2GC4A

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
total genus 93
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gc4A00
5FA5B 5IT9g 1N6EA 5EMJB 3OKTA 4K3ID 4JSVC 3PXTD 4J77A 2H13A 3NVXA 4A09B 5H1MA 4QQEA 4ZOVA 5EMMB 4JSXC 1S4UX 3BWSA 4CZYA 2H6QA 2IAAA 4BL0A 5HQGA 3OKWA 5I5IA 2HJ4A 4QT8A 4J73A 3UVNA 3F3GA 2B4EA 2OJYA 5IJ8E 3JAMg 4D6VA 2H9PA 2CE9A 4OZUA 1RI6A 5FKTA 3FGBA 3EI2A 3SMRA 1OLZA 3DM0A 2CN2A 3JZNA 1TYQC 2P9NC 2YBAA 4Z8LA 1NR0A 2B5NA 4Y5RD 5THAA 5IJ7E 2XL2A 3C99A 2Z2NA 2CO0C 3RN0D 3OTTA 1A0RB 2I0RA 5H17A 2H68A 4NSXA 2TRCB 4FAVD 3EU7A 3DXKC 4ZOZA 1TBGA 4ERQA 3C9CA 4ES0A 4A08B 4O45A 3OW8A 4CI1A 3E0CA 4FA4D 4LGNA 4PBYA 5KDOB 3OL2A 3KRWB 2YNPA 1P22A 2GNQA 3CFVA 3EG6A 3IJ0A 4ZOXA 5FLXg 5GMKn 1PGUA 2XL3A 4JSPC 3JZHA 4O1QD 4X3EA 5GXIA 2I0SA 4CY1A 3N0EA 2OK4A 2Z2PA 2GC4A 1XHMA 5HE2B 2HESX 1B9XA 5AMSA 5HYNB 4JD2C 1JMXB 3AL8B 3N0DA 4J8GA 3EI1B 3ODTA 4CY5A 3MKSB 3IKOA 5FKRA 1N6FA 1K32A 3EI2B 2QXVA 3ORVD 4E54B 2HXCA 1NEXB 3RMZD 4J86A 2HKMA 3SCYA 3SWSD 3EI4A 3EWEA 4K3JB 4FA9D 2B5LA 4Y7RA 4QL1A 4J0WA 5TDHB 2Q7QA 3I7PA 4LG9A 2QC5A 3EI3B 4PXWA 2YNNA 3V5WB 2H6NA 3I7NA 4AEZA 1FWXA 4XEIC 3V9FA 2IUPA 2P9KC 3FRXA 2AQ5A 1VYHC 3JPXA 3I7KA 3SBPA 1U4CA 4A0AA 3F3FA 5HE3B 3I8CA 3UVLA 2PBIB 3OL2B 3RFGA 5C2VB 1SHYB 2H6KA 5HE1B 1GG2B 5IC7A 4A11A 4PNKB 1U2VC 3L4MD 2B5MA 2J56H 2XU7A 1N6DA 3JRPA 3PE7A 3PSLA 5EM2A 2G99A 5H14A 1L0QA 4A0BA 2IUVA 4GM9A 3VA6A 4PSWB 5CYKB 3I7LA 4X61B 2CO0A 4L3GD 3UVMA 1GP2B 2J57G 4ZOYA 3I7OA 2CE8A 1XKSA 2OK6A 2UZYB 3EI1A 5GSAA 4L9OA 1PBYB 4TZ4A 3PVUB 5TF2A 4CC9A 2OIZA 4A09A 5EAPA 4J8BA 3U4YA 2H9MA 2IWKA 2Z2OA 1XIPA 3VGZA 3DSMA 3UVKA 3SLED 2YB8B 3A0FA 4GGAA 3L4OD 3MZLA 4E5ZB 4J81A 3UKRC 3IIYA 1JOFA 4AOWA 2W18A 4ERYA 3EI3A 4ESGA 1MG2A 4OWRA 5CXCA 3P4FA 4PSXB 2J55H 3NVQA 4GGCA 5TEEA 3SBQA 2O9KA 4H5IA 4N14A 1GXRA 3F3PA 5FQDA 5IGOA 2BBKH 4HDJA 4CZXA 3IJ1A 3SN6B 4CI2A 1K8KC 4JT5C 5EALA 2H14A 4JSNC 4IMMA 4BH6A 1MG3A 5C2WB 2P9UC 4A11B 4FWWA 3NVNA 5FXYA 4X60B 3HFQA 4J0XA 3KRXB 3AL9A 3JB9L 5CYKA 4J82A 2HYEA 4GMBA 2CN3A 2H9NA 2BCJB 5SXMA 4FHLA 2CNXA 2HKRA 1B9YA 3UVOA 3SVWD 5CXBA 4JXMA 3I8EA 4LG8A 4CZVA 3SHFA 3SFZA 4GZ8A 3RLMD 4A2MA 2AGZA 3UR4A 4J79A 4A7JA 4A2LA 3DXMC 3MZKA 4QRJA 5JWZA 2PM7B 4JT6C 2I3SA 3V7DB 2H47A 5FKSA 5EARA 3CIKB 5EMLB 4FAND 4KFMB 2GC7A 4PC0A 2H3XA 4ERZA 2P9PC 5CXCB 2AH1A 2PM9A 5AJAA 4E54A 4MK0B 5HE0B 2AGLA 3K27A 4U1EI 4CI8A 4G56B 3EI4B 3B7FA 1MDAH 1JMZB 3AH8B 5FKQA 2P9SC 4GGDA 3FM0A 4CY3A 4A08A 2OVRB 4XYHA 5K1CC 4I79A 3J80g 2H9LA 2AGYA 2IUQA 5TEFA 2PM6B 4L3HD 3SJLD 5EAMA 2I3TA 3UKUC 3OKYB 4ZN4A 3K26A 3MMYA 1GOTB 4O3TB 2IURA 4GM8A 4IA9A 1QNIA 2OVQB 3ZWLB 4BUJC 4A0AB 3ULEC 2P9LC 2HJBA 4U7AA 5CXBB 4J84A 5GXHA 1OMWB 3RN1D 4GQ1A 4FA5D 2EBSA 5I5JA 3SXTD 3W15A 4UI9R 3AL8A 5EM2B 4YVDA 4CY2A 2P9IC 4XYIA 4A0BB 3EMHA 3JROA 3MXXA 5IGQA 2AH0A 4EWRA 2OVPB 4GQ2P 3RFHA 1PI6A 3BG1A 3GREA 1JJUB 3AFCA 2AGWA 2YMUA 4FA1D 1R5MA 3DWLC 2IWFA 2I0TA 2PM9B 3VH0A 1PEVA 4O9DA 3RRMC 2YNOA 5AFU3 2XYIA 3I2NA 5I5MA 4X63B 1Q47A 4E5ZA 1ERJA 3GFCA 4O3UB 5A2Qg 4D0KA 3PXSD 3PXWD 3JZGA 4H5JA 5K19A 4R7AB 3IIWA 2MTAH 2G9AA 4GQBB 2AGXA 4FB1D 3J81g 3BG0A 4PBZA 3SBRA 4J78A 3C75H 3OKYA 3MKQA 4GM3A 3CFSB 3PVWB 2UZXB 3IJCA 5B4WA 3I89A 3I7HA 1YFQA 4J87A 1SQJA 4L1QD 3RSEC 4CI3A 5EMKB 3PSCB 1SQ9A 3C5MA 5C9ZB
chains in the Genus database with same CATH superfamily
5FA5B 5IT9g 1N6EA 5EMJB 3MUNA 3OKTA 4K3ID 4MMXA 4JSVC 3PXTD 4J77A 2EIBA 3QHYB 2H13A 3NVXA 4A09B 5H1MA 4QQEA 4ZOVA 5EMMB 3ZDZA 2QR5A 4JSXC 1S4UX 1UOQA 3BWSA 4CZYA 2H6QA 2IAAA 4BL0A 4RE6A 5HQGA 3OKWA 5I5IA 3IUNA 2HJ4A 4QT8A 4J73A 3UVNA 3F3GA 2B4EA 2OJYA 5IJ8E 3JAMg 4QAMA 4D6VA 2H9PA 2CE9A 4OZUA 1RI6A 5FKTA 3FGBA 3EI2A 3SMRA 1OLZA 3DM0A 4AN0A 2CN2A 3JZNA 4O02A 1TYQC 2P9NC 1GOHA 2YBAA 4Z8LA 1NR0A 2B5NA 4Y5RD 5THAA 5IJ7E 4DNWA 2XL2A 1QFSA 3C99A 2Z2NA 2CO0C 3RN0D 3OTTA 2VDOA 4DNUA 1A0RB 2XZGA 2I0RA 5H17A 2H68A 3GC3B 4NSXA 2TRCB 4BP9A 4FAVD 3EU7A 3DXKC 4ZOZA 3O4IA 1TBGA 4ERQA 3C9CA 4ES0A 4A08B 4O45A 3OW8A 5E6SA 3FCUA 4CI1A 1C9LA 3E0CA 4FA4D 4LGNA 4PBYA 5KDOB 2VDQA 3OL2A 3KRWB 2YNPA 1BPOA 4AN1A 1P22A 2GNQA 2VDRA 3CFVA 3EG6A 3IJ0A 3NIFA 4ZOXA 3VI4A 5E6RA 5FLXg 5GMKn 4NC4A 3QI0A 1I2MB 1PGUA 2HU7A 2XL3A 4JSPC 3JZHA 4O1QD 4X3EA 5GXIA 4MMZA 4DNVA 2I0SA 4CY1A 3N0EA 2OK4A 2Z2PA 2GC4A 1XHMA 5HE2B 1E5TA 2HESX 1B9XA 5AMSA 5HYNB 1C9IA 3K71A 4JD2C 1JMXB 3AL8B 3N0DA 4J8GA 3EI1B 3ODTA 3ZE0A 4CY5A 3MKSB 3IKOA 5FKRA 1N6FA 1K32A 3EI2B 3V4VA 2QXVA 3ORVD 4E54B 2HXCA 1NEXB 4BCCA 1JTDB 3RMZD 4J86A 2HKMA 3SCYA 3SWSD 3EI4A 5M5SA 3EWEA 4K3JB 4FA9D 1UOOA 2B5LA 4Y7RA 4QL1A 4Z7NA 3OF7A 3O4HA 4J0WA 4NENA 5TDHB 2Q7QA 3I7PA 4LG9A 2QC5A 2HU8A 4D9SA 3EI3B 4PXWA 2YNNA 3V5WB 2H6NA 3I7NA 1M1XA 4AEZA 1FWXA 4XEIC 3V9FA 2IUPA 2P9KC 3FRXA 2AQ5A 1VYHC 3JPXA 3I7KA 3SBPA 5M5UA 1U4CA 4A0AA 3F3FA 5HE3B 3I8CA 3UVLA 2PBIB 3OL2B 3RFGA 5C2VB 1SHYB 2H6KA 2QZPA 2VDKA 5HE1B 1GG2B 5IC7A 4A11A 4PNKB 1U2VC 3L4MD 2B5MA 4BCBA 2J56H 1O6GA 2XU7A 1N6DA 3JRPA 3PE7A 3PSLA 5FFOA 5EM2A 2G99A 5H14A 1L0QA 3IVMA 4A0BA 4AX4A 2IUVA 3MUOA 5C92A 4GM9A 3VA6A 4PSWB 5CYKB 3I7LA 4X61B 2CO0A 4L3GD 3UVMA 1GP2B 2J57G 4ZOYA 1E8MA 3I7OA 2CE8A 4NAAA 2EIEA 1XKSA 2OK6A 2UZYB 3EI1A 5GSAA 4L9OA 1PBYB 4Z7OA 4AMYA 4TZ4A 3PVUB 5TF2A 4CC9A 2OIZA 1GOGA 4A09A 5EAPA 4J8BA 3U4YA 2H9MA 2IWKA 2Z2OA 1H2YA 1XIPA 3VGZA 3NIDA 3DSMA 3UVKA 3SLED 2YB8B 3A0FA 4GGAA 3DDUA 3L4OD 3MZLA 4J81A 4E5ZB 3ZDYA 3UKRC 3IIYA 2JKXA 1JOFA 4G1EA 4AOWA 2W18A 4ERYA 3EI3A 4ESGA 1MG2A 4NBMA 4OWRA 5CXCA 3P4FA 4PSXB 5M61A 2J55H 3NVQA 3EQ7A 4GGCA 5TEEA 3SBQA 2O9KA 3ZE2A 4H5IA 4N14A 1GXRA 3F3PA 5FQDA 3O4GA 5IGOA 2BBKH 4HDJA 4CZXA 3IJ1A 3SN6B 4CI2A 2HU5A 1K8KC 1L5GA 4JT5C 5EALA 4G55A 2H14A 4JSNC 4IMMA 4BH6A 1MG3A 3ZE1A 5C2WB 2P9UC 4A11B 2VZ3A 4FWWA 3NVNA 1UTCA 5M5RA 5FXYA 4X60B 3HFQA 4J0XA 3KRXB 3EQ8A 4WK4A 3AL9A 2VDPA 3IJEA 5CYKA 3JB9L 4J82A 4UM8A 3VI3A 2HYEA 4GMBA 1T2XA 2CN3A 2H9NA 2BCJB 5SXMA 3FCSA 4FHLA 2CNXA 2EIDA 4MMYA 2HKRA 1B9YA 2VC2A 3UVOA 3IUQA 3SVWD 1VE7A 3NIGA 5CXBA 4JXMA 3I8EA 4LG8A 4CZVA 3SHFA 3SFZA 4GZ8A 3RLMD 4A2MA 2AGZA 3UR4A 3IUJA 4J79A 4A7JA 4WK0A 4A2LA 3DXMC 3MZKA 4O2WA 4QRJA 5JWZA 2PM7B 4JT6C 2I3SA 3V7DB 2H47A 5FKSA 3GD1I 5EARA 3CIKB 5EMLB 2WQ8A 2VDLA 4FAND 4KFMB 2GC7A 4PC0A 2H3XA 2BKLA 3V4PA 4ERZA 3IUMA 2P9PC 5CXCB 1UOPA 2AH1A 4WJKA 2PM9A 5AJAA 4E54A 1VE6A 4MK0B 5HE0B 2AGLA 3K27A 4U1EI 3MVDK 4CI8A 4G56B 3EI4B 3B7FA 1MDAH 5E6UA 5HDBA 1JMZB 1H2WA 3AH8B 5FKQA 1H2XA 2P9SC 1A12A 4GGDA 3FM0A 3O4JA 4CY3A 4A08A 2OVRB 1K3IA 1TYEA 4XYHA 5K1CC 4I79A 3J80g 2H9LA 2AGYA 2IUQA 5TEFA 2PM6B 5C86A 4L3HD 3SJLD 5EAMA 4Z7QA 3IULA 2I3TA 3UKUC 3OKYB 4ZN4A 3K26A 3MMYA 3EQ9A 1GOTB 4O3TB 2IURA 3K72A 4GM8A 4IA9A 1QNIA 2OVQB 5M5TA 3ZWLB 4BUJC 4A0AB 3ULEC 2P9LC 2HJBA 4U7AA 5CXBB 4J84A 5GXHA 1JV2A 1OMWB 3RN1D 4GQ1A 4FA5D 2EBSA 5I5JA 3SXTD 3W15A 4UI9R 3AL8A 4IRZA 5EM2B 1VZ3A 4YVDA 4CY2A 2P9IC 2VDNA 4XYIA 4A0BB 3EMHA 3JROA 3MXXA 5IGQA 2AH0A 4EWRA 2OVPB 4GQ2P 3RFHA 1PI6A 5M5VA 3BG1A 3GREA 1JJUB 3AFCA 2AGWA 2YMUA 4RE5A 4FA1D 1R5MA 4JHPC 3DWLC 1E8NA 2XE4A 2IWFA 2I0TA 2XDWA 1VZ2A 2PM9B 1PEVA 3VH0A 2EICA 3KCIA 2VDMA 4O9DA 3RRMC 2YNOA 4L1MA 1YR2A 4G1MA 5AFU3 5C9ZB 2XYIA 3I2NA 5I5MA 4X63B 1Q47A 4E5ZA 3T3PA 1ERJA 3GFCA 4O3UB 5A2Qg 4D0KA 3PXSD 3PXWD 3JZGA 4H5JA 5K19A 4R7AB 3IIWA 2MTAH 4AMZA 2G9AA 3T3MA 4GQBB 2AGXA 4FB1D 3J81g 1H2ZA 3BG0A 2VZ1A 4BCDA 4PBZA 3SBRA 4J78A 1O6FA 3C75H 3OKYA 3MKQA 4GM3A 3CFSB 3PVWB 2UZXB 3IURA 3IJCA 5B4WA 3I89A 4UM9A 3I7HA 1YFQA 4J87A 1SQJA 4JHNA 1U8CA 3K6SA 4WK2A 4L1QD 3RSEC 4CI3A 3ZDXA 5FFGA 5EMKB 3PSCB 1SQ9A 3C5MA 4BP8A 1QFMA 1GOFA
chains in the Genus database with same CATH topology
5FA5B 5IT9g 1N6EA 5EMJB 3OKTA 4K3ID 4JSVC 3PXTD 4J77A 2H13A 3NVXA 4A09B 5H1MA 4QQEA 4ZOVA 5EMMB 4JSXC 1S4UX 3BWSA 4CZYA 2H6QA 2IAAA 4BL0A 5HQGA 3OKWA 5I5IA 2HJ4A 4QT8A 4J73A 3UVNA 3F3GA 2B4EA 2OJYA 5IJ8E 3JAMg 4D6VA 2H9PA 2CE9A 4OZUA 1RI6A 5FKTA 3FGBA 3EI2A 3SMRA 1OLZA 3DM0A 2CN2A 3JZNA 1TYQC 2P9NC 2YBAA 4Z8LA 1NR0A 2B5NA 4Y5RD 5THAA 5IJ7E 2XL2A 3C99A 2Z2NA 2CO0C 3RN0D 3OTTA 1A0RB 2I0RA 5H17A 2H68A 4NSXA 2TRCB 4FAVD 3EU7A 3DXKC 4ZOZA 1TBGA 4ERQA 3C9CA 4ES0A 4A08B 4O45A 3OW8A 4CI1A 3E0CA 4FA4D 4LGNA 4PBYA 5KDOB 3OL2A 3KRWB 2YNPA 1P22A 2GNQA 3CFVA 3EG6A 3IJ0A 4ZOXA 5FLXg 5GMKn 1PGUA 2XL3A 4JSPC 3JZHA 4O1QD 4X3EA 5GXIA 2I0SA 4CY1A 3N0EA 2OK4A 2Z2PA 2GC4A 1XHMA 5HE2B 2HESX 1B9XA 5AMSA 5HYNB 4JD2C 1JMXB 3AL8B 3N0DA 4J8GA 3EI1B 3ODTA 4CY5A 3MKSB 3IKOA 5FKRA 1N6FA 1K32A 3EI2B 2QXVA 3ORVD 4E54B 2HXCA 1NEXB 3RMZD 4J86A 2HKMA 3SCYA 3SWSD 3EI4A 3EWEA 4K3JB 4FA9D 2B5LA 4Y7RA 4QL1A 4J0WA 5TDHB 2Q7QA 3I7PA 4LG9A 2QC5A 3EI3B 4PXWA 2YNNA 3V5WB 2H6NA 3I7NA 4AEZA 1FWXA 4XEIC 3V9FA 2IUPA 2P9KC 3FRXA 2AQ5A 1VYHC 3JPXA 3I7KA 3SBPA 1U4CA 4A0AA 3F3FA 5HE3B 3I8CA 3UVLA 2PBIB 3OL2B 3RFGA 5C2VB 1SHYB 2H6KA 5HE1B 1GG2B 5IC7A 4A11A 4PNKB 1U2VC 3L4MD 2B5MA 2J56H 2XU7A 1N6DA 3JRPA 3PE7A 3PSLA 5EM2A 2G99A 5H14A 1L0QA 4A0BA 2IUVA 4GM9A 3VA6A 4PSWB 5CYKB 3I7LA 4X61B 2CO0A 4L3GD 3UVMA 1GP2B 2J57G 4ZOYA 3I7OA 2CE8A 1XKSA 2OK6A 2UZYB 3EI1A 5GSAA 4L9OA 1PBYB 4TZ4A 3PVUB 5TF2A 4CC9A 2OIZA 4A09A 5EAPA 4J8BA 3U4YA 2H9MA 2IWKA 2Z2OA 1XIPA 3VGZA 3DSMA 3UVKA 3SLED 2YB8B 3A0FA 4GGAA 3L4OD 3MZLA 4E5ZB 4J81A 3UKRC 3IIYA 1JOFA 4AOWA 2W18A 4ERYA 3EI3A 4ESGA 1MG2A 4OWRA 5CXCA 3P4FA 4PSXB 2J55H 3NVQA 4GGCA 5TEEA 3SBQA 2O9KA 4H5IA 4N14A 1GXRA 3F3PA 5FQDA 5IGOA 2BBKH 4HDJA 4CZXA 3IJ1A 3SN6B 4CI2A 1K8KC 4JT5C 5EALA 2H14A 4JSNC 4IMMA 4BH6A 1MG3A 5C2WB 2P9UC 4A11B 4FWWA 3NVNA 5FXYA 4X60B 3HFQA 4J0XA 3KRXB 3AL9A 3JB9L 5CYKA 4J82A 2HYEA 4GMBA 2CN3A 2H9NA 2BCJB 5SXMA 4FHLA 2CNXA 2HKRA 1B9YA 3UVOA 3SVWD 5CXBA 4JXMA 3I8EA 4LG8A 4CZVA 3SHFA 3SFZA 4GZ8A 3RLMD 4A2MA 2AGZA 3UR4A 4J79A 4A7JA 4A2LA 3DXMC 3MZKA 4QRJA 5JWZA 2PM7B 4JT6C 2I3SA 3V7DB 2H47A 5FKSA 5EARA 3CIKB 5EMLB 4FAND 4KFMB 2GC7A 4PC0A 2H3XA 4ERZA 2P9PC 5CXCB 2AH1A 2PM9A 5AJAA 4E54A 4MK0B 5HE0B 2AGLA 3K27A 4U1EI 4CI8A 4G56B 3EI4B 3B7FA 1MDAH 1JMZB 3AH8B 5FKQA 2P9SC 4GGDA 3FM0A 4CY3A 4A08A 2OVRB 4XYHA 5K1CC 4I79A 3J80g 2H9LA 2AGYA 2IUQA 5TEFA 2PM6B 4L3HD 3SJLD 5EAMA 2I3TA 3UKUC 3OKYB 4ZN4A 3K26A 3MMYA 1GOTB 4O3TB 2IURA 4GM8A 4IA9A 1QNIA 2OVQB 3ZWLB 4BUJC 4A0AB 3ULEC 2P9LC 2HJBA 4U7AA 5CXBB 4J84A 5GXHA 1OMWB 3RN1D 4GQ1A 4FA5D 2EBSA 5I5JA 3SXTD 3W15A 4UI9R 3AL8A 5EM2B 4YVDA 4CY2A 2P9IC 4XYIA 4A0BB 3EMHA 3JROA 3MXXA 5IGQA 2AH0A 4EWRA 2OVPB 4GQ2P 3RFHA 1PI6A 3BG1A 3GREA 1JJUB 3AFCA 2AGWA 2YMUA 4FA1D 1R5MA 3DWLC 2IWFA 2I0TA 2PM9B 3VH0A 1PEVA 4O9DA 3RRMC 2YNOA 5AFU3 2XYIA 3I2NA 5I5MA 4X63B 1Q47A 4E5ZA 1ERJA 3GFCA 4O3UB 5A2Qg 4D0KA 3PXSD 3PXWD 3JZGA 4H5JA 5K19A 4R7AB 3IIWA 2MTAH 2G9AA 4GQBB 2AGXA 4FB1D 3J81g 3BG0A 4PBZA 3SBRA 4J78A 3C75H 3OKYA 3MKQA 4GM3A 3CFSB 3PVWB 2UZXB 3IJCA 5B4WA 3I89A 3I7HA 1YFQA 4J87A 1SQJA 4L1QD 3RSEC 4CI3A 5EMKB 3PSCB 1SQ9A 3C5MA 5C9ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FA5 B;  5IT9 g;  1N6E A;  5EMJ B;  3OKT A;  4K3I D;  4JSV C;  3PXT D;  4J77 A;  2H13 A;  3NVX A;  4A09 B;  5H1M A;  4QQE A;  4ZOV A;  5EMM B;  4JSX C;  1S4U X;  3BWS A;  4CZY A;  2H6Q A;  2IAA A;  4BL0 A;  5HQG A;  3OKW A;  5I5I A;  2HJ4 A;  4QT8 A;  4J73 A;  3UVN A;  3F3G A;  2B4E A;  2OJY A;  5IJ8 E;  3JAM g;  4D6V A;  2H9P A;  2CE9 A;  4OZU A;  1RI6 A;  5FKT A;  3FGB A;  3EI2 A;  3SMR A;  1OLZ A;  3DM0 A;  2CN2 A;  3JZN A;  1TYQ C;  2P9N C;  2YBA A;  4Z8L A;  1NR0 A;  2B5N A;  4Y5R D;  5THA A;  5IJ7 E;  2XL2 A;  3C99 A;  2Z2N A;  2CO0 C;  3RN0 D;  3OTT A;  1A0R B;  2I0R A;  5H17 A;  2H68 A;  4NSX A;  2TRC B;  4FAV D;  3EU7 A;  3DXK C;  4ZOZ A;  1TBG A;  4ERQ A;  3C9C A;  4ES0 A;  4A08 B;  4O45 A;  3OW8 A;  4CI1 A;  3E0C A;  4FA4 D;  4LGN A;  4PBY A;  5KDO B;  3OL2 A;  3KRW B;  2YNP A;  1P22 A;  2GNQ A;  3CFV A;  3EG6 A;  3IJ0 A;  4ZOX A;  5FLX g;  5GMK n;  1PGU A;  2XL3 A;  4JSP C;  3JZH A;  4O1Q D;  4X3E A;  5GXI A;  2I0S A;  4CY1 A;  3N0E A;  2OK4 A;  2Z2P A;  2GC4 A;  1XHM A;  5HE2 B;  2HES X;  1B9X A;  5AMS A;  5HYN B;  4JD2 C;  1JMX B;  3AL8 B;  3N0D A;  4J8G A;  3EI1 B;  3ODT A;  4CY5 A;  3MKS B;  3IKO A;  5FKR A;  1N6F A;  1K32 A;  3EI2 B;  2QXV A;  3ORV D;  4E54 B;  2HXC A;  1NEX B;  3RMZ D;  4J86 A;  2HKM A;  3SCY A;  3SWS D;  3EI4 A;  3EWE A;  4K3J B;  4FA9 D;  2B5L A;  4Y7R A;  4QL1 A;  4J0W A;  5TDH B;  2Q7Q A;  3I7P A;  4LG9 A;  2QC5 A;  3EI3 B;  4PXW A;  2YNN A;  3V5W B;  2H6N A;  3I7N A;  4AEZ A;  1FWX A;  4XEI C;  3V9F A;  2IUP A;  2P9K C;  3FRX A;  2AQ5 A;  1VYH C;  3JPX A;  3I7K A;  3SBP A;  1U4C A;  4A0A A;  3F3F A;  5HE3 B;  3I8C A;  3UVL A;  2PBI B;  3OL2 B;  3RFG A;  5C2V B;  1SHY B;  2H6K A;  5HE1 B;  1GG2 B;  5IC7 A;  4A11 A;  4PNK B;  1U2V C;  3L4M D;  2B5M A;  2J56 H;  2XU7 A;  1N6D A;  3JRP A;  3PE7 A;  3PSL A;  5EM2 A;  2G99 A;  5H14 A;  1L0Q A;  4A0B A;  2IUV A;  4GM9 A;  3VA6 A;  4PSW B;  5CYK B;  3I7L A;  4X61 B;  2CO0 A;  4L3G D;  3UVM A;  1GP2 B;  2J57 G;  4ZOY A;  3I7O A;  2CE8 A;  1XKS A;  2OK6 A;  2UZY B;  3EI1 A;  5GSA A;  4L9O A;  1PBY B;  4TZ4 A;  3PVU B;  5TF2 A;  4CC9 A;  2OIZ A;  4A09 A;  5EAP A;  4J8B A;  3U4Y A;  2H9M A;  2IWK A;  2Z2O A;  1XIP A;  3VGZ A;  3DSM A;  3UVK A;  3SLE D;  2YB8 B;  3A0F A;  4GGA A;  3L4O D;  3MZL A;  4E5Z B;  4J81 A;  3UKR C;  3IIY A;  1JOF A;  4AOW A;  2W18 A;  4ERY A;  3EI3 A;  4ESG A;  1MG2 A;  4OWR A;  5CXC A;  3P4F A;  4PSX B;  2J55 H;  3NVQ A;  4GGC A;  5TEE A;  3SBQ A;  2O9K A;  4H5I A;  4N14 A;  1GXR A;  3F3P A;  5FQD A;  5IGO A;  2BBK H;  4HDJ A;  4CZX A;  3IJ1 A;  3SN6 B;  4CI2 A;  1K8K C;  4JT5 C;  5EAL A;  2H14 A;  4JSN C;  4IMM A;  4BH6 A;  1MG3 A;  5C2W B;  2P9U C;  4A11 B;  4FWW A;  3NVN A;  5FXY A;  4X60 B;  3HFQ A;  4J0X A;  3KRX B;  3AL9 A;  3JB9 L;  5CYK A;  4J82 A;  2HYE A;  4GMB A;  2CN3 A;  2H9N A;  2BCJ B;  5SXM A;  4FHL A;  2CNX A;  2HKR A;  1B9Y A;  3UVO A;  3SVW D;  5CXB A;  4JXM A;  3I8E A;  4LG8 A;  4CZV A;  3SHF A;  3SFZ A;  4GZ8 A;  3RLM D;  4A2M A;  2AGZ A;  3UR4 A;  4J79 A;  4A7J A;  4A2L A;  3DXM C;  3MZK A;  4QRJ A;  5JWZ A;  2PM7 B;  4JT6 C;  2I3S A;  3V7D B;  2H47 A;  5FKS A;  5EAR A;  3CIK B;  5EML B;  4FAN D;  4KFM B;  2GC7 A;  4PC0 A;  2H3X A;  4ERZ A;  2P9P C;  5CXC B;  2AH1 A;  2PM9 A;  5AJA A;  4E54 A;  4MK0 B;  5HE0 B;  2AGL A;  3K27 A;  4U1E I;  4CI8 A;  4G56 B;  3EI4 B;  3B7F A;  1MDA H;  1JMZ B;  3AH8 B;  5FKQ A;  2P9S C;  4GGD A;  3FM0 A;  4CY3 A;  4A08 A;  2OVR B;  4XYH A;  5K1C C;  4I79 A;  3J80 g;  2H9L A;  2AGY A;  2IUQ A;  5TEF A;  2PM6 B;  4L3H D;  3SJL D;  5EAM A;  2I3T A;  3UKU C;  3OKY B;  4ZN4 A;  3K26 A;  3MMY A;  1GOT B;  4O3T B;  2IUR A;  4GM8 A;  4IA9 A;  1QNI A;  2OVQ B;  3ZWL B;  4BUJ C;  4A0A B;  3ULE C;  2P9L C;  2HJB A;  4U7A A;  5CXB B;  4J84 A;  5GXH A;  1OMW B;  3RN1 D;  4GQ1 A;  4FA5 D;  2EBS A;  5I5J A;  3SXT D;  3W15 A;  4UI9 R;  3AL8 A;  5EM2 B;  4YVD A;  4CY2 A;  2P9I C;  4XYI A;  4A0B B;  3EMH A;  3JRO A;  3MXX A;  5IGQ A;  2AH0 A;  4EWR A;  2OVP B;  4GQ2 P;  3RFH A;  1PI6 A;  3BG1 A;  3GRE A;  1JJU B;  3AFC A;  2AGW A;  2YMU A;  4FA1 D;  1R5M A;  3DWL C;  2IWF A;  2I0T A;  2PM9 B;  3VH0 A;  1PEV A;  4O9D A;  3RRM C;  2YNO A;  5AFU 3;  2XYI A;  3I2N A;  5I5M A;  4X63 B;  1Q47 A;  4E5Z A;  1ERJ A;  3GFC A;  4O3U B;  5A2Q g;  4D0K A;  3PXS D;  3PXW D;  3JZG A;  4H5J A;  5K19 A;  4R7A B;  3IIW A;  2MTA H;  2G9A A;  4GQB B;  2AGX A;  4FB1 D;  3J81 g;  3BG0 A;  4PBZ A;  3SBR A;  4J78 A;  3C75 H;  3OKY A;  3MKQ A;  4GM3 A;  3CFS B;  3PVW B;  2UZX B;  3IJC A;  5B4W A;  3I89 A;  3I7H A;  1YFQ A;  4J87 A;  1SQJ A;  4L1Q D;  3RSE C;  4CI3 A;  5EMK B;  3PSC B;  1SQ9 A;  3C5M A;  5C9Z B; 
#chains in the Genus database with same CATH topology
 5FA5 B;  5IT9 g;  1N6E A;  5EMJ B;  3MUN A;  3OKT A;  4K3I D;  4MMX A;  4JSV C;  3PXT D;  4J77 A;  2EIB A;  3QHY B;  2H13 A;  3NVX A;  4A09 B;  5H1M A;  4QQE A;  4ZOV A;  5EMM B;  3ZDZ A;  2QR5 A;  4JSX C;  1S4U X;  1UOQ A;  3BWS A;  4CZY A;  2H6Q A;  2IAA A;  4BL0 A;  4RE6 A;  5HQG A;  3OKW A;  5I5I A;  3IUN A;  2HJ4 A;  4QT8 A;  4J73 A;  3UVN A;  3F3G A;  2B4E A;  2OJY A;  5IJ8 E;  3JAM g;  4QAM A;  4D6V A;  2H9P A;  2CE9 A;  4OZU A;  1RI6 A;  5FKT A;  3FGB A;  3EI2 A;  3SMR A;  1OLZ A;  3DM0 A;  4AN0 A;  2CN2 A;  3JZN A;  4O02 A;  1TYQ C;  2P9N C;  1GOH A;  2YBA A;  4Z8L A;  1NR0 A;  2B5N A;  4Y5R D;  5THA A;  5IJ7 E;  4DNW A;  2XL2 A;  1QFS A;  3C99 A;  2Z2N A;  2CO0 C;  3RN0 D;  3OTT A;  2VDO A;  4DNU A;  1A0R B;  2XZG A;  2I0R A;  5H17 A;  2H68 A;  3GC3 B;  4NSX A;  2TRC B;  4BP9 A;  4FAV D;  3EU7 A;  3DXK C;  4ZOZ A;  3O4I A;  1TBG A;  4ERQ A;  3C9C A;  4ES0 A;  4A08 B;  4O45 A;  3OW8 A;  5E6S A;  3FCU A;  4CI1 A;  1C9L A;  3E0C A;  4FA4 D;  4LGN A;  4PBY A;  5KDO B;  2VDQ A;  3OL2 A;  3KRW B;  2YNP A;  1BPO A;  4AN1 A;  1P22 A;  2GNQ A;  2VDR A;  3CFV A;  3EG6 A;  3IJ0 A;  3NIF A;  4ZOX A;  3VI4 A;  5E6R A;  5FLX g;  5GMK n;  4NC4 A;  3QI0 A;  1I2M B;  1PGU A;  2HU7 A;  2XL3 A;  4JSP C;  3JZH A;  4O1Q D;  4X3E A;  5GXI A;  4MMZ A;  4DNV A;  2I0S A;  4CY1 A;  3N0E A;  2OK4 A;  2Z2P A;  2GC4 A;  1XHM A;  5HE2 B;  1E5T A;  2HES X;  1B9X A;  5AMS A;  5HYN B;  1C9I A;  3K71 A;  4JD2 C;  1JMX B;  3AL8 B;  3N0D A;  4J8G A;  3EI1 B;  3ODT A;  3ZE0 A;  4CY5 A;  3MKS B;  3IKO A;  5FKR A;  1N6F A;  1K32 A;  3EI2 B;  3V4V A;  2QXV A;  3ORV D;  4E54 B;  2HXC A;  1NEX B;  4BCC A;  1JTD B;  3RMZ D;  4J86 A;  2HKM A;  3SCY A;  3SWS D;  3EI4 A;  5M5S A;  3EWE A;  4K3J B;  4FA9 D;  1UOO A;  2B5L A;  4Y7R A;  4QL1 A;  4Z7N A;  3OF7 A;  3O4H A;  4J0W A;  4NEN A;  5TDH B;  2Q7Q A;  3I7P A;  4LG9 A;  2QC5 A;  2HU8 A;  4D9S A;  3EI3 B;  4PXW A;  2YNN A;  3V5W B;  2H6N A;  3I7N A;  1M1X A;  4AEZ A;  1FWX A;  4XEI C;  3V9F A;  2IUP A;  2P9K C;  3FRX A;  2AQ5 A;  1VYH C;  3JPX A;  3I7K A;  3SBP A;  5M5U A;  1U4C A;  4A0A A;  3F3F A;  5HE3 B;  3I8C A;  3UVL A;  2PBI B;  3OL2 B;  3RFG A;  5C2V B;  1SHY B;  2H6K A;  2QZP A;  2VDK A;  5HE1 B;  1GG2 B;  5IC7 A;  4A11 A;  4PNK B;  1U2V C;  3L4M D;  2B5M A;  4BCB A;  2J56 H;  1O6G A;  2XU7 A;  1N6D A;  3JRP A;  3PE7 A;  3PSL A;  5FFO A;  5EM2 A;  2G99 A;  5H14 A;  1L0Q A;  3IVM A;  4A0B A;  4AX4 A;  2IUV A;  3MUO A;  5C92 A;  4GM9 A;  3VA6 A;  4PSW B;  5CYK B;  3I7L A;  4X61 B;  2CO0 A;  4L3G D;  3UVM A;  1GP2 B;  2J57 G;  4ZOY A;  1E8M A;  3I7O A;  2CE8 A;  4NAA A;  2EIE A;  1XKS A;  2OK6 A;  2UZY B;  3EI1 A;  5GSA A;  4L9O A;  1PBY B;  4Z7O A;  4AMY A;  4TZ4 A;  3PVU B;  5TF2 A;  4CC9 A;  2OIZ A;  1GOG A;  4A09 A;  5EAP A;  4J8B A;  3U4Y A;  2H9M A;  2IWK A;  2Z2O A;  1H2Y A;  1XIP A;  3VGZ A;  3NID A;  3DSM A;  3UVK A;  3SLE D;  2YB8 B;  3A0F A;  4GGA A;  3DDU A;  3L4O D;  3MZL A;  4J81 A;  4E5Z B;  3ZDY A;  3UKR C;  3IIY A;  2JKX A;  1JOF A;  4G1E A;  4AOW A;  2W18 A;  4ERY A;  3EI3 A;  4ESG A;  1MG2 A;  4NBM A;  4OWR A;  5CXC A;  3P4F A;  4PSX B;  5M61 A;  2J55 H;  3NVQ A;  3EQ7 A;  4GGC A;  5TEE A;  3SBQ A;  2O9K A;  3ZE2 A;  4H5I A;  4N14 A;  1GXR A;  3F3P A;  5FQD A;  3O4G A;  5IGO A;  2BBK H;  4HDJ A;  4CZX A;  3IJ1 A;  3SN6 B;  4CI2 A;  2HU5 A;  1K8K C;  1L5G A;  4JT5 C;  5EAL A;  4G55 A;  2H14 A;  4JSN C;  4IMM A;  4BH6 A;  1MG3 A;  3ZE1 A;  5C2W B;  2P9U C;  4A11 B;  2VZ3 A;  4FWW A;  3NVN A;  1UTC A;  5M5R A;  5FXY A;  4X60 B;  3HFQ A;  4J0X A;  3KRX B;  3EQ8 A;  4WK4 A;  3AL9 A;  2VDP A;  3IJE A;  5CYK A;  3JB9 L;  4J82 A;  4UM8 A;  3VI3 A;  2HYE A;  4GMB A;  1T2X A;  2CN3 A;  2H9N A;  2BCJ B;  5SXM A;  3FCS A;  4FHL A;  2CNX A;  2EID A;  4MMY A;  2HKR A;  1B9Y A;  2VC2 A;  3UVO A;  3IUQ A;  3SVW D;  1VE7 A;  3NIG A;  5CXB A;  4JXM A;  3I8E A;  4LG8 A;  4CZV A;  3SHF A;  3SFZ A;  4GZ8 A;  3RLM D;  4A2M A;  2AGZ A;  3UR4 A;  3IUJ A;  4J79 A;  4A7J A;  4WK0 A;  4A2L A;  3DXM C;  3MZK A;  4O2W A;  4QRJ A;  5JWZ A;  2PM7 B;  4JT6 C;  2I3S A;  3V7D B;  2H47 A;  5FKS A;  3GD1 I;  5EAR A;  3CIK B;  5EML B;  2WQ8 A;  2VDL A;  4FAN D;  4KFM B;  2GC7 A;  4PC0 A;  2H3X A;  2BKL A;  3V4P A;  4ERZ A;  3IUM A;  2P9P C;  5CXC B;  1UOP A;  2AH1 A;  4WJK A;  2PM9 A;  5AJA A;  4E54 A;  1VE6 A;  4MK0 B;  5HE0 B;  2AGL A;  3K27 A;  4U1E I;  3MVD K;  4CI8 A;  4G56 B;  3EI4 B;  3B7F A;  1MDA H;  5E6U A;  5HDB A;  1JMZ B;  1H2W A;  3AH8 B;  5FKQ A;  1H2X A;  2P9S C;  1A12 A;  4GGD A;  3FM0 A;  3O4J A;  4CY3 A;  4A08 A;  2OVR B;  1K3I A;  1TYE A;  4XYH A;  5K1C C;  4I79 A;  3J80 g;  2H9L A;  2AGY A;  2IUQ A;  5TEF A;  2PM6 B;  5C86 A;  4L3H D;  3SJL D;  5EAM A;  4Z7Q A;  3IUL A;  2I3T A;  3UKU C;  3OKY B;  4ZN4 A;  3K26 A;  3MMY A;  3EQ9 A;  1GOT B;  4O3T B;  2IUR A;  3K72 A;  4GM8 A;  4IA9 A;  1QNI A;  2OVQ B;  5M5T A;  3ZWL B;  4BUJ C;  4A0A B;  3ULE C;  2P9L C;  2HJB A;  4U7A A;  5CXB B;  4J84 A;  5GXH A;  1JV2 A;  1OMW B;  3RN1 D;  4GQ1 A;  4FA5 D;  2EBS A;  5I5J A;  3SXT D;  3W15 A;  4UI9 R;  3AL8 A;  4IRZ A;  5EM2 B;  1VZ3 A;  4YVD A;  4CY2 A;  2P9I C;  2VDN A;  4XYI A;  4A0B B;  3EMH A;  3JRO A;  3MXX A;  5IGQ A;  2AH0 A;  4EWR A;  2OVP B;  4GQ2 P;  3RFH A;  1PI6 A;  5M5V A;  3BG1 A;  3GRE A;  1JJU B;  3AFC A;  2AGW A;  2YMU A;  4RE5 A;  4FA1 D;  1R5M A;  4JHP C;  3DWL C;  1E8N A;  2XE4 A;  2IWF A;  2I0T A;  2XDW A;  1VZ2 A;  2PM9 B;  1PEV A;  3VH0 A;  2EIC A;  3KCI A;  2VDM A;  4O9D A;  3RRM C;  2YNO A;  4L1M A;  1YR2 A;  4G1M A;  5AFU 3;  5C9Z B;  2XYI A;  3I2N A;  5I5M A;  4X63 B;  1Q47 A;  4E5Z A;  3T3P A;  1ERJ A;  3GFC A;  4O3U B;  5A2Q g;  4D0K A;  3PXS D;  3PXW D;  3JZG A;  4H5J A;  5K19 A;  4R7A B;  3IIW A;  2MTA H;  4AMZ A;  2G9A A;  3T3M A;  4GQB B;  2AGX A;  4FB1 D;  3J81 g;  1H2Z A;  3BG0 A;  2VZ1 A;  4BCD A;  4PBZ A;  3SBR A;  4J78 A;  1O6F A;  3C75 H;  3OKY A;  3MKQ A;  4GM3 A;  3CFS B;  3PVW B;  2UZX B;  3IUR A;  3IJC A;  5B4W A;  3I89 A;  4UM9 A;  3I7H A;  1YFQ A;  4J87 A;  1SQJ A;  4JHN A;  1U8C A;  3K6S A;  4WK2 A;  4L1Q D;  3RSE C;  4CI3 A;  3ZDX A;  5FFG A;  5EMK B;  3PSC B;  1SQ9 A;  3C5M A;  4BP8 A;  1QFM A;  1GOF A; 
#chains in the Genus database with same CATH homology
 5FA5 B;  5IT9 g;  1N6E A;  5EMJ B;  3OKT A;  4K3I D;  4JSV C;  3PXT D;  4J77 A;  2H13 A;  3NVX A;  4A09 B;  5H1M A;  4QQE A;  4ZOV A;  5EMM B;  4JSX C;  1S4U X;  3BWS A;  4CZY A;  2H6Q A;  2IAA A;  4BL0 A;  5HQG A;  3OKW A;  5I5I A;  2HJ4 A;  4QT8 A;  4J73 A;  3UVN A;  3F3G A;  2B4E A;  2OJY A;  5IJ8 E;  3JAM g;  4D6V A;  2H9P A;  2CE9 A;  4OZU A;  1RI6 A;  5FKT A;  3FGB A;  3EI2 A;  3SMR A;  1OLZ A;  3DM0 A;  2CN2 A;  3JZN A;  1TYQ C;  2P9N C;  2YBA A;  4Z8L A;  1NR0 A;  2B5N A;  4Y5R D;  5THA A;  5IJ7 E;  2XL2 A;  3C99 A;  2Z2N A;  2CO0 C;  3RN0 D;  3OTT A;  1A0R B;  2I0R A;  5H17 A;  2H68 A;  4NSX A;  2TRC B;  4FAV D;  3EU7 A;  3DXK C;  4ZOZ A;  1TBG A;  4ERQ A;  3C9C A;  4ES0 A;  4A08 B;  4O45 A;  3OW8 A;  4CI1 A;  3E0C A;  4FA4 D;  4LGN A;  4PBY A;  5KDO B;  3OL2 A;  3KRW B;  2YNP A;  1P22 A;  2GNQ A;  3CFV A;  3EG6 A;  3IJ0 A;  4ZOX A;  5FLX g;  5GMK n;  1PGU A;  2XL3 A;  4JSP C;  3JZH A;  4O1Q D;  4X3E A;  5GXI A;  2I0S A;  4CY1 A;  3N0E A;  2OK4 A;  2Z2P A;  2GC4 A;  1XHM A;  5HE2 B;  2HES X;  1B9X A;  5AMS A;  5HYN B;  4JD2 C;  1JMX B;  3AL8 B;  3N0D A;  4J8G A;  3EI1 B;  3ODT A;  4CY5 A;  3MKS B;  3IKO A;  5FKR A;  1N6F A;  1K32 A;  3EI2 B;  2QXV A;  3ORV D;  4E54 B;  2HXC A;  1NEX B;  3RMZ D;  4J86 A;  2HKM A;  3SCY A;  3SWS D;  3EI4 A;  3EWE A;  4K3J B;  4FA9 D;  2B5L A;  4Y7R A;  4QL1 A;  4J0W A;  5TDH B;  2Q7Q A;  3I7P A;  4LG9 A;  2QC5 A;  3EI3 B;  4PXW A;  2YNN A;  3V5W B;  2H6N A;  3I7N A;  4AEZ A;  1FWX A;  4XEI C;  3V9F A;  2IUP A;  2P9K C;  3FRX A;  2AQ5 A;  1VYH C;  3JPX A;  3I7K A;  3SBP A;  1U4C A;  4A0A A;  3F3F A;  5HE3 B;  3I8C A;  3UVL A;  2PBI B;  3OL2 B;  3RFG A;  5C2V B;  1SHY B;  2H6K A;  5HE1 B;  1GG2 B;  5IC7 A;  4A11 A;  4PNK B;  1U2V C;  3L4M D;  2B5M A;  2J56 H;  2XU7 A;  1N6D A;  3JRP A;  3PE7 A;  3PSL A;  5EM2 A;  2G99 A;  5H14 A;  1L0Q A;  4A0B A;  2IUV A;  4GM9 A;  3VA6 A;  4PSW B;  5CYK B;  3I7L A;  4X61 B;  2CO0 A;  4L3G D;  3UVM A;  1GP2 B;  2J57 G;  4ZOY A;  3I7O A;  2CE8 A;  1XKS A;  2OK6 A;  2UZY B;  3EI1 A;  5GSA A;  4L9O A;  1PBY B;  4TZ4 A;  3PVU B;  5TF2 A;  4CC9 A;  2OIZ A;  4A09 A;  5EAP A;  4J8B A;  3U4Y A;  2H9M A;  2IWK A;  2Z2O A;  1XIP A;  3VGZ A;  3DSM A;  3UVK A;  3SLE D;  2YB8 B;  3A0F A;  4GGA A;  3L4O D;  3MZL A;  4E5Z B;  4J81 A;  3UKR C;  3IIY A;  1JOF A;  4AOW A;  2W18 A;  4ERY A;  3EI3 A;  4ESG A;  1MG2 A;  4OWR A;  5CXC A;  3P4F A;  4PSX B;  2J55 H;  3NVQ A;  4GGC A;  5TEE A;  3SBQ A;  2O9K A;  4H5I A;  4N14 A;  1GXR A;  3F3P A;  5FQD A;  5IGO A;  2BBK H;  4HDJ A;  4CZX A;  3IJ1 A;  3SN6 B;  4CI2 A;  1K8K C;  4JT5 C;  5EAL A;  2H14 A;  4JSN C;  4IMM A;  4BH6 A;  1MG3 A;  5C2W B;  2P9U C;  4A11 B;  4FWW A;  3NVN A;  5FXY A;  4X60 B;  3HFQ A;  4J0X A;  3KRX B;  3AL9 A;  3JB9 L;  5CYK A;  4J82 A;  2HYE A;  4GMB A;  2CN3 A;  2H9N A;  2BCJ B;  5SXM A;  4FHL A;  2CNX A;  2HKR A;  1B9Y A;  3UVO A;  3SVW D;  5CXB A;  4JXM A;  3I8E A;  4LG8 A;  4CZV A;  3SHF A;  3SFZ A;  4GZ8 A;  3RLM D;  4A2M A;  2AGZ A;  3UR4 A;  4J79 A;  4A7J A;  4A2L A;  3DXM C;  3MZK A;  4QRJ A;  5JWZ A;  2PM7 B;  4JT6 C;  2I3S A;  3V7D B;  2H47 A;  5FKS A;  5EAR A;  3CIK B;  5EML B;  4FAN D;  4KFM B;  2GC7 A;  4PC0 A;  2H3X A;  4ERZ A;  2P9P C;  5CXC B;  2AH1 A;  2PM9 A;  5AJA A;  4E54 A;  4MK0 B;  5HE0 B;  2AGL A;  3K27 A;  4U1E I;  4CI8 A;  4G56 B;  3EI4 B;  3B7F A;  1MDA H;  1JMZ B;  3AH8 B;  5FKQ A;  2P9S C;  4GGD A;  3FM0 A;  4CY3 A;  4A08 A;  2OVR B;  4XYH A;  5K1C C;  4I79 A;  3J80 g;  2H9L A;  2AGY A;  2IUQ A;  5TEF A;  2PM6 B;  4L3H D;  3SJL D;  5EAM A;  2I3T A;  3UKU C;  3OKY B;  4ZN4 A;  3K26 A;  3MMY A;  1GOT B;  4O3T B;  2IUR A;  4GM8 A;  4IA9 A;  1QNI A;  2OVQ B;  3ZWL B;  4BUJ C;  4A0A B;  3ULE C;  2P9L C;  2HJB A;  4U7A A;  5CXB B;  4J84 A;  5GXH A;  1OMW B;  3RN1 D;  4GQ1 A;  4FA5 D;  2EBS A;  5I5J A;  3SXT D;  3W15 A;  4UI9 R;  3AL8 A;  5EM2 B;  4YVD A;  4CY2 A;  2P9I C;  4XYI A;  4A0B B;  3EMH A;  3JRO A;  3MXX A;  5IGQ A;  2AH0 A;  4EWR A;  2OVP B;  4GQ2 P;  3RFH A;  1PI6 A;  3BG1 A;  3GRE A;  1JJU B;  3AFC A;  2AGW A;  2YMU A;  4FA1 D;  1R5M A;  3DWL C;  2IWF A;  2I0T A;  2PM9 B;  3VH0 A;  1PEV A;  4O9D A;  3RRM C;  2YNO A;  5AFU 3;  2XYI A;  3I2N A;  5I5M A;  4X63 B;  1Q47 A;  4E5Z A;  1ERJ A;  3GFC A;  4O3U B;  5A2Q g;  4D0K A;  3PXS D;  3PXW D;  3JZG A;  4H5J A;  5K19 A;  4R7A B;  3IIW A;  2MTA H;  2G9A A;  4GQB B;  2AGX A;  4FB1 D;  3J81 g;  3BG0 A;  4PBZ A;  3SBR A;  4J78 A;  3C75 H;  3OKY A;  3MKQ A;  4GM3 A;  3CFS B;  3PVW B;  2UZX B;  3IJC A;  5B4W A;  3I89 A;  3I7H A;  1YFQ A;  4J87 A;  1SQJ A;  4L1Q D;  3RSE C;  4CI3 A;  5EMK B;  3PSC B;  1SQ9 A;  3C5M A;  5C9Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...