JAM g;  1R5M A;  4Y5R D;  1GOT B;  4LG9 A;  4O1Q D;  1U4C A;  3SJL D;  2P9I C;  3NVN A;  2CN3 A;  1P22 A;  4GM9 A;  1N6F A;  2AQ5 A;  3BG0 A;  2IUR A;  2YNN A;  3EI2 B;  4J79 A;  4JXM A;  3JZH A;  1B9X A;  3NVQ A;  4LGN A;  5CXC A;  3AL8 A;  2OVQ B;  3IIW A;  3V9F A;  4JSV C;  4L1Q D;  3UKU C;  5TEE A;  5FLX g;  2XL3 A;  2IAA A;  4Y7R A;  1MDA H;  2H6N A;  4U7A A;  4X3E A;  2AGY A;  2P9L C;  3OKY A;  4CY5 A;  3ODT A;  4ZOV A;  1PI6 A;  3EG6 A;  4YVD A;  4GQB B;  4JSX C;  2AGW A;  3K27 A;  5IJ8 E;  3UVL A;  2H9L A;  2PBI B;  3VH0 A;  3EI3 B;  3JZN A;  2Q7Q A;  2TRC B;  5EMM B;  2J57 G;  4GM8 A;  3SBP A;  4FA1 D;  4AOW A;  2YMU A;  5TF2 A;  3JZG A;  1Q47 A;  2H13 A;  2I0T A;  3RSE C;  4JT6 C;  2IUP A;  2PM9 B;  5FKS A;  3N0E A;  3MKQ A;  3W15 A;  5A2Q g;  4CY1 A;  3AH8 B;  4CY2 A;  4CC9 A;  2UZX B;  4QT8 A;  4J81 A;  3CIK B;  1TBG A;  4J87 A;  3PSL A;  2B5M A;  2OK6 A;  3FM0 A;  4XYI A;  1RI6 A;  3B7F A;  2B5N A;  3BG1 A;  4CI8 A;  3IJ0 A;  3GFC A;  4A0B A;  1GP2 B;  2EBS A;  4A11 A;  2CN2 A;  3SCY A;  2QXV A;  3DWL C;  5HE3 B;  3RN1 D;  4A09 B;  4ERQ A;  3DSM A;  3PSC B;  1NEX B;  4LG8 A;  1K32 A;  3IIY A;  2AGL A;  5FQD A;  5K1C C;  4O45 A;  1A0R B;  3RRM C;  3PXS D;  4A0A B;  4GZ8 A;  1N6E A;  3N0D A;  2H9M A;  4A7J A;  5C2W B;  4JD2 C;  4FAV D;  1XIP A;  3PVU B;  4TZ4 A;  3EMH A;  1PBY B;  1S4U X;  3I7H A;  2YNP A;  4J73 A;  5THA A;  4D0K A;  3NVX A;  2P9N C;  3EI1 B;  4H5I A;  4O9D A;  5HE1 B;  5EMJ B;  3SXT D;  4IMM A;  3IJC A;  5JWZ A;  4ZOZ A;  3EI2 A;  3I7N A;  5EM2 A;  4U1E I;  5C2V B;  3EU7 A;  4BL0 A;  2H6Q A;  3MZK A;  1U2V C;  5EAM A;  3E0C A;  5GXH A;  2CO0 A;  4KFM B;  2BBK H;  3OL2 A;  4QRJ A;  3J80 g;  2P9P C;  4PC0 A;  2IUV A;  3RLM D;  5CYK B;  2HXC A;  2H9P A;  2B5L A;  3KRX B;  4GGA A;  4JSP C;  5EAR A;  4L9O A;  2OJY A;  5AFU 3;  2CNX A;  3C5M A;  1N6D A;  3OW8 A;  3EI3 A;  3I89 A;  5H17 A;  4AEZ A;  2P9K C;  3PVW B;  2G9A A;  4E54 B;  2H9N A;  4O3U B;  2J56 H;  4IA9 A;  5FKQ A;  1MG3 A;  4J0X A;  4GQ2 P;  2XU7 A;  4FA4 D;  2XL2 A;  2PM9 A;  3L4M D;  1L0Q A;  3UVK A;  4CI1 A;  4A08 B;  1MG2 A;  1NR0 A;  2J55 H;  5TEF A;  3AFC A;  5CXB B;  4FWW A;  2I3S A;  4PBY A;  5EMK B;  4A2M A;  3AL8 B;  5GMK n;  4BH6 A;  2CE8 A;  3I8C A;  5I5J A;  2P9U C;  2MTA H;  1OMW B;  4JT5 C;  4K3J B;  3PXT D;  4K3I D;  3SVW D;  2B4E A;  2YBA A;  4PNK B;  1QNI A;  2GC7 A;  4A09 A;  4E5Z B;  3AL9 A;  4CZX A;  4J84 A;  3OKT A;  3FRX A;  3L4O D;  4NSX A;  4A0A A;  1K8K C;  4QL1 A;  4G56 B;  2H6K A;  2W18 A;  1GXR A;  4UI9 R;  5TDH B;  3VGZ A;  4X60 B;  2P9S C;  4ZN4 A;  2H47 A;  4FHL A;  4R7A B;  5AMS A;  4EWR A;  3EI1 A;  2HYE A;  1VYH C;  1ERJ A;  5H14 A;  5C9Z B;  3U4Y A;  3DXM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...