2GC4A

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 93
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gc4A00
2P9NC 3I2NA 4J78A 1OMWB 4AEZA 2CN2A 4FWWA 3EI4A 4JD2C 5JWZA 2G9AA 4UI9R 1JJUB 4L3GD 4BL0A 4FA1D 3EI1A 4X60B 3V5WB 4EWRA 4L3HD 3UKRC 3BWSA 3MKSB 2I3SA 3DXMC 2UZXB 4U7AA 1N6EA 3I7NA 2AGZA 4A2MA 1NR0A 4JSXC 4ZN4A 2Z2NA 3OL2B 3PXTD 5I5MA 5I5JA 4GM9A 3L4MD 2PM6B 3JPXA 4CI3A 2O9KA 3EI4B 2OJYA 4JSNC 4H5IA 3EI1B 2I0RA 3IJCA 4O3TB 4ESGA 3JZGA 3V7DB 4K3JB 2PBIB 2Z2OA 3PSCB 3RFHA 2H6NA 3SFZA 2H9MA 4IMMA 1GP2B 1PI6A 2CE8A 4JT6C 4J8BA 2GNQA 1XHMA 5H1MA 4X61B 4FAVD 3UVOA 3EU7A 4J87A 1TYQC 2PM7B 5IJ7E 4GGCA 4A09A 4PNKB 3DSMA 4R7AB 2CO0C 1S4UX 3RSEC 2AGLA 2P9PC 3EI3B 5IGOA 1Q47A 4ERYA 1K8KC 4L1QD 3SVWD 1N6FA 5HE1B 4GM8A 4J81A 2H9PA 4CI1A 3OKWA 3OKTA 4E5ZB 4J0WA 5H17A 3IJ0A 5HE2B 3AL9A 3ZWLB 3NVNA 1N6DA 2BCJB 2J57G 4J77A 1JOFA 2IUVA 3RN1D 2CE9A 5THAA 4BUJC 5FKQA 3EWEA 4A7JA 4QQEA 5CXBA 3I89A 1PBYB 2QXVA 2PM9B 3PXSD 4H5JA 3OTTA 3ODTA 3MZLA 5CXCA 1OLZA 4O1QD 3NVQA 5TF2A 4KFMB 2P9LC 4CY3A 2HESX 3F3GA 3OL2A 3RN0D 4D6VA 2AGWA 4O9DA 4J84A 4PSXB 5C2WB 3P4FA 3C9CA 2H3XA 4O45A 3CIKB 5CXBB 5EM2B 2MTAH 3SCYA 3KRXB 3C5MA 5EARA 5KDOB 3JZNA 5TDHB 3OKYA 4CZYA 3DM0A 5HE3B 3KRWB 4ZOZA 3JROA 1U2VC 5CXCB 4E54B 4LG8A 3DWLC 3BG0A 1K32A 4FHLA 4X3EA 4CZXA 3RMZD 4NSXA 2J56H 3SBRA 5C2VB 3NVXA 3C99A 2HKRA 4D0KA 1L0QA 3PVWB 1P22A 3EI3A 3AL8B 4GM3A 4G56B 4XEIC 4Y7RA 4FAND 1QNIA 3U4YA 2AQ5A 3I7LA 4LGNA 3OKYB 2IUPA 4AOWA 2HKMA 2P9SC 2I0TA 4FB1D 4E5ZA 4ZOVA 2CO0A 2GC4A 2YNOA 3JB9L 3I7HA 4I79A 3VGZA 3PSLA 3UVMA 2BBKH 3JAMg 3MZKA 4GZ8A 2EBSA 4PXWA 3CFSB 3FRXA 3W15A 3IIWA 3V9FA 4J79A 4PC0A 4A08A 3EG6A 2Z2PA 2YNNA 3N0DA 4PBYA 1PGUA 4CY2A 3UKUC 3I7PA 4CY1A 4GQBB 5GXIA 1MDAH 4QT8A 3RFGA 3VH0A 4FA4D 2PM9A 5HYNB 2P9UC 3UR4A 2I3TA 2OVRB 3OW8A 5H14A 4PSWB 3SMRA 4CY5A 2HYEA 3L4OD 2H9NA 5IJ8E 2YBAA 2HXCA 4J73A 3PVUB 1SQJA 1FWXA 2IUQA 4A08B 4GQ2P 4X63B 5GXHA 3GREA 2I0SA 3J81g 5CYKA 1GXRA 4L9OA 5TEEA 5EM2A 3SHFA 2XU7A 3EI2A 3SLED 3EMHA 2H6KA 1U4CA 4GMBA 1RI6A 3SJLD 4E54A 4OWRA 2H9LA 4J0XA 4ES0A 4TZ4A 5EMKB 4CC9A 5EMLB 4JT5C 5EAPA 2H6QA 3DXKC 5AFU3 3BG1A 3SBQA 4JSPC 3A0FA 3SXTD 1MG2A 2OK4A 2CN3A 2CNXA 4GGAA 5CYKB 3RRMC 3AL8A 1XKSA 3MMYA 4ERQA 4A2LA 5EALA 3EI2B 5I5IA 3FGBA 3IKOA 3IJ1A 4CI8A 3I7OA 2XL2A 1B9YA 2H13A 2W18A 1SHYB 4O3UB 4IA9A 4Y5RD 4JSVC 5FXYA 4FA9D 5FQDA 3PXWD 4QL1A 3HFQA 4U1EI 3SWSD 4CI2A 4HDJA 2IWKA 5AMSA 4JXMA 4XYHA 5C9ZB 1GG2B 2YNPA 2OVPB 2UZYB 3AH8B 3UVKA 2OK6A 3ORVD 5FKTA 4BH6A 2P9KC 3UVLA 5IC7A 4K3ID 3J80g 5GSAA 2G99A 2AGXA 3N0EA 1MG3A 2IWFA 2TRCB 5A2Qg 2YB8B 2GC7A 4XYIA 1GOTB 2XYIA 4OZUA 2B4EA 2AH0A 3C75H 1ERJA 3FM0A 1JMXB 3MKQA 1TBGA 4CZVA 3CFVA 4PBZA 5FA5B 5K1CC 1VYHC 1JMZB 4GGDA 3GFCA 4YVDA 1SQ9A 2IURA 4GQ1A 2IAAA 4A0AA 2H14A 5K19A 2P9IC 3PE7A 3JRPA 5HQGA 3IIYA 5B4WA 2B5NA 3VA6A 2B5LA 4A11A 2J55H 1XIPA 5FKSA 4A0BA 4J86A 4Z8LA 4ZOYA 4ZOXA 3I8EA 2XL3A 5FKRA 2H68A 3SN6B 4LG9A 5GMKn 1YFQA 3I8CA 4J8GA 4A0AB 5HE0B 5SXMA 5AJAA 3AFCA 2AH1A 3UVNA 4N14A 4A09B 4QRJA 3E0CA 4MK0B 2HJ4A 2H47A 4A11B 2QC5A 3RLMD 4A0BB 1PEVA 3SBPA 5FLXg 2AGYA 4J82A 2YMUA 1A0RB 2HJBA 2OIZA 3F3FA 3F3PA 5IT9g 2OVQB 1R5MA 3MXXA 3ULEC 3K27A 1B9XA 1NEXB 2Q7QA 3K26A 5EMJB 3I7KA 5EMMB 5IGQA 2B5MA 5EAMA 3JZHA 5TEFA 4ERZA 3B7FA 4FA5D
chains in the Genus database with same CATH superfamily
2P9NC 3I2NA 3EQ7A 4J78A 1OMWB 4AEZA 2CN2A 4FWWA 3EI4A 4JD2C 5JWZA 2G9AA 4UI9R 1JJUB 4L3GD 3ZDZA 4BL0A 4FA1D 3EI1A 4X60B 3V5WB 4EWRA 4L3HD 3UKRC 1GOHA 3BWSA 3MKSB 2I3SA 3DXMC 2UZXB 4U7AA 1N6EA 3I7NA 1H2XA 3IUJA 2AGZA 5E6UA 4A2MA 1NR0A 4JSXC 4ZN4A 2Z2NA 1VE7A 3OL2B 1E8MA 1H2ZA 3PXTD 2VDRA 5I5MA 5M5VA 5I5JA 5M5TA 4GM9A 3L4MD 2PM6B 3JPXA 4RE5A 4CI3A 2O9KA 3V4VA 3EI4B 2OJYA 4JSNC 4H5IA 5HDBA 3EI1B 2I0RA 3V4PA 4IRZA 4DNVA 2QZPA 3IJCA 4O3TB 4ESGA 3JZGA 3V7DB 4K3JB 3FCUA 2PBIB 2Z2OA 3PSCB 4WK2A 2HU5A 3RFHA 2H6NA 3SFZA 2H9MA 4IMMA 4BCCA 1GP2B 1PI6A 2CE8A 4JT6C 4J8BA 2GNQA 1XHMA 5H1MA 4X61B 4FAVD 3UVOA 3EU7A 4J87A 1TYQC 2PM7B 5IJ7E 4GGCA 4O02A 4A09A 4PNKB 3DSMA 4R7AB 2CO0C 1E5TA 1S4UX 4MMXA 3RSEC 2AGLA 2P9PC 3EI3B 5IGOA 1BPOA 1O6GA 1Q47A 4ERYA 1K8KC 4L1QD 3SVWD 1H2WA 1N6FA 5HE1B 4GM8A 4J81A 2H9PA 4NAAA 4CI1A 3OKWA 3OKTA 4E5ZB 2XZGA 4J0WA 3O4JA 5H17A 2VDPA 3IUMA 3IJ0A 4G1EA 5HE2B 3ZE0A 3AL9A 3ZWLB 3NVNA 1N6DA 2BCJB 2J57G 4J77A 2XDWA 1JOFA 3MVDK 2IUVA 3RN1D 2CE9A 2VC2A 5E6SA 5THAA 4BUJC 5FKQA 3ZE2A 3EWEA 4A7JA 4QQEA 2EIEA 5CXBA 2VDOA 3I89A 1PBYB 2QXVA 4JHNA 2PM9B 3PXSD 4H5JA 1A12A 3OTTA 3ODTA 3MZLA 5CXCA 1C9IA 1OLZA 4O1QD 3NVQA 5TF2A 4KFMB 2P9LC 4CY3A 3QI0A 2HESX 3F3GA 3OL2A 2VDLA 3RN0D 4D6VA 4G55A 2AGWA 4O9DA 1UOQA 4NENA 4J84A 4PSXB 5C2WB 3P4FA 3C9CA 2H3XA 3QHYB 4O45A 2BKLA 3CIKB 5CXBB 5EM2B 2MTAH 3SCYA 3KRXB 3C5MA 5EARA 5KDOB 3JZNA 5TDHB 3OKYA 4CZYA 3DM0A 2EIBA 1GOGA 5HE3B 3KRWB 4DNWA 3ZDXA 4ZOZA 3JROA 1U2VC 5CXCB 4E54B 1VE6A 4LG8A 3DWLC 3BG0A 1K32A 4FHLA 4X3EA 4CZXA 3RMZD 4NSXA 5M5RA 2J56H 4JHPC 3DDUA 3SBRA 1JTDB 5C2VB 3IJEA 3NVXA 3K6SA 3C99A 2HKRA 2VDMA 1L0QA 4D0KA 3PVWB 1TYEA 1P22A 4WK0A 3EI3A 3AL8B 3IUQA 4G56B 4GM3A 4XEIC 4Y7RA 4FAND 1QNIA 3U4YA 2AQ5A 3I7LA 4LGNA 3GC3B 3OKYB 2IUPA 4AOWA 1O6FA 2HKMA 2P9SC 2I0TA 4FB1D 4AMYA 4E5ZA 4ZOVA 1T2XA 2CO0A 2GC4A 2YNOA 3T3PA 3JB9L 3I7HA 4I79A 3VGZA 3PSLA 3UVMA 5FFOA 5C86A 2BBKH 4UM8A 3JAMg 3MZKA 4GZ8A 2EBSA 4PXWA 1QFMA 3CFSB 3FRXA 4Z7OA 3W15A 2HU7A 3IIWA 2WQ8A 3V9FA 4J79A 4PC0A 4BCBA 4A08A 3EG6A 2Z2PA 2YNNA 3N0DA 4PBYA 1PGUA 4CY2A 4Z7NA 3UKUC 3I7PA 4G1MA 3VI4A 4CY1A 4GQBB 5C92A 5GXIA 1MDAH 4QT8A 3RFGA 3ZE1A 3IULA 3VH0A 4FA4D 2PM9A 1I2MB 1L5GA 5HYNB 2EICA 2P9UC 3UR4A 2I3TA 2OVRB 3OW8A 5H14A 4PSWB 3SMRA 2JKXA 4CY5A 4Z7QA 2HYEA 3L4OD 2H9NA 5IJ8E 2YBAA 2HXCA 4J73A 4RE6A 3PVUB 1SQJA 4WK4A 4L1MA 1FWXA 2IUQA 4AX4A 4GQ2P 4X63B 4A08B 4DNUA 5GXHA 2QR5A 2I0SA 3GREA 3J81g 5CYKA 1GXRA 4L9OA 2VDNA 5TEEA 5EM2A 3SHFA 2XU7A 3EI2A 3SLED 3EMHA 2H6KA 1U4CA 4GMBA 2HU8A 1RI6A 3SJLD 3K71A 1M1XA 4E54A 4OWRA 2H9LA 4J0XA 4ES0A 4TZ4A 5EMKB 3K72A 4CC9A 5EMLB 4JT5C 5E6RA 5EAPA 2H6QA 3DXKC 4NBMA 5AFU3 3BG1A 3SBQA 4JSPC 3A0FA 3SXTD 4AMZA 1MG2A 5FFGA 3NIGA 2OK4A 2CN3A 2CNXA 1VZ3A 4GGAA 5CYKB 2VZ3A 2VDQA 4D9SA 3RRMC 3AL8A 1XKSA 3MMYA 4ERQA 4A2LA 5EALA 3EI2B 5I5IA 3FGBA 3IKOA 4O2WA 3IJ1A 4CI8A 3OF7A 3I7OA 2XL2A 1B9YA 2H13A 2W18A 1SHYB 4AN1A 4O3UB 4IA9A 4Y5RD 4JSVC 5FXYA 4FA9D 5FQDA 3PXWD 4QL1A 3HFQA 1QFSA 4U1EI 3SWSD 4CI2A 4HDJA 2IWKA 5AMSA 4JXMA 4XYHA 5C9ZB 1GG2B 2YNPA 2OVPB 2UZYB 1U8CA 3AH8B 3UVKA 2OK6A 3ORVD 5FKTA 4BH6A 4WJKA 2P9KC 3UVLA 5IC7A 4K3ID 1K3IA 4MMZA 3J80g 5GSAA 2G99A 2AGXA 3N0EA 1MG3A 2EIDA 2IWFA 2TRCB 4MMYA 5A2Qg 2XE4A 2YB8B 2GC7A 3O4IA 4XYIA 1GOTB 3IUNA 3T3MA 4BP8A 2XYIA 3EQ8A 4OZUA 4AN0A 2B4EA 3KCIA 2AH0A 3C75H 5M5UA 1ERJA 3FM0A 1JMXB 3MKQA 1TBGA 1GOFA 4CZVA 3CFVA 4PBZA 5FA5B 5K1CC 1VYHC 1YR2A 3NIFA 4UM9A 4NC4A 1JMZB 4GGDA 4QAMA 3GFCA 4YVDA 1SQ9A 2IURA 1JV2A 1VZ2A 2IAAA 3MUOA 4GQ1A 4A0AA 2H14A 1UTCA 3EQ9A 1E8NA 5K19A 2P9IC 3PE7A 1C9LA 3JRPA 5HQGA 3IIYA 3VI3A 5B4WA 3GD1I 3NIDA 2B5NA 3VA6A 2B5LA 4A11A 2J55H 1XIPA 5FKSA 4A0BA 4J86A 4Z8LA 4ZOYA 4BP9A 4ZOXA 3I8EA 2XL3A 5FKRA 2H68A 3SN6B 4LG9A 5GMKn 3MUNA 1YFQA 3I8CA 2VDKA 4J8GA 4A0AB 5HE0B 5SXMA 5AJAA 3AFCA 2AH1A 3UVNA 4N14A 4A09B 4QRJA 3E0CA 4MK0B 2HJ4A 2H47A 4A11B 2QC5A 3RLMD 4A0BB 1PEVA 3SBPA 5FLXg 2AGYA 4J82A 2YMUA 1A0RB 2HJBA 2OIZA 3ZDYA 3F3FA 3F3PA 5IT9g 5M61A 2OVQB 1R5MA 3MXXA 3ULEC 3K27A 1B9XA 1NEXB 2Q7QA 3K26A 5EMJB 4FA5D 1UOOA 3IURA 3I7KA 1H2YA 2VZ1A 5M5SA 5EMMB 3FCSA 5IGQA 2B5MA 3O4HA 3JZHA 3O4GA 1UOPA 5EAMA 5TEFA 4BCDA 4ERZA 3B7FA 3IVMA
chains in the Genus database with same CATH topology
2P9NC 3I2NA 4J78A 1OMWB 4AEZA 2CN2A 4FWWA 3EI4A 4JD2C 5JWZA 2G9AA 4UI9R 1JJUB 4L3GD 4BL0A 4FA1D 3EI1A 4X60B 3V5WB 4EWRA 4L3HD 3UKRC 3BWSA 3MKSB 2I3SA 3DXMC 2UZXB 4U7AA 1N6EA 3I7NA 2AGZA 4A2MA 1NR0A 4JSXC 4ZN4A 2Z2NA 3OL2B 3PXTD 5I5MA 5I5JA 4GM9A 3L4MD 2PM6B 3JPXA 4CI3A 2O9KA 3EI4B 2OJYA 4JSNC 4H5IA 3EI1B 2I0RA 3IJCA 4O3TB 4ESGA 3JZGA 3V7DB 4K3JB 2PBIB 2Z2OA 3PSCB 3RFHA 2H6NA 3SFZA 2H9MA 4IMMA 1GP2B 1PI6A 2CE8A 4JT6C 4J8BA 2GNQA 1XHMA 5H1MA 4X61B 4FAVD 3UVOA 3EU7A 4J87A 1TYQC 2PM7B 5IJ7E 4GGCA 4A09A 4PNKB 3DSMA 4R7AB 2CO0C 1S4UX 3RSEC 2AGLA 2P9PC 3EI3B 5IGOA 1Q47A 4ERYA 1K8KC 4L1QD 3SVWD 1N6FA 5HE1B 4GM8A 4J81A 2H9PA 4CI1A 3OKWA 3OKTA 4E5ZB 4J0WA 5H17A 3IJ0A 5HE2B 3AL9A 3ZWLB 3NVNA 1N6DA 2BCJB 2J57G 4J77A 1JOFA 2IUVA 3RN1D 2CE9A 5THAA 4BUJC 5FKQA 3EWEA 4A7JA 4QQEA 5CXBA 3I89A 1PBYB 2QXVA 2PM9B 3PXSD 4H5JA 3OTTA 3ODTA 3MZLA 5CXCA 1OLZA 4O1QD 3NVQA 5TF2A 4KFMB 2P9LC 4CY3A 2HESX 3F3GA 3OL2A 3RN0D 4D6VA 2AGWA 4O9DA 4J84A 4PSXB 5C2WB 3P4FA 3C9CA 2H3XA 4O45A 3CIKB 5CXBB 5EM2B 2MTAH 3SCYA 3KRXB 3C5MA 5EARA 5KDOB 3JZNA 5TDHB 3OKYA 4CZYA 3DM0A 5HE3B 3KRWB 4ZOZA 3JROA 1U2VC 5CXCB 4E54B 4LG8A 3DWLC 3BG0A 1K32A 4FHLA 4X3EA 4CZXA 3RMZD 4NSXA 2J56H 3SBRA 5C2VB 3NVXA 3C99A 2HKRA 4D0KA 1L0QA 3PVWB 1P22A 3EI3A 3AL8B 4GM3A 4G56B 4XEIC 4Y7RA 4FAND 1QNIA 3U4YA 2AQ5A 3I7LA 4LGNA 3OKYB 2IUPA 4AOWA 2HKMA 2P9SC 2I0TA 4FB1D 4E5ZA 4ZOVA 2CO0A 2GC4A 2YNOA 3JB9L 3I7HA 4I79A 3VGZA 3PSLA 3UVMA 2BBKH 3JAMg 3MZKA 4GZ8A 2EBSA 4PXWA 3CFSB 3FRXA 3W15A 3IIWA 3V9FA 4J79A 4PC0A 4A08A 3EG6A 2Z2PA 2YNNA 3N0DA 4PBYA 1PGUA 4CY2A 3UKUC 3I7PA 4CY1A 4GQBB 5GXIA 1MDAH 4QT8A 3RFGA 3VH0A 4FA4D 2PM9A 5HYNB 2P9UC 3UR4A 2I3TA 2OVRB 3OW8A 5H14A 4PSWB 3SMRA 4CY5A 2HYEA 3L4OD 2H9NA 5IJ8E 2YBAA 2HXCA 4J73A 3PVUB 1SQJA 1FWXA 2IUQA 4A08B 4GQ2P 4X63B 5GXHA 3GREA 2I0SA 3J81g 5CYKA 1GXRA 4L9OA 5TEEA 5EM2A 3SHFA 2XU7A 3EI2A 3SLED 3EMHA 2H6KA 1U4CA 4GMBA 1RI6A 3SJLD 4E54A 4OWRA 2H9LA 4J0XA 4ES0A 4TZ4A 5EMKB 4CC9A 5EMLB 4JT5C 5EAPA 2H6QA 3DXKC 5AFU3 3BG1A 3SBQA 4JSPC 3A0FA 3SXTD 1MG2A 2OK4A 2CN3A 2CNXA 4GGAA 5CYKB 3RRMC 3AL8A 1XKSA 3MMYA 4ERQA 4A2LA 5EALA 3EI2B 5I5IA 3FGBA 3IKOA 3IJ1A 4CI8A 3I7OA 2XL2A 1B9YA 2H13A 2W18A 1SHYB 4O3UB 4IA9A 4Y5RD 4JSVC 5FXYA 4FA9D 5FQDA 3PXWD 4QL1A 3HFQA 4U1EI 3SWSD 4CI2A 4HDJA 2IWKA 5AMSA 4JXMA 4XYHA 5C9ZB 1GG2B 2YNPA 2OVPB 2UZYB 3AH8B 3UVKA 2OK6A 3ORVD 5FKTA 4BH6A 2P9KC 3UVLA 5IC7A 4K3ID 3J80g 5GSAA 2G99A 2AGXA 3N0EA 1MG3A 2IWFA 2TRCB 5A2Qg 2YB8B 2GC7A 4XYIA 1GOTB 2XYIA 4OZUA 2B4EA 2AH0A 3C75H 1ERJA 3FM0A 1JMXB 3MKQA 1TBGA 4CZVA 3CFVA 4PBZA 5FA5B 5K1CC 1VYHC 1JMZB 4GGDA 3GFCA 4YVDA 1SQ9A 2IURA 4GQ1A 2IAAA 4A0AA 2H14A 5K19A 2P9IC 3PE7A 3JRPA 5HQGA 3IIYA 5B4WA 2B5NA 3VA6A 2B5LA 4A11A 2J55H 1XIPA 5FKSA 4A0BA 4J86A 4Z8LA 4ZOYA 4ZOXA 3I8EA 2XL3A 5FKRA 2H68A 3SN6B 4LG9A 5GMKn 1YFQA 3I8CA 4J8GA 4A0AB 5HE0B 5SXMA 5AJAA 3AFCA 2AH1A 3UVNA 4N14A 4A09B 4QRJA 3E0CA 4MK0B 2HJ4A 2H47A 4A11B 2QC5A 3RLMD 4A0BB 1PEVA 3SBPA 5FLXg 2AGYA 4J82A 2YMUA 1A0RB 2HJBA 2OIZA 3F3FA 3F3PA 5IT9g 2OVQB 1R5MA 3MXXA 3ULEC 3K27A 1B9XA 1NEXB 2Q7QA 3K26A 5EMJB 3I7KA 5EMMB 5IGQA 2B5MA 5EAMA 3JZHA 5TEFA 4ERZA 3B7FA 4FA5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9N C;  3I2N A;  4J78 A;  1OMW B;  4AEZ A;  2CN2 A;  4FWW A;  3EI4 A;  4JD2 C;  5JWZ A;  2G9A A;  4UI9 R;  1JJU B;  4L3G D;  4BL0 A;  4FA1 D;  3EI1 A;  4X60 B;  3V5W B;  4EWR A;  4L3H D;  3UKR C;  3BWS A;  3MKS B;  2I3S A;  3DXM C;  2UZX B;  4U7A A;  1N6E A;  3I7N A;  2AGZ A;  4A2M A;  1NR0 A;  4JSX C;  4ZN4 A;  2Z2N A;  3OL2 B;  3PXT D;  5I5M A;  5I5J A;  4GM9 A;  3L4M D;  2PM6 B;  3JPX A;  4CI3 A;  2O9K A;  3EI4 B;  2OJY A;  4JSN C;  4H5I A;  3EI1 B;  2I0R A;  3IJC A;  4O3T B;  4ESG A;  3JZG A;  3V7D B;  4K3J B;  2PBI B;  2Z2O A;  3PSC B;  3RFH A;  2H6N A;  3SFZ A;  2H9M A;  4IMM A;  1GP2 B;  1PI6 A;  2CE8 A;  4JT6 C;  4J8B A;  2GNQ A;  1XHM A;  5H1M A;  4X61 B;  4FAV D;  3UVO A;  3EU7 A;  4J87 A;  1TYQ C;  2PM7 B;  5IJ7 E;  4GGC A;  4A09 A;  4PNK B;  3DSM A;  4R7A B;  2CO0 C;  1S4U X;  3RSE C;  2AGL A;  2P9P C;  3EI3 B;  5IGO A;  1Q47 A;  4ERY A;  1K8K C;  4L1Q D;  3SVW D;  1N6F A;  5HE1 B;  4GM8 A;  4J81 A;  2H9P A;  4CI1 A;  3OKW A;  3OKT A;  4E5Z B;  4J0W A;  5H17 A;  3IJ0 A;  5HE2 B;  3AL9 A;  3ZWL B;  3NVN A;  1N6D A;  2BCJ B;  2J57 G;  4J77 A;  1JOF A;  2IUV A;  3RN1 D;  2CE9 A;  5THA A;  4BUJ C;  5FKQ A;  3EWE A;  4A7J A;  4QQE A;  5CXB A;  3I89 A;  1PBY B;  2QXV A;  2PM9 B;  3PXS D;  4H5J A;  3OTT A;  3ODT A;  3MZL A;  5CXC A;  1OLZ A;  4O1Q D;  3NVQ A;  5TF2 A;  4KFM B;  2P9L C;  4CY3 A;  2HES X;  3F3G A;  3OL2 A;  3RN0 D;  4D6V A;  2AGW A;  4O9D A;  4J84 A;  4PSX B;  5C2W B;  3P4F A;  3C9C A;  2H3X A;  4O45 A;  3CIK B;  5CXB B;  5EM2 B;  2MTA H;  3SCY A;  3KRX B;  3C5M A;  5EAR A;  5KDO B;  3JZN A;  5TDH B;  3OKY A;  4CZY A;  3DM0 A;  5HE3 B;  3KRW B;  4ZOZ A;  3JRO A;  1U2V C;  5CXC B;  4E54 B;  4LG8 A;  3DWL C;  3BG0 A;  1K32 A;  4FHL A;  4X3E A;  4CZX A;  3RMZ D;  4NSX A;  2J56 H;  3SBR A;  5C2V B;  3NVX A;  3C99 A;  2HKR A;  4D0K A;  1L0Q A;  3PVW B;  1P22 A;  3EI3 A;  3AL8 B;  4GM3 A;  4G56 B;  4XEI C;  4Y7R A;  4FAN D;  1QNI A;  3U4Y A;  2AQ5 A;  3I7L A;  4LGN A;  3OKY B;  2IUP A;  4AOW A;  2HKM A;  2P9S C;  2I0T A;  4FB1 D;  4E5Z A;  4ZOV A;  2CO0 A;  2GC4 A;  2YNO A;  3JB9 L;  3I7H A;  4I79 A;  3VGZ A;  3PSL A;  3UVM A;  2BBK H;  3JAM g;  3MZK A;  4GZ8 A;  2EBS A;  4PXW A;  3CFS B;  3FRX A;  3W15 A;  3IIW A;  3V9F A;  4J79 A;  4PC0 A;  4A08 A;  3EG6 A;  2Z2P A;  2YNN A;  3N0D A;  4PBY A;  1PGU A;  4CY2 A;  3UKU C;  3I7P A;  4CY1 A;  4GQB B;  5GXI A;  1MDA H;  4QT8 A;  3RFG A;  3VH0 A;  4FA4 D;  2PM9 A;  5HYN B;  2P9U C;  3UR4 A;  2I3T A;  2OVR B;  3OW8 A;  5H14 A;  4PSW B;  3SMR A;  4CY5 A;  2HYE A;  3L4O D;  2H9N A;  5IJ8 E;  2YBA A;  2HXC A;  4J73 A;  3PVU B;  1SQJ A;  1FWX A;  2IUQ A;  4A08 B;  4GQ2 P;  4X63 B;  5GXH A;  3GRE A;  2I0S A;  3J81 g;  5CYK A;  1GXR A;  4L9O A;  5TEE A;  5EM2 A;  3SHF A;  2XU7 A;  3EI2 A;  3SLE D;  3EMH A;  2H6K A;  1U4C A;  4GMB A;  1RI6 A;  3SJL D;  4E54 A;  4OWR A;  2H9L A;  4J0X A;  4ES0 A;  4TZ4 A;  5EMK B;  4CC9 A;  5EML B;  4JT5 C;  5EAP A;  2H6Q A;  3DXK C;  5AFU 3;  3BG1 A;  3SBQ A;  4JSP C;  3A0F A;  3SXT D;  1MG2 A;  2OK4 A;  2CN3 A;  2CNX A;  4GGA A;  5CYK B;  3RRM C;  3AL8 A;  1XKS A;  3MMY A;  4ERQ A;  4A2L A;  5EAL A;  3EI2 B;  5I5I A;  3FGB A;  3IKO A;  3IJ1 A;  4CI8 A;  3I7O A;  2XL2 A;  1B9Y A;  2H13 A;  2W18 A;  1SHY B;  4O3U B;  4IA9 A;  4Y5R D;  4JSV C;  5FXY A;  4FA9 D;  5FQD A;  3PXW D;  4QL1 A;  3HFQ A;  4U1E I;  3SWS D;  4CI2 A;  4HDJ A;  2IWK A;  5AMS A;  4JXM A;  4XYH A;  5C9Z B;  1GG2 B;  2YNP A;  2OVP B;  2UZY B;  3AH8 B;  3UVK A;  2OK6 A;  3ORV D;  5FKT A;  4BH6 A;  2P9K C;  3UVL A;  5IC7 A;  4K3I D;  3J80 g;  5GSA A;  2G99 A;  2AGX A;  3N0E A;  1MG3 A;  2IWF A;  2TRC B;  5A2Q g;  2YB8 B;  2GC7 A;  4XYI A;  1GOT B;  2XYI A;  4OZU A;  2B4E A;  2AH0 A;  3C75 H;  1ERJ A;  3FM0 A;  1JMX B;  3MKQ A;  1TBG A;  4CZV A;  3CFV A;  4PBZ A;  5FA5 B;  5K1C C;  1VYH C;  1JMZ B;  4GGD A;  3GFC A;  4YVD A;  1SQ9 A;  2IUR A;  4GQ1 A;  2IAA A;  4A0A A;  2H14 A;  5K19 A;  2P9I C;  3PE7 A;  3JRP A;  5HQG A;  3IIY A;  5B4W A;  2B5N A;  3VA6 A;  2B5L A;  4A11 A;  2J55 H;  1XIP A;  5FKS A;  4A0B A;  4J86 A;  4Z8L A;  4ZOY A;  4ZOX A;  3I8E A;  2XL3 A;  5FKR A;  2H68 A;  3SN6 B;  4LG9 A;  5GMK n;  1YFQ A;  3I8C A;  4J8G A;  4A0A B;  5HE0 B;  5SXM A;  5AJA A;  3AFC A;  2AH1 A;  3UVN A;  4N14 A;  4A09 B;  4QRJ A;  3E0C A;  4MK0 B;  2HJ4 A;  2H47 A;  4A11 B;  2QC5 A;  3RLM D;  4A0B B;  1PEV A;  3SBP A;  5FLX g;  2AGY A;  4J82 A;  2YMU A;  1A0R B;  2HJB A;  2OIZ A;  3F3F A;  3F3P A;  5IT9 g;  2OVQ B;  1R5M A;  3MXX A;  3ULE C;  3K27 A;  1B9X A;  1NEX B;  2Q7Q A;  3K26 A;  5EMJ B;  3I7K A;  5EMM B;  5IGQ A;  2B5M A;  5EAM A;  3JZH A;  5TEF A;  4ERZ A;  3B7F A;  4FA5 D; 
#chains in the Genus database with same CATH topology
 2P9N C;  3I2N A;  3EQ7 A;  4J78 A;  1OMW B;  4AEZ A;  2CN2 A;  4FWW A;  3EI4 A;  4JD2 C;  5JWZ A;  2G9A A;  4UI9 R;  1JJU B;  4L3G D;  3ZDZ A;  4BL0 A;  4FA1 D;  3EI1 A;  4X60 B;  3V5W B;  4EWR A;  4L3H D;  3UKR C;  1GOH A;  3BWS A;  3MKS B;  2I3S A;  3DXM C;  2UZX B;  4U7A A;  1N6E A;  3I7N A;  1H2X A;  3IUJ A;  2AGZ A;  5E6U A;  4A2M A;  1NR0 A;  4JSX C;  4ZN4 A;  2Z2N A;  1VE7 A;  3OL2 B;  1E8M A;  1H2Z A;  3PXT D;  2VDR A;  5I5M A;  5M5V A;  5I5J A;  5M5T A;  4GM9 A;  3L4M D;  2PM6 B;  3JPX A;  4RE5 A;  4CI3 A;  2O9K A;  3V4V A;  3EI4 B;  2OJY A;  4JSN C;  4H5I A;  5HDB A;  3EI1 B;  2I0R A;  3V4P A;  4IRZ A;  4DNV A;  2QZP A;  3IJC A;  4O3T B;  4ESG A;  3JZG A;  3V7D B;  4K3J B;  3FCU A;  2PBI B;  2Z2O A;  3PSC B;  4WK2 A;  2HU5 A;  3RFH A;  2H6N A;  3SFZ A;  2H9M A;  4IMM A;  4BCC A;  1GP2 B;  1PI6 A;  2CE8 A;  4JT6 C;  4J8B A;  2GNQ A;  1XHM A;  5H1M A;  4X61 B;  4FAV D;  3UVO A;  3EU7 A;  4J87 A;  1TYQ C;  2PM7 B;  5IJ7 E;  4GGC A;  4O02 A;  4A09 A;  4PNK B;  3DSM A;  4R7A B;  2CO0 C;  1E5T A;  1S4U X;  4MMX A;  3RSE C;  2AGL A;  2P9P C;  3EI3 B;  5IGO A;  1BPO A;  1O6G A;  1Q47 A;  4ERY A;  1K8K C;  4L1Q D;  3SVW D;  1H2W A;  1N6F A;  5HE1 B;  4GM8 A;  4J81 A;  2H9P A;  4NAA A;  4CI1 A;  3OKW A;  3OKT A;  4E5Z B;  2XZG A;  4J0W A;  3O4J A;  5H17 A;  2VDP A;  3IUM A;  3IJ0 A;  4G1E A;  5HE2 B;  3ZE0 A;  3AL9 A;  3ZWL B;  3NVN A;  1N6D A;  2BCJ B;  2J57 G;  4J77 A;  2XDW A;  1JOF A;  3MVD K;  2IUV A;  3RN1 D;  2CE9 A;  2VC2 A;  5E6S A;  5THA A;  4BUJ C;  5FKQ A;  3ZE2 A;  3EWE A;  4A7J A;  4QQE A;  2EIE A;  5CXB A;  2VDO A;  3I89 A;  1PBY B;  2QXV A;  4JHN A;  2PM9 B;  3PXS D;  4H5J A;  1A12 A;  3OTT A;  3ODT A;  3MZL A;  5CXC A;  1C9I A;  1OLZ A;  4O1Q D;  3NVQ A;  5TF2 A;  4KFM B;  2P9L C;  4CY3 A;  3QI0 A;  2HES X;  3F3G A;  3OL2 A;  2VDL A;  3RN0 D;  4D6V A;  4G55 A;  2AGW A;  4O9D A;  1UOQ A;  4NEN A;  4J84 A;  4PSX B;  5C2W B;  3P4F A;  3C9C A;  2H3X A;  3QHY B;  4O45 A;  2BKL A;  3CIK B;  5CXB B;  5EM2 B;  2MTA H;  3SCY A;  3KRX B;  3C5M A;  5EAR A;  5KDO B;  3JZN A;  5TDH B;  3OKY A;  4CZY A;  3DM0 A;  2EIB A;  1GOG A;  5HE3 B;  3KRW B;  4DNW A;  3ZDX A;  4ZOZ A;  3JRO A;  1U2V C;  5CXC B;  4E54 B;  1VE6 A;  4LG8 A;  3DWL C;  3BG0 A;  1K32 A;  4FHL A;  4X3E A;  4CZX A;  3RMZ D;  4NSX A;  5M5R A;  2J56 H;  4JHP C;  3DDU A;  3SBR A;  1JTD B;  5C2V B;  3IJE A;  3NVX A;  3K6S A;  3C99 A;  2HKR A;  2VDM A;  1L0Q A;  4D0K A;  3PVW B;  1TYE A;  1P22 A;  4WK0 A;  3EI3 A;  3AL8 B;  3IUQ A;  4G56 B;  4GM3 A;  4XEI C;  4Y7R A;  4FAN D;  1QNI A;  3U4Y A;  2AQ5 A;  3I7L A;  4LGN A;  3GC3 B;  3OKY B;  2IUP A;  4AOW A;  1O6F A;  2HKM A;  2P9S C;  2I0T A;  4FB1 D;  4AMY A;  4E5Z A;  4ZOV A;  1T2X A;  2CO0 A;  2GC4 A;  2YNO A;  3T3P A;  3JB9 L;  3I7H A;  4I79 A;  3VGZ A;  3PSL A;  3UVM A;  5FFO A;  5C86 A;  2BBK H;  4UM8 A;  3JAM g;  3MZK A;  4GZ8 A;  2EBS A;  4PXW A;  1QFM A;  3CFS B;  3FRX A;  4Z7O A;  3W15 A;  2HU7 A;  3IIW A;  2WQ8 A;  3V9F A;  4J79 A;  4PC0 A;  4BCB A;  4A08 A;  3EG6 A;  2Z2P A;  2YNN A;  3N0D A;  4PBY A;  1PGU A;  4CY2 A;  4Z7N A;  3UKU C;  3I7P A;  4G1M A;  3VI4 A;  4CY1 A;  4GQB B;  5C92 A;  5GXI A;  1MDA H;  4QT8 A;  3RFG A;  3ZE1 A;  3IUL A;  3VH0 A;  4FA4 D;  2PM9 A;  1I2M B;  1L5G A;  5HYN B;  2EIC A;  2P9U C;  3UR4 A;  2I3T A;  2OVR B;  3OW8 A;  5H14 A;  4PSW B;  3SMR A;  2JKX A;  4CY5 A;  4Z7Q A;  2HYE A;  3L4O D;  2H9N A;  5IJ8 E;  2YBA A;  2HXC A;  4J73 A;  4RE6 A;  3PVU B;  1SQJ A;  4WK4 A;  4L1M A;  1FWX A;  2IUQ A;  4AX4 A;  4GQ2 P;  4X63 B;  4A08 B;  4DNU A;  5GXH A;  2QR5 A;  2I0S A;  3GRE A;  3J81 g;  5CYK A;  1GXR A;  4L9O A;  2VDN A;  5TEE A;  5EM2 A;  3SHF A;  2XU7 A;  3EI2 A;  3SLE D;  3EMH A;  2H6K A;  1U4C A;  4GMB A;  2HU8 A;  1RI6 A;  3SJL D;  3K71 A;  1M1X A;  4E54 A;  4OWR A;  2H9L A;  4J0X A;  4ES0 A;  4TZ4 A;  5EMK B;  3K72 A;  4CC9 A;  5EML B;  4JT5 C;  5E6R A;  5EAP A;  2H6Q A;  3DXK C;  4NBM A;  5AFU 3;  3BG1 A;  3SBQ A;  4JSP C;  3A0F A;  3SXT D;  4AMZ A;  1MG2 A;  5FFG A;  3NIG A;  2OK4 A;  2CN3 A;  2CNX A;  1VZ3 A;  4GGA A;  5CYK B;  2VZ3 A;  2VDQ A;  4D9S A;  3RRM C;  3AL8 A;  1XKS A;  3MMY A;  4ERQ A;  4A2L A;  5EAL A;  3EI2 B;  5I5I A;  3FGB A;  3IKO A;  4O2W A;  3IJ1 A;  4CI8 A;  3OF7 A;  3I7O A;  2XL2 A;  1B9Y A;  2H13 A;  2W18 A;  1SHY B;  4AN1 A;  4O3U B;  4IA9 A;  4Y5R D;  4JSV C;  5FXY A;  4FA9 D;  5FQD A;  3PXW D;  4QL1 A;  3HFQ A;  1QFS A;  4U1E I;  3SWS D;  4CI2 A;  4HDJ A;  2IWK A;  5AMS A;  4JXM A;  4XYH A;  5C9Z B;  1GG2 B;  2YNP A;  2OVP B;  2UZY B;  1U8C A;  3AH8 B;  3UVK A;  2OK6 A;  3ORV D;  5FKT A;  4BH6 A;  4WJK A;  2P9K C;  3UVL A;  5IC7 A;  4K3I D;  1K3I A;  4MMZ A;  3J80 g;  5GSA A;  2G99 A;  2AGX A;  3N0E A;  1MG3 A;  2EID A;  2IWF A;  2TRC B;  4MMY A;  5A2Q g;  2XE4 A;  2YB8 B;  2GC7 A;  3O4I A;  4XYI A;  1GOT B;  3IUN A;  3T3M A;  4BP8 A;  2XYI A;  3EQ8 A;  4OZU A;  4AN0 A;  2B4E A;  3KCI A;  2AH0 A;  3C75 H;  5M5U A;  1ERJ A;  3FM0 A;  1JMX B;  3MKQ A;  1TBG A;  1GOF A;  4CZV A;  3CFV A;  4PBZ A;  5FA5 B;  5K1C C;  1VYH C;  1YR2 A;  3NIF A;  4UM9 A;  4NC4 A;  1JMZ B;  4GGD A;  4QAM A;  3GFC A;  4YVD A;  1SQ9 A;  2IUR A;  1JV2 A;  1VZ2 A;  2IAA A;  3MUO A;  4GQ1 A;  4A0A A;  2H14 A;  1UTC A;  3EQ9 A;  1E8N A;  5K19 A;  2P9I C;  3PE7 A;  1C9L A;  3JRP A;  5HQG A;  3IIY A;  3VI3 A;  5B4W A;  3GD1 I;  3NID A;  2B5N A;  3VA6 A;  2B5L A;  4A11 A;  2J55 H;  1XIP A;  5FKS A;  4A0B A;  4J86 A;  4Z8L A;  4ZOY A;  4BP9 A;  4ZOX A;  3I8E A;  2XL3 A;  5FKR A;  2H68 A;  3SN6 B;  4LG9 A;  5GMK n;  3MUN A;  1YFQ A;  3I8C A;  2VDK A;  4J8G A;  4A0A B;  5HE0 B;  5SXM A;  5AJA A;  3AFC A;  2AH1 A;  3UVN A;  4N14 A;  4A09 B;  4QRJ A;  3E0C A;  4MK0 B;  2HJ4 A;  2H47 A;  4A11 B;  2QC5 A;  3RLM D;  4A0B B;  1PEV A;  3SBP A;  5FLX g;  2AGY A;  4J82 A;  2YMU A;  1A0R B;  2HJB A;  2OIZ A;  3ZDY A;  3F3F A;  3F3P A;  5IT9 g;  5M61 A;  2OVQ B;  1R5M A;  3MXX A;  3ULE C;  3K27 A;  1B9X A;  1NEX B;  2Q7Q A;  3K26 A;  5EMJ B;  4FA5 D;  1UOO A;  3IUR A;  3I7K A;  1H2Y A;  2VZ1 A;  5M5S A;  5EMM B;  3FCS A;  5IGQ A;  2B5M A;  3O4H A;  3JZH A;  3O4G A;  1UOP A;  5EAM A;  5TEF A;  4BCD A;  4ERZ A;  3B7F A;  3IVM A; 
#chains in the Genus database with same CATH homology
 2P9N C;  3I2N A;  4J78 A;  1OMW B;  4AEZ A;  2CN2 A;  4FWW A;  3EI4 A;  4JD2 C;  5JWZ A;  2G9A A;  4UI9 R;  1JJU B;  4L3G D;  4BL0 A;  4FA1 D;  3EI1 A;  4X60 B;  3V5W B;  4EWR A;  4L3H D;  3UKR C;  3BWS A;  3MKS B;  2I3S A;  3DXM C;  2UZX B;  4U7A A;  1N6E A;  3I7N A;  2AGZ A;  4A2M A;  1NR0 A;  4JSX C;  4ZN4 A;  2Z2N A;  3OL2 B;  3PXT D;  5I5M A;  5I5J A;  4GM9 A;  3L4M D;  2PM6 B;  3JPX A;  4CI3 A;  2O9K A;  3EI4 B;  2OJY A;  4JSN C;  4H5I A;  3EI1 B;  2I0R A;  3IJC A;  4O3T B;  4ESG A;  3JZG A;  3V7D B;  4K3J B;  2PBI B;  2Z2O A;  3PSC B;  3RFH A;  2H6N A;  3SFZ A;  2H9M A;  4IMM A;  1GP2 B;  1PI6 A;  2CE8 A;  4JT6 C;  4J8B A;  2GNQ A;  1XHM A;  5H1M A;  4X61 B;  4FAV D;  3UVO A;  3EU7 A;  4J87 A;  1TYQ C;  2PM7 B;  5IJ7 E;  4GGC A;  4A09 A;  4PNK B;  3DSM A;  4R7A B;  2CO0 C;  1S4U X;  3RSE C;  2AGL A;  2P9P C;  3EI3 B;  5IGO A;  1Q47 A;  4ERY A;  1K8K C;  4L1Q D;  3SVW D;  1N6F A;  5HE1 B;  4GM8 A;  4J81 A;  2H9P A;  4CI1 A;  3OKW A;  3OKT A;  4E5Z B;  4J0W A;  5H17 A;  3IJ0 A;  5HE2 B;  3AL9 A;  3ZWL B;  3NVN A;  1N6D A;  2BCJ B;  2J57 G;  4J77 A;  1JOF A;  2IUV A;  3RN1 D;  2CE9 A;  5THA A;  4BUJ C;  5FKQ A;  3EWE A;  4A7J A;  4QQE A;  5CXB A;  3I89 A;  1PBY B;  2QXV A;  2PM9 B;  3PXS D;  4H5J A;  3OTT A;  3ODT A;  3MZL A;  5CXC A;  1OLZ A;  4O1Q D;  3NVQ A;  5TF2 A;  4KFM B;  2P9L C;  4CY3 A;  2HES X;  3F3G A;  3OL2 A;  3RN0 D;  4D6V A;  2AGW A;  4O9D A;  4J84 A;  4PSX B;  5C2W B;  3P4F A;  3C9C A;  2H3X A;  4O45 A;  3CIK B;  5CXB B;  5EM2 B;  2MTA H;  3SCY A;  3KRX B;  3C5M A;  5EAR A;  5KDO B;  3JZN A;  5TDH B;  3OKY A;  4CZY A;  3DM0 A;  5HE3 B;  3KRW B;  4ZOZ A;  3JRO A;  1U2V C;  5CXC B;  4E54 B;  4LG8 A;  3DWL C;  3BG0 A;  1K32 A;  4FHL A;  4X3E A;  4CZX A;  3RMZ D;  4NSX A;  2J56 H;  3SBR A;  5C2V B;  3NVX A;  3C99 A;  2HKR A;  4D0K A;  1L0Q A;  3PVW B;  1P22 A;  3EI3 A;  3AL8 B;  4GM3 A;  4G56 B;  4XEI C;  4Y7R A;  4FAN D;  1QNI A;  3U4Y A;  2AQ5 A;  3I7L A;  4LGN A;  3OKY B;  2IUP A;  4AOW A;  2HKM A;  2P9S C;  2I0T A;  4FB1 D;  4E5Z A;  4ZOV A;  2CO0 A;  2GC4 A;  2YNO A;  3JB9 L;  3I7H A;  4I79 A;  3VGZ A;  3PSL A;  3UVM A;  2BBK H;  3JAM g;  3MZK A;  4GZ8 A;  2EBS A;  4PXW A;  3CFS B;  3FRX A;  3W15 A;  3IIW A;  3V9F A;  4J79 A;  4PC0 A;  4A08 A;  3EG6 A;  2Z2P A;  2YNN A;  3N0D A;  4PBY A;  1PGU A;  4CY2 A;  3UKU C;  3I7P A;  4CY1 A;  4GQB B;  5GXI A;  1MDA H;  4QT8 A;  3RFG A;  3VH0 A;  4FA4 D;  2PM9 A;  5HYN B;  2P9U C;  3UR4 A;  2I3T A;  2OVR B;  3OW8 A;  5H14 A;  4PSW B;  3SMR A;  4CY5 A;  2HYE A;  3L4O D;  2H9N A;  5IJ8 E;  2YBA A;  2HXC A;  4J73 A;  3PVU B;  1SQJ A;  1FWX A;  2IUQ A;  4A08 B;  4GQ2 P;  4X63 B;  5GXH A;  3GRE A;  2I0S A;  3J81 g;  5CYK A;  1GXR A;  4L9O A;  5TEE A;  5EM2 A;  3SHF A;  2XU7 A;  3EI2 A;  3SLE D;  3EMH A;  2H6K A;  1U4C A;  4GMB A;  1RI6 A;  3SJL D;  4E54 A;  4OWR A;  2H9L A;  4J0X A;  4ES0 A;  4TZ4 A;  5EMK B;  4CC9 A;  5EML B;  4JT5 C;  5EAP A;  2H6Q A;  3DXK C;  5AFU 3;  3BG1 A;  3SBQ A;  4JSP C;  3A0F A;  3SXT D;  1MG2 A;  2OK4 A;  2CN3 A;  2CNX A;  4GGA A;  5CYK B;  3RRM C;  3AL8 A;  1XKS A;  3MMY A;  4ERQ A;  4A2L A;  5EAL A;  3EI2 B;  5I5I A;  3FGB A;  3IKO A;  3IJ1 A;  4CI8 A;  3I7O A;  2XL2 A;  1B9Y A;  2H13 A;  2W18 A;  1SHY B;  4O3U B;  4IA9 A;  4Y5R D;  4JSV C;  5FXY A;  4FA9 D;  5FQD A;  3PXW D;  4QL1 A;  3HFQ A;  4U1E I;  3SWS D;  4CI2 A;  4HDJ A;  2IWK A;  5AMS A;  4JXM A;  4XYH A;  5C9Z B;  1GG2 B;  2YNP A;  2OVP B;  2UZY B;  3AH8 B;  3UVK A;  2OK6 A;  3ORV D;  5FKT A;  4BH6 A;  2P9K C;  3UVL A;  5IC7 A;  4K3I D;  3J80 g;  5GSA A;  2G99 A;  2AGX A;  3N0E A;  1MG3 A;  2IWF A;  2TRC B;  5A2Q g;  2YB8 B;  2GC7 A;  4XYI A;  1GOT B;  2XYI A;  4OZU A;  2B4E A;  2AH0 A;  3C75 H;  1ERJ A;  3FM0 A;  1JMX B;  3MKQ A;  1TBG A;  4CZV A;  3CFV A;  4PBZ A;  5FA5 B;  5K1C C;  1VYH C;  1JMZ B;  4GGD A;  3GFC A;  4YVD A;  1SQ9 A;  2IUR A;  4GQ1 A;  2IAA A;  4A0A A;  2H14 A;  5K19 A;  2P9I C;  3PE7 A;  3JRP A;  5HQG A;  3IIY A;  5B4W A;  2B5N A;  3VA6 A;  2B5L A;  4A11 A;  2J55 H;  1XIP A;  5FKS A;  4A0B A;  4J86 A;  4Z8L A;  4ZOY A;  4ZOX A;  3I8E A;  2XL3 A;  5FKR A;  2H68 A;  3SN6 B;  4LG9 A;  5GMK n;  1YFQ A;  3I8C A;  4J8G A;  4A0A B;  5HE0 B;  5SXM A;  5AJA A;  3AFC A;  2AH1 A;  3UVN A;  4N14 A;  4A09 B;  4QRJ A;  3E0C A;  4MK0 B;  2HJ4 A;  2H47 A;  4A11 B;  2QC5 A;  3RLM D;  4A0B B;  1PEV A;  3SBP A;  5FLX g;  2AGY A;  4J82 A;  2YMU A;  1A0R B;  2HJB A;  2OIZ A;  3F3F A;  3F3P A;  5IT9 g;  2OVQ B;  1R5M A;  3MXX A;  3ULE C;  3K27 A;  1B9X A;  1NEX B;  2Q7Q A;  3K26 A;  5EMJ B;  3I7K A;  5EMM B;  5IGQ A;  2B5M A;  5EAM A;  3JZH A;  5TEF A;  4ERZ A;  3B7F A;  4FA5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...