2GC4A

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
total genus 93
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gc4A00
2H14A 3JRPA 2H9NA 5AMSA 2AQ5A 3KRWB 5B4WA 2AH0A 3SVWD 2B5LA 3FM0A 4FWWA 4A0BB 4GQ1A 4A0AA 3CFSB 2H68A 2CN3A 2P9LC 1GOTB 1N6EA 3I7NA 3L4MD 4J8GA 5EMKB 3ODTA 4NSXA 5IJ7E 3I8CA 3SBRA 3GFCA 2GNQA 3AL9A 3IJCA 3RFGA 4IMMA 3FRXA 4JSNC 3K26A 3DM0A 4GM9A 5EM2B 4FB1D 2PM9B 2IWKA 4IA9A 5C2WB 4J8BA 1ERJA 2AGYA 2CO0A 5EAMA 1R5MA 3EMHA 4J79A 2IURA 4ZOVA 4BH6A 3EU7A 3FGBA 4FA5D 2YNPA 2IUPA 4X60B 2TRCB 5HE2B 3EWEA 2EBSA 4A2MA 2G99A 3SBPA 1Q47A 3OKTA 5I5JA 4GM8A 4EWRA 2OVPB 2P9UC 4JSPC 1GXRA 4A2LA 4X63B 3I7HA 2HJ4A 4ESGA 4A11B 4CY2A 4GMBA 3JPXA 4FA4D 4O45A 4J78A 4ES0A 3C75H 2OK6A 5HYNB 4X3EA 3RN1D 4ERYA 4H5JA 4A7JA 4J86A 5IJ8E 4U7AA 5CXCA 1VYHC 2CN2A 4BUJC 4JD2C 2H6NA 1N6FA 4FAVD 2CE9A 3RLMD 3AL8A 4LG9A 3OKYA 3C99A 3UKUC 3U4YA 3JB9L 4L9OA 2HKMA 1MDAH 4A08B 4ZOZA 3SBQA 2W18A 3PSLA 3PVWB 4XEIC 4QQEA 2BCJB 3I2NA 4PC0A 5GSAA 1JMZB 4Y5RD 2HXCA 2H9MA 4FA9D 4CZXA 5H14A 4CI8A 4J84A 1PEVA 3NVNA 3EI1A 5TEEA 3I7OA 3AH8B 1GG2B 3BG1A 5CXBB 1A0RB 2XL2A 4CC9A 3UKRC 4J87A 2AGXA 3EG6A 3E0CA 2I3TA 4GGCA 4J73A 4PNKB 4E54A 1NEXB 3EI2A 5C9ZB 5EMLB 2AGWA 2P9SC 3DWLC 4QL1A 3EI4A 4K3JB 4G56B 5GXIA 2H3XA 5K1CC 3UR4A 3SJLD 4ZN4A 3BG0A 4FAND 5CYKA 1S4UX 3IJ1A 5SXMA 3CFVA 3OTTA 4TZ4A 2HESX 2QXVA 3I89A 2J55H 4OZUA 3JZGA 2GC7A 4CY3A 2I0RA 1L0QA 5AFU3 1SHYB 2OK4A 1GP2B 4JXMA 3RSEC 2I0TA 4N14A 4A0AB 1K32A 3PVUB 4AEZA 3IIWA 4AOWA 2YB8B 3EI3B 2H9LA 4GZ8A 4O3UB 5CXBA 2H13A 2AGLA 1OLZA 4GM3A 1OMWB 1U4CA 4XYIA 3OKYB 2YMUA 5FLXg 3F3PA 1YFQA 4J82A 4LG8A 5FXYA 5FKSA 3JAMg 4D6VA 4E5ZB 4L1QD 3IIYA 3UVNA 4E5ZA 5CYKB 5FA5B 2YBAA 3HFQA 4ERZA 5I5IA 4PSXB 3BWSA 3KRXB 4R7AB 2Z2PA 5H17A 3OL2B 2G9AA 4CY1A 3JZHA 5FKQA 2CE8A 3EI2B 3ORVD 4X61B 2P9PC 2UZXB 1SQ9A 3SMRA 3EI4B 4O1QD 3I8EA 4I79A 5K19A 1B9YA 5H1MA 5A2Qg 5C2VB 1PBYB 5HE1B 4A08A 5TDHB 1PI6A 4O9DA 4BL0A 4CI1A 5EALA 3RFHA 4CI2A 3PE7A 4CY5A 3C9CA 2QC5A 4J0WA 3EI1B 1FWXA 3RRMC 3UVMA 5EAPA 2IUVA 4ZOXA 3UVLA 5I5MA 4KFMB 4GGAA 3I7PA 2H6QA 3IJ0A 3V7DB 4UI9R 2Z2NA 3J80g 3SCYA 4E54B 3CIKB 3L4OD 2HYEA 3MXXA 5EM2A 3SLED 1MG3A 3AFCA 3EI3A 4JSXC 2OVQB 1JMXB 4CI3A 2HJBA 1XHMA 3SN6B 3A0FA 2B4EA 3JROA 2IUQA 4QT8A 4D0KA 5AJAA 4L3GD 2Q7QA 2YNNA 2I0SA 1RI6A 2P9KC 5HE3B 5IGQA 3UVKA 3VGZA 5EMMB 3SFZA 3MKQA 2B5MA 1JJUB 2AH1A 3OKWA 4Y7RA 4HDJA 4JSVC 3MMYA 4A09B 3SXTD 4PSWB 5FQDA 4J81A 4Z8LA 4OWRA 3I7KA 5HE0B 3P4FA 1NR0A 4J77A 3SHFA 4A11A 3PSCB 1JOFA 2J57G 4ZOYA 5TF2A 5IT9g 2CNXA 5KDOB 1XKSA 3OW8A 4PXWA 5EMJB 2H9PA 3C5MA 3MZKA 4XYHA 2XU7A 1TBGA 3JZNA 4GQ2P 4MK0B 3K27A 3IKOA 2UZYB 2I3SA 2GC4A 3OL2A 4YVDA 4H5IA 5CXCB 5FKRA 3VA6A 2J56H 4JT6C 4U1EI 5IGOA 1SQJA 3GREA 2YNOA 2HKRA 3ULEC 3ZWLB 3N0EA 3DSMA 2H47A 3F3FA 4LGNA 1MG2A 2AGZA 1P22A 2BBKH 2MTAH 2PM9A 4FHLA 2XL3A 1N6DA 4CZYA 5HQGA 3N0DA 4L3HD 2H6KA 2PBIB 4GGDA 3DXKC 1B9XA 3PXWD 4ERQA 4A0BA 3AL8B 3SWSD 1XIPA 2OVRB 2IAAA 3B7FA 3UVOA 5JWZA 5TEFA 3MKSB 2OIZA 4A09A 2XYIA 3NVQA 2B5NA 3RMZD 1K8KC 3VH0A 1TYQC 3NVXA 3PXTD 5GMKn 1PGUA 3RN0D 2CO0C 4PBYA 4FA1D 3F3GA 4K3ID 5EARA 2PM6B 2O9KA 1QNIA 5GXHA 2IWFA 3V9FA 2OJYA 5FKTA 4QRJA 5IC7A 2P9NC 4J0XA 3DXMC 3PXSD 4PBZA 4O3TB 5THAA 1U2VC 2Z2OA 3MZLA 2P9IC 4GQBB 3W15A 3I7LA 3J81g 3V5WB 4JT5C 4CZVA 2PM7B
chains in the Genus database with same CATH superfamily
2H14A 3JRPA 1BPOA 3T3MA 2H9NA 5AMSA 2AQ5A 3KRWB 5B4WA 2AH0A 3SVWD 4BP8A 2B5LA 3FM0A 4FWWA 4A0BB 4GQ1A 1UOPA 3K72A 4JHNA 4A0AA 1H2WA 3CFSB 2H68A 2CN3A 3DDUA 3K6SA 2P9LC 1K3IA 1GOTB 1N6EA 3I7NA 3L4MD 1H2ZA 4J8GA 5EMKB 3ODTA 4NSXA 5IJ7E 3I8CA 3SBRA 3GFCA 2GNQA 3AL9A 3IJCA 3RFGA 4IMMA 3FRXA 4MMZA 4JSNC 1UOOA 3K26A 3DM0A 5E6SA 4GM9A 5EM2B 2VZ1A 4FB1D 2PM9B 2IWKA 4IA9A 5C2WB 4J8BA 3IURA 1ERJA 2AGYA 2CO0A 5EAMA 1O6GA 3IUJA 1R5MA 3EMHA 4J79A 1GOGA 2IURA 4ZOVA 1QFMA 4BH6A 3EU7A 3FGBA 4FA5D 2VC2A 2YNPA 2IUPA 4X60B 2TRCB 5HE2B 3K71A 3EWEA 1C9LA 2EBSA 3MUNA 4A2MA 2G99A 4DNVA 3SBPA 1Q47A 3OKTA 5I5JA 4GM8A 4EWRA 3T3PA 2OVPB 2P9UC 4JSPC 4D9SA 1GXRA 4A2LA 4X63B 3I7HA 2HJ4A 4ESGA 5M61A 4A11B 4CY2A 3IUQA 4GMBA 3JPXA 4FA4D 4O45A 4J78A 4WK2A 4ES0A 4WJKA 3C75H 2OK6A 5HYNB 4X3EA 3GD1I 3RN1D 4ERYA 4H5JA 4A7JA 4J86A 5IJ8E 1TYEA 4U7AA 5CXCA 1VYHC 2CN2A 5E6RA 4BUJC 2VZ3A 4JD2C 2H6NA 1N6FA 4G1MA 4FAVD 5FFGA 2CE9A 3RLMD 3AL8A 4LG9A 3OKYA 3C99A 1GOFA 3IUMA 4DNWA 3UKUC 1M1XA 3U4YA 3JB9L 4L9OA 2HKMA 1MDAH 4A08B 4ZOZA 2VDQA 3SBQA 3ZDXA 2W18A 3PSLA 3PVWB 4QQEA 4XEIC 2BCJB 3I2NA 3NIGA 4PC0A 5GSAA 1JMZB 4Y5RD 2HXCA 2H9MA 4FA9D 4CZXA 5H14A 4CI8A 4J84A 1PEVA 3NVNA 2WQ8A 5TEEA 2QR5A 3EI1A 1L5GA 3I7OA 3AH8B 1GG2B 3BG1A 2VDMA 5CXBB 3MVDK 1A0RB 2XL2A 4CC9A 3UKRC 4J87A 2AGXA 3EG6A 3E0CA 2I3TA 4GGCA 4J73A 4PNKB 4E54A 1NEXB 3EI2A 5C9ZB 5EMLB 1QFSA 2AGWA 4O02A 2P9SC 2VDKA 3DWLC 4QL1A 3EI4A 4K3JB 5M5TA 1UTCA 4G56B 5GXIA 2H3XA 5K1CC 3UR4A 4UM9A 3SJLD 4ZN4A 3BG0A 5FFOA 4FAND 5CYKA 1S4UX 2VDOA 3IJ1A 5SXMA 3CFVA 3OTTA 4TZ4A 2HESX 2QXVA 3I89A 2J55H 1I2MB 3JZGA 4OZUA 2GC7A 4CY3A 3ZDZA 5C92A 2I0RA 1L0QA 5AFU3 1SHYB 2OK4A 3NIDA 1GP2B 4JXMA 4RE6A 3RSEC 4UM8A 2I0TA 4N14A 4AMZA 4A0AB 2BKLA 1K32A 1YR2A 3ZE1A 1VE7A 3PVUB 3IIWA 4AEZA 4AOWA 2YB8B 3EI3B 3ZDYA 2H9LA 2XDWA 4GZ8A 4O3UB 5CXBA 1U8CA 2H13A 3V4VA 4Z7QA 2AGLA 1OLZA 4GM3A 1OMWB 1U4CA 4XYIA 1E5TA 3OKYB 4NAAA 4IRZA 5M5UA 2YMUA 5FLXg 5M5RA 1UOQA 3F3PA 1YFQA 4J82A 4G55A 4LG8A 1GOHA 2XZGA 5FXYA 1JTDB 5FKSA 3JAMg 4D6VA 4E5ZB 4L1QD 2XE4A 3IIYA 3UVNA 4E5ZA 2VDRA 5CYKB 5FA5B 2YBAA 3HFQA 4ERZA 5I5IA 1E8NA 4PSXB 3BWSA 3KRXB 4R7AB 2Z2PA 3GC3B 5H17A 3OL2B 4AX4A 2G9AA 4CY1A 3IUNA 3JZHA 4Z7NA 5FKQA 3IULA 2CE8A 3EI2B 2HU5A 3ORVD 5M5VA 4X61B 2P9PC 2UZXB 3VI3A 1SQ9A 3SMRA 2EIBA 2EIDA 3EI4B 4O1QD 4AN0A 4BCCA 3I8EA 4I79A 5K19A 1B9YA 5H1MA 5A2Qg 5C2VB 1PBYB 5HE1B 5C86A 4A08A 3IJEA 5TDHB 1PI6A 4O9DA 4BL0A 3VI4A 4CI1A 3QHYB 5EALA 3RFHA 3KCIA 4CI2A 3PE7A 1H2XA 4CY5A 3C9CA 2QC5A 4J0WA 3ZE0A 3EI1B 1FWXA 3RRMC 3UVMA 5EAPA 2IUVA 3EQ8A 4ZOXA 3UVLA 2VDLA 5I5MA 4KFMB 4GGAA 3I7PA 4WK0A 2H6QA 3IJ0A 3V7DB 4UI9R 2Z2NA 3J80g 3SCYA 4E54B 3CIKB 3L4OD 2HYEA 3MXXA 5EM2A 3SLED 1MG3A 3AFCA 3EQ9A 1VZ3A 4NBMA 1O6FA 3EI3A 4JSXC 4O2WA 1JMXB 2OVQB 4BCBA 4CI3A 2HJBA 1VZ2A 1XHMA 3MUOA 3SN6B 3A0FA 2B4EA 3JROA 4DNUA 2IUQA 4QT8A 3FCSA 4D0KA 5AJAA 4L3GD 4MMYA 2Q7QA 5HDBA 1JV2A 2I0SA 1RI6A 2P9KC 2YNNA 4NENA 5HE3B 5IGQA 3UVKA 3VGZA 1VE6A 5EMMB 3SFZA 3MKQA 2B5MA 1JJUB 2AH1A 3OKWA 4Y7RA 4HDJA 4JSVC 5M5SA 3MMYA 1A12A 4NC4A 4A09B 3O4JA 3SXTD 4PSWB 5FQDA 4J81A 4WK4A 4Z8LA 4OWRA 3I7KA 5HE0B 3P4FA 1NR0A 4J77A 5E6UA 3SHFA 4A11A 3PSCB 1JOFA 2J57G 4ZOYA 5TF2A 5IT9g 2CNXA 5KDOB 1XKSA 3OW8A 3O4HA 4PXWA 5EMJB 3ZE2A 1T2XA 2H9PA 3C5MA 3MZKA 4JHPC 2XU7A 1TBGA 4XYHA 3JZNA 4GQ2P 4MK0B 3K27A 3IKOA 2UZYB 3NIFA 2I3SA 2GC4A 3OL2A 4G1EA 4YVDA 4H5IA 5CXCB 5FKRA 3VA6A 2J56H 1H2YA 4JT6C 4U1EI 5IGOA 4BP9A 1SQJA 2JKXA 2YNOA 2HKRA 3GREA 3ULEC 3N0EA 3ZWLB 3DSMA 2H47A 3F3FA 1E8MA 3OF7A 4LGNA 1MG2A 2AGZA 1P22A 2BBKH 2MTAH 2PM9A 4FHLA 2XL3A 1N6DA 4CZYA 5HQGA 3N0DA 2EIEA 4L3HD 2H6KA 2PBIB 4GGDA 3DXKC 3FCUA 1B9XA 2HU7A 3PXWD 4ERQA 4A0BA 3AL8B 2HU8A 3SWSD 4BCDA 2QZPA 1XIPA 2OVRB 3EQ7A 2IAAA 3B7FA 3O4GA 3UVOA 5JWZA 3V4PA 5TEFA 3MKSB 2EICA 2OIZA 2XYIA 4A09A 3NVQA 2B5NA 3RMZD 4RE5A 1K8KC 3O4IA 3VH0A 1TYQC 3NVXA 4L1MA 1C9IA 3PXTD 5GMKn 4QAMA 4MMXA 1PGUA 3RN0D 2CO0C 4PBYA 4FA1D 3F3GA 4K3ID 4Z7OA 5EARA 2PM6B 2O9KA 1QNIA 5GXHA 2IWFA 3V9FA 2OJYA 2VDNA 5FKTA 4AN1A 4QRJA 4AMYA 3IVMA 5IC7A 2P9NC 2VDPA 4J0XA 3DXMC 3PXSD 4PBZA 4O3TB 5THAA 1U2VC 2Z2OA 3MZLA 2P9IC 3QI0A 4GQBB 3W15A 3I7LA 3J81g 3V5WB 4JT5C 4CZVA 2PM7B
chains in the Genus database with same CATH topology
2H14A 3JRPA 2H9NA 5AMSA 2AQ5A 3KRWB 5B4WA 2AH0A 3SVWD 2B5LA 3FM0A 4FWWA 4A0BB 4GQ1A 4A0AA 3CFSB 2H68A 2CN3A 2P9LC 1GOTB 1N6EA 3I7NA 3L4MD 4J8GA 5EMKB 3ODTA 4NSXA 5IJ7E 3I8CA 3SBRA 3GFCA 2GNQA 3AL9A 3IJCA 3RFGA 4IMMA 3FRXA 4JSNC 3K26A 3DM0A 4GM9A 5EM2B 4FB1D 2PM9B 2IWKA 4IA9A 5C2WB 4J8BA 1ERJA 2AGYA 2CO0A 5EAMA 1R5MA 3EMHA 4J79A 2IURA 4ZOVA 4BH6A 3EU7A 3FGBA 4FA5D 2YNPA 2IUPA 4X60B 2TRCB 5HE2B 3EWEA 2EBSA 4A2MA 2G99A 3SBPA 1Q47A 3OKTA 5I5JA 4GM8A 4EWRA 2OVPB 2P9UC 4JSPC 1GXRA 4A2LA 4X63B 3I7HA 2HJ4A 4ESGA 4A11B 4CY2A 4GMBA 3JPXA 4FA4D 4O45A 4J78A 4ES0A 3C75H 2OK6A 5HYNB 4X3EA 3RN1D 4ERYA 4H5JA 4A7JA 4J86A 5IJ8E 4U7AA 5CXCA 1VYHC 2CN2A 4BUJC 4JD2C 2H6NA 1N6FA 4FAVD 2CE9A 3RLMD 3AL8A 4LG9A 3OKYA 3C99A 3UKUC 3U4YA 3JB9L 4L9OA 2HKMA 1MDAH 4A08B 4ZOZA 3SBQA 2W18A 3PSLA 3PVWB 4XEIC 4QQEA 2BCJB 3I2NA 4PC0A 5GSAA 1JMZB 4Y5RD 2HXCA 2H9MA 4FA9D 4CZXA 5H14A 4CI8A 4J84A 1PEVA 3NVNA 3EI1A 5TEEA 3I7OA 3AH8B 1GG2B 3BG1A 5CXBB 1A0RB 2XL2A 4CC9A 3UKRC 4J87A 2AGXA 3EG6A 3E0CA 2I3TA 4GGCA 4J73A 4PNKB 4E54A 1NEXB 3EI2A 5C9ZB 5EMLB 2AGWA 2P9SC 3DWLC 4QL1A 3EI4A 4K3JB 4G56B 5GXIA 2H3XA 5K1CC 3UR4A 3SJLD 4ZN4A 3BG0A 4FAND 5CYKA 1S4UX 3IJ1A 5SXMA 3CFVA 3OTTA 4TZ4A 2HESX 2QXVA 3I89A 2J55H 4OZUA 3JZGA 2GC7A 4CY3A 2I0RA 1L0QA 5AFU3 1SHYB 2OK4A 1GP2B 4JXMA 3RSEC 2I0TA 4N14A 4A0AB 1K32A 3PVUB 4AEZA 3IIWA 4AOWA 2YB8B 3EI3B 2H9LA 4GZ8A 4O3UB 5CXBA 2H13A 2AGLA 1OLZA 4GM3A 1OMWB 1U4CA 4XYIA 3OKYB 2YMUA 5FLXg 3F3PA 1YFQA 4J82A 4LG8A 5FXYA 5FKSA 3JAMg 4D6VA 4E5ZB 4L1QD 3IIYA 3UVNA 4E5ZA 5CYKB 5FA5B 2YBAA 3HFQA 4ERZA 5I5IA 4PSXB 3BWSA 3KRXB 4R7AB 2Z2PA 5H17A 3OL2B 2G9AA 4CY1A 3JZHA 5FKQA 2CE8A 3EI2B 3ORVD 4X61B 2P9PC 2UZXB 1SQ9A 3SMRA 3EI4B 4O1QD 3I8EA 4I79A 5K19A 1B9YA 5H1MA 5A2Qg 5C2VB 1PBYB 5HE1B 4A08A 5TDHB 1PI6A 4O9DA 4BL0A 4CI1A 5EALA 3RFHA 4CI2A 3PE7A 4CY5A 3C9CA 2QC5A 4J0WA 3EI1B 1FWXA 3RRMC 3UVMA 5EAPA 2IUVA 4ZOXA 3UVLA 5I5MA 4KFMB 4GGAA 3I7PA 2H6QA 3IJ0A 3V7DB 4UI9R 2Z2NA 3J80g 3SCYA 4E54B 3CIKB 3L4OD 2HYEA 3MXXA 5EM2A 3SLED 1MG3A 3AFCA 3EI3A 4JSXC 2OVQB 1JMXB 4CI3A 2HJBA 1XHMA 3SN6B 3A0FA 2B4EA 3JROA 2IUQA 4QT8A 4D0KA 5AJAA 4L3GD 2Q7QA 2YNNA 2I0SA 1RI6A 2P9KC 5HE3B 5IGQA 3UVKA 3VGZA 5EMMB 3SFZA 3MKQA 2B5MA 1JJUB 2AH1A 3OKWA 4Y7RA 4HDJA 4JSVC 3MMYA 4A09B 3SXTD 4PSWB 5FQDA 4J81A 4Z8LA 4OWRA 3I7KA 5HE0B 3P4FA 1NR0A 4J77A 3SHFA 4A11A 3PSCB 1JOFA 2J57G 4ZOYA 5TF2A 5IT9g 2CNXA 5KDOB 1XKSA 3OW8A 4PXWA 5EMJB 2H9PA 3C5MA 3MZKA 4XYHA 2XU7A 1TBGA 3JZNA 4GQ2P 4MK0B 3K27A 3IKOA 2UZYB 2I3SA 2GC4A 3OL2A 4YVDA 4H5IA 5CXCB 5FKRA 3VA6A 2J56H 4JT6C 4U1EI 5IGOA 1SQJA 3GREA 2YNOA 2HKRA 3ULEC 3ZWLB 3N0EA 3DSMA 2H47A 3F3FA 4LGNA 1MG2A 2AGZA 1P22A 2BBKH 2MTAH 2PM9A 4FHLA 2XL3A 1N6DA 4CZYA 5HQGA 3N0DA 4L3HD 2H6KA 2PBIB 4GGDA 3DXKC 1B9XA 3PXWD 4ERQA 4A0BA 3AL8B 3SWSD 1XIPA 2OVRB 2IAAA 3B7FA 3UVOA 5JWZA 5TEFA 3MKSB 2OIZA 4A09A 2XYIA 3NVQA 2B5NA 3RMZD 1K8KC 3VH0A 1TYQC 3NVXA 3PXTD 5GMKn 1PGUA 3RN0D 2CO0C 4PBYA 4FA1D 3F3GA 4K3ID 5EARA 2PM6B 2O9KA 1QNIA 5GXHA 2IWFA 3V9FA 2OJYA 5FKTA 4QRJA 5IC7A 2P9NC 4J0XA 3DXMC 3PXSD 4PBZA 4O3TB 5THAA 1U2VC 2Z2OA 3MZLA 2P9IC 4GQBB 3W15A 3I7LA 3J81g 3V5WB 4JT5C 4CZVA 2PM7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H14 A;  3JRP A;  2H9N A;  5AMS A;  2AQ5 A;  3KRW B;  5B4W A;  2AH0 A;  3SVW D;  2B5L A;  3FM0 A;  4FWW A;  4A0B B;  4GQ1 A;  4A0A A;  3CFS B;  2H68 A;  2CN3 A;  2P9L C;  1GOT B;  1N6E A;  3I7N A;  3L4M D;  4J8G A;  5EMK B;  3ODT A;  4NSX A;  5IJ7 E;  3I8C A;  3SBR A;  3GFC A;  2GNQ A;  3AL9 A;  3IJC A;  3RFG A;  4IMM A;  3FRX A;  4JSN C;  3K26 A;  3DM0 A;  4GM9 A;  5EM2 B;  4FB1 D;  2PM9 B;  2IWK A;  4IA9 A;  5C2W B;  4J8B A;  1ERJ A;  2AGY A;  2CO0 A;  5EAM A;  1R5M A;  3EMH A;  4J79 A;  2IUR A;  4ZOV A;  4BH6 A;  3EU7 A;  3FGB A;  4FA5 D;  2YNP A;  2IUP A;  4X60 B;  2TRC B;  5HE2 B;  3EWE A;  2EBS A;  4A2M A;  2G99 A;  3SBP A;  1Q47 A;  3OKT A;  5I5J A;  4GM8 A;  4EWR A;  2OVP B;  2P9U C;  4JSP C;  1GXR A;  4A2L A;  4X63 B;  3I7H A;  2HJ4 A;  4ESG A;  4A11 B;  4CY2 A;  4GMB A;  3JPX A;  4FA4 D;  4O45 A;  4J78 A;  4ES0 A;  3C75 H;  2OK6 A;  5HYN B;  4X3E A;  3RN1 D;  4ERY A;  4H5J A;  4A7J A;  4J86 A;  5IJ8 E;  4U7A A;  5CXC A;  1VYH C;  2CN2 A;  4BUJ C;  4JD2 C;  2H6N A;  1N6F A;  4FAV D;  2CE9 A;  3RLM D;  3AL8 A;  4LG9 A;  3OKY A;  3C99 A;  3UKU C;  3U4Y A;  3JB9 L;  4L9O A;  2HKM A;  1MDA H;  4A08 B;  4ZOZ A;  3SBQ A;  2W18 A;  3PSL A;  3PVW B;  4XEI C;  4QQE A;  2BCJ B;  3I2N A;  4PC0 A;  5GSA A;  1JMZ B;  4Y5R D;  2HXC A;  2H9M A;  4FA9 D;  4CZX A;  5H14 A;  4CI8 A;  4J84 A;  1PEV A;  3NVN A;  3EI1 A;  5TEE A;  3I7O A;  3AH8 B;  1GG2 B;  3BG1 A;  5CXB B;  1A0R B;  2XL2 A;  4CC9 A;  3UKR C;  4J87 A;  2AGX A;  3EG6 A;  3E0C A;  2I3T A;  4GGC A;  4J73 A;  4PNK B;  4E54 A;  1NEX B;  3EI2 A;  5C9Z B;  5EML B;  2AGW A;  2P9S C;  3DWL C;  4QL1 A;  3EI4 A;  4K3J B;  4G56 B;  5GXI A;  2H3X A;  5K1C C;  3UR4 A;  3SJL D;  4ZN4 A;  3BG0 A;  4FAN D;  5CYK A;  1S4U X;  3IJ1 A;  5SXM A;  3CFV A;  3OTT A;  4TZ4 A;  2HES X;  2QXV A;  3I89 A;  2J55 H;  4OZU A;  3JZG A;  2GC7 A;  4CY3 A;  2I0R A;  1L0Q A;  5AFU 3;  1SHY B;  2OK4 A;  1GP2 B;  4JXM A;  3RSE C;  2I0T A;  4N14 A;  4A0A B;  1K32 A;  3PVU B;  4AEZ A;  3IIW A;  4AOW A;  2YB8 B;  3EI3 B;  2H9L A;  4GZ8 A;  4O3U B;  5CXB A;  2H13 A;  2AGL A;  1OLZ A;  4GM3 A;  1OMW B;  1U4C A;  4XYI A;  3OKY B;  2YMU A;  5FLX g;  3F3P A;  1YFQ A;  4J82 A;  4LG8 A;  5FXY A;  5FKS A;  3JAM g;  4D6V A;  4E5Z B;  4L1Q D;  3IIY A;  3UVN A;  4E5Z A;  5CYK B;  5FA5 B;  2YBA A;  3HFQ A;  4ERZ A;  5I5I A;  4PSX B;  3BWS A;  3KRX B;  4R7A B;  2Z2P A;  5H17 A;  3OL2 B;  2G9A A;  4CY1 A;  3JZH A;  5FKQ A;  2CE8 A;  3EI2 B;  3ORV D;  4X61 B;  2P9P C;  2UZX B;  1SQ9 A;  3SMR A;  3EI4 B;  4O1Q D;  3I8E A;  4I79 A;  5K19 A;  1B9Y A;  5H1M A;  5A2Q g;  5C2V B;  1PBY B;  5HE1 B;  4A08 A;  5TDH B;  1PI6 A;  4O9D A;  4BL0 A;  4CI1 A;  5EAL A;  3RFH A;  4CI2 A;  3PE7 A;  4CY5 A;  3C9C A;  2QC5 A;  4J0W A;  3EI1 B;  1FWX A;  3RRM C;  3UVM A;  5EAP A;  2IUV A;  4ZOX A;  3UVL A;  5I5M A;  4KFM B;  4GGA A;  3I7P A;  2H6Q A;  3IJ0 A;  3V7D B;  4UI9 R;  2Z2N A;  3J80 g;  3SCY A;  4E54 B;  3CIK B;  3L4O D;  2HYE A;  3MXX A;  5EM2 A;  3SLE D;  1MG3 A;  3AFC A;  3EI3 A;  4JSX C;  2OVQ B;  1JMX B;  4CI3 A;  2HJB A;  1XHM A;  3SN6 B;  3A0F A;  2B4E A;  3JRO A;  2IUQ A;  4QT8 A;  4D0K A;  5AJA A;  4L3G D;  2Q7Q A;  2YNN A;  2I0S A;  1RI6 A;  2P9K C;  5HE3 B;  5IGQ A;  3UVK A;  3VGZ A;  5EMM B;  3SFZ A;  3MKQ A;  2B5M A;  1JJU B;  2AH1 A;  3OKW A;  4Y7R A;  4HDJ A;  4JSV C;  3MMY A;  4A09 B;  3SXT D;  4PSW B;  5FQD A;  4J81 A;  4Z8L A;  4OWR A;  3I7K A;  5HE0 B;  3P4F A;  1NR0 A;  4J77 A;  3SHF A;  4A11 A;  3PSC B;  1JOF A;  2J57 G;  4ZOY A;  5TF2 A;  5IT9 g;  2CNX A;  5KDO B;  1XKS A;  3OW8 A;  4PXW A;  5EMJ B;  2H9P A;  3C5M A;  3MZK A;  4XYH A;  2XU7 A;  1TBG A;  3JZN A;  4GQ2 P;  4MK0 B;  3K27 A;  3IKO A;  2UZY B;  2I3S A;  2GC4 A;  3OL2 A;  4YVD A;  4H5I A;  5CXC B;  5FKR A;  3VA6 A;  2J56 H;  4JT6 C;  4U1E I;  5IGO A;  1SQJ A;  3GRE A;  2YNO A;  2HKR A;  3ULE C;  3ZWL B;  3N0E A;  3DSM A;  2H47 A;  3F3F A;  4LGN A;  1MG2 A;  2AGZ A;  1P22 A;  2BBK H;  2MTA H;  2PM9 A;  4FHL A;  2XL3 A;  1N6D A;  4CZY A;  5HQG A;  3N0D A;  4L3H D;  2H6K A;  2PBI B;  4GGD A;  3DXK C;  1B9X A;  3PXW D;  4ERQ A;  4A0B A;  3AL8 B;  3SWS D;  1XIP A;  2OVR B;  2IAA A;  3B7F A;  3UVO A;  5JWZ A;  5TEF A;  3MKS B;  2OIZ A;  4A09 A;  2XYI A;  3NVQ A;  2B5N A;  3RMZ D;  1K8K C;  3VH0 A;  1TYQ C;  3NVX A;  3PXT D;  5GMK n;  1PGU A;  3RN0 D;  2CO0 C;  4PBY A;  4FA1 D;  3F3G A;  4K3I D;  5EAR A;  2PM6 B;  2O9K A;  1QNI A;  5GXH A;  2IWF A;  3V9F A;  2OJY A;  5FKT A;  4QRJ A;  5IC7 A;  2P9N C;  4J0X A;  3DXM C;  3PXS D;  4PBZ A;  4O3T B;  5THA A;  1U2V C;  2Z2O A;  3MZL A;  2P9I C;  4GQB B;  3W15 A;  3I7L A;  3J81 g;  3V5W B;  4JT5 C;  4CZV A;  2PM7 B; 
#chains in the Genus database with same CATH topology
 2H14 A;  3JRP A;  1BPO A;  3T3M A;  2H9N A;  5AMS A;  2AQ5 A;  3KRW B;  5B4W A;  2AH0 A;  3SVW D;  4BP8 A;  2B5L A;  3FM0 A;  4FWW A;  4A0B B;  4GQ1 A;  1UOP A;  3K72 A;  4JHN A;  4A0A A;  1H2W A;  3CFS B;  2H68 A;  2CN3 A;  3DDU A;  3K6S A;  2P9L C;  1K3I A;  1GOT B;  1N6E A;  3I7N A;  3L4M D;  1H2Z A;  4J8G A;  5EMK B;  3ODT A;  4NSX A;  5IJ7 E;  3I8C A;  3SBR A;  3GFC A;  2GNQ A;  3AL9 A;  3IJC A;  3RFG A;  4IMM A;  3FRX A;  4MMZ A;  4JSN C;  1UOO A;  3K26 A;  3DM0 A;  5E6S A;  4GM9 A;  5EM2 B;  2VZ1 A;  4FB1 D;  2PM9 B;  2IWK A;  4IA9 A;  5C2W B;  4J8B A;  3IUR A;  1ERJ A;  2AGY A;  2CO0 A;  5EAM A;  1O6G A;  3IUJ A;  1R5M A;  3EMH A;  4J79 A;  1GOG A;  2IUR A;  4ZOV A;  1QFM A;  4BH6 A;  3EU7 A;  3FGB A;  4FA5 D;  2VC2 A;  2YNP A;  2IUP A;  4X60 B;  2TRC B;  5HE2 B;  3K71 A;  3EWE A;  1C9L A;  2EBS A;  3MUN A;  4A2M A;  2G99 A;  4DNV A;  3SBP A;  1Q47 A;  3OKT A;  5I5J A;  4GM8 A;  4EWR A;  3T3P A;  2OVP B;  2P9U C;  4JSP C;  4D9S A;  1GXR A;  4A2L A;  4X63 B;  3I7H A;  2HJ4 A;  4ESG A;  5M61 A;  4A11 B;  4CY2 A;  3IUQ A;  4GMB A;  3JPX A;  4FA4 D;  4O45 A;  4J78 A;  4WK2 A;  4ES0 A;  4WJK A;  3C75 H;  2OK6 A;  5HYN B;  4X3E A;  3GD1 I;  3RN1 D;  4ERY A;  4H5J A;  4A7J A;  4J86 A;  5IJ8 E;  1TYE A;  4U7A A;  5CXC A;  1VYH C;  2CN2 A;  5E6R A;  4BUJ C;  2VZ3 A;  4JD2 C;  2H6N A;  1N6F A;  4G1M A;  4FAV D;  5FFG A;  2CE9 A;  3RLM D;  3AL8 A;  4LG9 A;  3OKY A;  3C99 A;  1GOF A;  3IUM A;  4DNW A;  3UKU C;  1M1X A;  3U4Y A;  3JB9 L;  4L9O A;  2HKM A;  1MDA H;  4A08 B;  4ZOZ A;  2VDQ A;  3SBQ A;  3ZDX A;  2W18 A;  3PSL A;  3PVW B;  4QQE A;  4XEI C;  2BCJ B;  3I2N A;  3NIG A;  4PC0 A;  5GSA A;  1JMZ B;  4Y5R D;  2HXC A;  2H9M A;  4FA9 D;  4CZX A;  5H14 A;  4CI8 A;  4J84 A;  1PEV A;  3NVN A;  2WQ8 A;  5TEE A;  2QR5 A;  3EI1 A;  1L5G A;  3I7O A;  3AH8 B;  1GG2 B;  3BG1 A;  2VDM A;  5CXB B;  3MVD K;  1A0R B;  2XL2 A;  4CC9 A;  3UKR C;  4J87 A;  2AGX A;  3EG6 A;  3E0C A;  2I3T A;  4GGC A;  4J73 A;  4PNK B;  4E54 A;  1NEX B;  3EI2 A;  5C9Z B;  5EML B;  1QFS A;  2AGW A;  4O02 A;  2P9S C;  2VDK A;  3DWL C;  4QL1 A;  3EI4 A;  4K3J B;  5M5T A;  1UTC A;  4G56 B;  5GXI A;  2H3X A;  5K1C C;  3UR4 A;  4UM9 A;  3SJL D;  4ZN4 A;  3BG0 A;  5FFO A;  4FAN D;  5CYK A;  1S4U X;  2VDO A;  3IJ1 A;  5SXM A;  3CFV A;  3OTT A;  4TZ4 A;  2HES X;  2QXV A;  3I89 A;  2J55 H;  1I2M B;  3JZG A;  4OZU A;  2GC7 A;  4CY3 A;  3ZDZ A;  5C92 A;  2I0R A;  1L0Q A;  5AFU 3;  1SHY B;  2OK4 A;  3NID A;  1GP2 B;  4JXM A;  4RE6 A;  3RSE C;  4UM8 A;  2I0T A;  4N14 A;  4AMZ A;  4A0A B;  2BKL A;  1K32 A;  1YR2 A;  3ZE1 A;  1VE7 A;  3PVU B;  3IIW A;  4AEZ A;  4AOW A;  2YB8 B;  3EI3 B;  3ZDY A;  2H9L A;  2XDW A;  4GZ8 A;  4O3U B;  5CXB A;  1U8C A;  2H13 A;  3V4V A;  4Z7Q A;  2AGL A;  1OLZ A;  4GM3 A;  1OMW B;  1U4C A;  4XYI A;  1E5T A;  3OKY B;  4NAA A;  4IRZ A;  5M5U A;  2YMU A;  5FLX g;  5M5R A;  1UOQ A;  3F3P A;  1YFQ A;  4J82 A;  4G55 A;  4LG8 A;  1GOH A;  2XZG A;  5FXY A;  1JTD B;  5FKS A;  3JAM g;  4D6V A;  4E5Z B;  4L1Q D;  2XE4 A;  3IIY A;  3UVN A;  4E5Z A;  2VDR A;  5CYK B;  5FA5 B;  2YBA A;  3HFQ A;  4ERZ A;  5I5I A;  1E8N A;  4PSX B;  3BWS A;  3KRX B;  4R7A B;  2Z2P A;  3GC3 B;  5H17 A;  3OL2 B;  4AX4 A;  2G9A A;  4CY1 A;  3IUN A;  3JZH A;  4Z7N A;  5FKQ A;  3IUL A;  2CE8 A;  3EI2 B;  2HU5 A;  3ORV D;  5M5V A;  4X61 B;  2P9P C;  2UZX B;  3VI3 A;  1SQ9 A;  3SMR A;  2EIB A;  2EID A;  3EI4 B;  4O1Q D;  4AN0 A;  4BCC A;  3I8E A;  4I79 A;  5K19 A;  1B9Y A;  5H1M A;  5A2Q g;  5C2V B;  1PBY B;  5HE1 B;  5C86 A;  4A08 A;  3IJE A;  5TDH B;  1PI6 A;  4O9D A;  4BL0 A;  3VI4 A;  4CI1 A;  3QHY B;  5EAL A;  3RFH A;  3KCI A;  4CI2 A;  3PE7 A;  1H2X A;  4CY5 A;  3C9C A;  2QC5 A;  4J0W A;  3ZE0 A;  3EI1 B;  1FWX A;  3RRM C;  3UVM A;  5EAP A;  2IUV A;  3EQ8 A;  4ZOX A;  3UVL A;  2VDL A;  5I5M A;  4KFM B;  4GGA A;  3I7P A;  4WK0 A;  2H6Q A;  3IJ0 A;  3V7D B;  4UI9 R;  2Z2N A;  3J80 g;  3SCY A;  4E54 B;  3CIK B;  3L4O D;  2HYE A;  3MXX A;  5EM2 A;  3SLE D;  1MG3 A;  3AFC A;  3EQ9 A;  1VZ3 A;  4NBM A;  1O6F A;  3EI3 A;  4JSX C;  4O2W A;  1JMX B;  2OVQ B;  4BCB A;  4CI3 A;  2HJB A;  1VZ2 A;  1XHM A;  3MUO A;  3SN6 B;  3A0F A;  2B4E A;  3JRO A;  4DNU A;  2IUQ A;  4QT8 A;  3FCS A;  4D0K A;  5AJA A;  4L3G D;  4MMY A;  2Q7Q A;  5HDB A;  1JV2 A;  2I0S A;  1RI6 A;  2P9K C;  2YNN A;  4NEN A;  5HE3 B;  5IGQ A;  3UVK A;  3VGZ A;  1VE6 A;  5EMM B;  3SFZ A;  3MKQ A;  2B5M A;  1JJU B;  2AH1 A;  3OKW A;  4Y7R A;  4HDJ A;  4JSV C;  5M5S A;  3MMY A;  1A12 A;  4NC4 A;  4A09 B;  3O4J A;  3SXT D;  4PSW B;  5FQD A;  4J81 A;  4WK4 A;  4Z8L A;  4OWR A;  3I7K A;  5HE0 B;  3P4F A;  1NR0 A;  4J77 A;  5E6U A;  3SHF A;  4A11 A;  3PSC B;  1JOF A;  2J57 G;  4ZOY A;  5TF2 A;  5IT9 g;  2CNX A;  5KDO B;  1XKS A;  3OW8 A;  3O4H A;  4PXW A;  5EMJ B;  3ZE2 A;  1T2X A;  2H9P A;  3C5M A;  3MZK A;  4JHP C;  2XU7 A;  1TBG A;  4XYH A;  3JZN A;  4GQ2 P;  4MK0 B;  3K27 A;  3IKO A;  2UZY B;  3NIF A;  2I3S A;  2GC4 A;  3OL2 A;  4G1E A;  4YVD A;  4H5I A;  5CXC B;  5FKR A;  3VA6 A;  2J56 H;  1H2Y A;  4JT6 C;  4U1E I;  5IGO A;  4BP9 A;  1SQJ A;  2JKX A;  2YNO A;  2HKR A;  3GRE A;  3ULE C;  3N0E A;  3ZWL B;  3DSM A;  2H47 A;  3F3F A;  1E8M A;  3OF7 A;  4LGN A;  1MG2 A;  2AGZ A;  1P22 A;  2BBK H;  2MTA H;  2PM9 A;  4FHL A;  2XL3 A;  1N6D A;  4CZY A;  5HQG A;  3N0D A;  2EIE A;  4L3H D;  2H6K A;  2PBI B;  4GGD A;  3DXK C;  3FCU A;  1B9X A;  2HU7 A;  3PXW D;  4ERQ A;  4A0B A;  3AL8 B;  2HU8 A;  3SWS D;  4BCD A;  2QZP A;  1XIP A;  2OVR B;  3EQ7 A;  2IAA A;  3B7F A;  3O4G A;  3UVO A;  5JWZ A;  3V4P A;  5TEF A;  3MKS B;  2EIC A;  2OIZ A;  2XYI A;  4A09 A;  3NVQ A;  2B5N A;  3RMZ D;  4RE5 A;  1K8K C;  3O4I A;  3VH0 A;  1TYQ C;  3NVX A;  4L1M A;  1C9I A;  3PXT D;  5GMK n;  4QAM A;  4MMX A;  1PGU A;  3RN0 D;  2CO0 C;  4PBY A;  4FA1 D;  3F3G A;  4K3I D;  4Z7O A;  5EAR A;  2PM6 B;  2O9K A;  1QNI A;  5GXH A;  2IWF A;  3V9F A;  2OJY A;  2VDN A;  5FKT A;  4AN1 A;  4QRJ A;  4AMY A;  3IVM A;  5IC7 A;  2P9N C;  2VDP A;  4J0X A;  3DXM C;  3PXS D;  4PBZ A;  4O3T B;  5THA A;  1U2V C;  2Z2O A;  3MZL A;  2P9I C;  3QI0 A;  4GQB B;  3W15 A;  3I7L A;  3J81 g;  3V5W B;  4JT5 C;  4CZV A;  2PM7 B; 
#chains in the Genus database with same CATH homology
 2H14 A;  3JRP A;  2H9N A;  5AMS A;  2AQ5 A;  3KRW B;  5B4W A;  2AH0 A;  3SVW D;  2B5L A;  3FM0 A;  4FWW A;  4A0B B;  4GQ1 A;  4A0A A;  3CFS B;  2H68 A;  2CN3 A;  2P9L C;  1GOT B;  1N6E A;  3I7N A;  3L4M D;  4J8G A;  5EMK B;  3ODT A;  4NSX A;  5IJ7 E;  3I8C A;  3SBR A;  3GFC A;  2GNQ A;  3AL9 A;  3IJC A;  3RFG A;  4IMM A;  3FRX A;  4JSN C;  3K26 A;  3DM0 A;  4GM9 A;  5EM2 B;  4FB1 D;  2PM9 B;  2IWK A;  4IA9 A;  5C2W B;  4J8B A;  1ERJ A;  2AGY A;  2CO0 A;  5EAM A;  1R5M A;  3EMH A;  4J79 A;  2IUR A;  4ZOV A;  4BH6 A;  3EU7 A;  3FGB A;  4FA5 D;  2YNP A;  2IUP A;  4X60 B;  2TRC B;  5HE2 B;  3EWE A;  2EBS A;  4A2M A;  2G99 A;  3SBP A;  1Q47 A;  3OKT A;  5I5J A;  4GM8 A;  4EWR A;  2OVP B;  2P9U C;  4JSP C;  1GXR A;  4A2L A;  4X63 B;  3I7H A;  2HJ4 A;  4ESG A;  4A11 B;  4CY2 A;  4GMB A;  3JPX A;  4FA4 D;  4O45 A;  4J78 A;  4ES0 A;  3C75 H;  2OK6 A;  5HYN B;  4X3E A;  3RN1 D;  4ERY A;  4H5J A;  4A7J A;  4J86 A;  5IJ8 E;  4U7A A;  5CXC A;  1VYH C;  2CN2 A;  4BUJ C;  4JD2 C;  2H6N A;  1N6F A;  4FAV D;  2CE9 A;  3RLM D;  3AL8 A;  4LG9 A;  3OKY A;  3C99 A;  3UKU C;  3U4Y A;  3JB9 L;  4L9O A;  2HKM A;  1MDA H;  4A08 B;  4ZOZ A;  3SBQ A;  2W18 A;  3PSL A;  3PVW B;  4XEI C;  4QQE A;  2BCJ B;  3I2N A;  4PC0 A;  5GSA A;  1JMZ B;  4Y5R D;  2HXC A;  2H9M A;  4FA9 D;  4CZX A;  5H14 A;  4CI8 A;  4J84 A;  1PEV A;  3NVN A;  3EI1 A;  5TEE A;  3I7O A;  3AH8 B;  1GG2 B;  3BG1 A;  5CXB B;  1A0R B;  2XL2 A;  4CC9 A;  3UKR C;  4J87 A;  2AGX A;  3EG6 A;  3E0C A;  2I3T A;  4GGC A;  4J73 A;  4PNK B;  4E54 A;  1NEX B;  3EI2 A;  5C9Z B;  5EML B;  2AGW A;  2P9S C;  3DWL C;  4QL1 A;  3EI4 A;  4K3J B;  4G56 B;  5GXI A;  2H3X A;  5K1C C;  3UR4 A;  3SJL D;  4ZN4 A;  3BG0 A;  4FAN D;  5CYK A;  1S4U X;  3IJ1 A;  5SXM A;  3CFV A;  3OTT A;  4TZ4 A;  2HES X;  2QXV A;  3I89 A;  2J55 H;  4OZU A;  3JZG A;  2GC7 A;  4CY3 A;  2I0R A;  1L0Q A;  5AFU 3;  1SHY B;  2OK4 A;  1GP2 B;  4JXM A;  3RSE C;  2I0T A;  4N14 A;  4A0A B;  1K32 A;  3PVU B;  4AEZ A;  3IIW A;  4AOW A;  2YB8 B;  3EI3 B;  2H9L A;  4GZ8 A;  4O3U B;  5CXB A;  2H13 A;  2AGL A;  1OLZ A;  4GM3 A;  1OMW B;  1U4C A;  4XYI A;  3OKY B;  2YMU A;  5FLX g;  3F3P A;  1YFQ A;  4J82 A;  4LG8 A;  5FXY A;  5FKS A;  3JAM g;  4D6V A;  4E5Z B;  4L1Q D;  3IIY A;  3UVN A;  4E5Z A;  5CYK B;  5FA5 B;  2YBA A;  3HFQ A;  4ERZ A;  5I5I A;  4PSX B;  3BWS A;  3KRX B;  4R7A B;  2Z2P A;  5H17 A;  3OL2 B;  2G9A A;  4CY1 A;  3JZH A;  5FKQ A;  2CE8 A;  3EI2 B;  3ORV D;  4X61 B;  2P9P C;  2UZX B;  1SQ9 A;  3SMR A;  3EI4 B;  4O1Q D;  3I8E A;  4I79 A;  5K19 A;  1B9Y A;  5H1M A;  5A2Q g;  5C2V B;  1PBY B;  5HE1 B;  4A08 A;  5TDH B;  1PI6 A;  4O9D A;  4BL0 A;  4CI1 A;  5EAL A;  3RFH A;  4CI2 A;  3PE7 A;  4CY5 A;  3C9C A;  2QC5 A;  4J0W A;  3EI1 B;  1FWX A;  3RRM C;  3UVM A;  5EAP A;  2IUV A;  4ZOX A;  3UVL A;  5I5M A;  4KFM B;  4GGA A;  3I7P A;  2H6Q A;  3IJ0 A;  3V7D B;  4UI9 R;  2Z2N A;  3J80 g;  3SCY A;  4E54 B;  3CIK B;  3L4O D;  2HYE A;  3MXX A;  5EM2 A;  3SLE D;  1MG3 A;  3AFC A;  3EI3 A;  4JSX C;  2OVQ B;  1JMX B;  4CI3 A;  2HJB A;  1XHM A;  3SN6 B;  3A0F A;  2B4E A;  3JRO A;  2IUQ A;  4QT8 A;  4D0K A;  5AJA A;  4L3G D;  2Q7Q A;  2YNN A;  2I0S A;  1RI6 A;  2P9K C;  5HE3 B;  5IGQ A;  3UVK A;  3VGZ A;  5EMM B;  3SFZ A;  3MKQ A;  2B5M A;  1JJU B;  2AH1 A;  3OKW A;  4Y7R A;  4HDJ A;  4JSV C;  3MMY A;  4A09 B;  3SXT D;  4PSW B;  5FQD A;  4J81 A;  4Z8L A;  4OWR A;  3I7K A;  5HE0 B;  3P4F A;  1NR0 A;  4J77 A;  3SHF A;  4A11 A;  3PSC B;  1JOF A;  2J57 G;  4ZOY A;  5TF2 A;  5IT9 g;  2CNX A;  5KDO B;  1XKS A;  3OW8 A;  4PXW A;  5EMJ B;  2H9P A;  3C5M A;  3MZK A;  4XYH A;  2XU7 A;  1TBG A;  3JZN A;  4GQ2 P;  4MK0 B;  3K27 A;  3IKO A;  2UZY B;  2I3S A;  2GC4 A;  3OL2 A;  4YVD A;  4H5I A;  5CXC B;  5FKR A;  3VA6 A;  2J56 H;  4JT6 C;  4U1E I;  5IGO A;  1SQJ A;  3GRE A;  2YNO A;  2HKR A;  3ULE C;  3ZWL B;  3N0E A;  3DSM A;  2H47 A;  3F3F A;  4LGN A;  1MG2 A;  2AGZ A;  1P22 A;  2BBK H;  2MTA H;  2PM9 A;  4FHL A;  2XL3 A;  1N6D A;  4CZY A;  5HQG A;  3N0D A;  4L3H D;  2H6K A;  2PBI B;  4GGD A;  3DXK C;  1B9X A;  3PXW D;  4ERQ A;  4A0B A;  3AL8 B;  3SWS D;  1XIP A;  2OVR B;  2IAA A;  3B7F A;  3UVO A;  5JWZ A;  5TEF A;  3MKS B;  2OIZ A;  4A09 A;  2XYI A;  3NVQ A;  2B5N A;  3RMZ D;  1K8K C;  3VH0 A;  1TYQ C;  3NVX A;  3PXT D;  5GMK n;  1PGU A;  3RN0 D;  2CO0 C;  4PBY A;  4FA1 D;  3F3G A;  4K3I D;  5EAR A;  2PM6 B;  2O9K A;  1QNI A;  5GXH A;  2IWF A;  3V9F A;  2OJY A;  5FKT A;  4QRJ A;  5IC7 A;  2P9N C;  4J0X A;  3DXM C;  3PXS D;  4PBZ A;  4O3T B;  5THA A;  1U2V C;  2Z2O A;  3MZL A;  2P9I C;  4GQB B;  3W15 A;  3I7L A;  3J81 g;  3V5W B;  4JT5 C;  4CZV A;  2PM7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...