2GC4A

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
382
structure length
382
Chain Sequence
b'EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 93
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gc4A00
3AL8B 4IA9A 4XYIA 4FB1D 3OTTA 5CXCA 4Y5RD 3A0FA 2YBAA 5I5JA 2H6KA 2YNPA 3OKWA 2B5LA 1U4CA 4PSWB 5K19A 4J73A 3JPXA 4HDJA 4J84A 2P9NC 4D0KA 4CI3A 5CYKB 5TDHB 4J8BA 4N14A 2HKRA 2XU7A 3EI1B 3EI3B 3J80g 5THAA 3IJCA 4L9OA 3OKYB 5I5MA 4FA4D 4H5IA 2HKMA 2I3SA 4G56B 4O45A 4BUJC 3L4OD 4E5ZA 5EMKB 4FA9D 3EI2A 1SQJA 2H6NA 5EARA 4CC9A 4U7AA 4J0WA 3I8CA 5FQDA 3ULEC 3UKRC 1XIPA 5CXBB 5TF2A 4KFMB 4O1QD 1A0RB 3OW8A 4QRJA 3SXTD 4E5ZB 3BWSA 3EI2B 3JB9L 4IMMA 4R7AB 2J55H 5GMKn 4JD2C 3DSMA 5IJ8E 1QNIA 3CFVA 3RN0D 3J81g 2PM6B 2YNOA 3EU7A 2HESX 4J79A 4ZOXA 1GOTB 5H14A 3CFSB 4ZOZA 4FAVD 5HYNB 3F3PA 4O9DA 1TYQC 1PGUA 2OIZA 4ERQA 1XHMA 4CZXA 2CN3A 4CI8A 1S4UX 1ERJA 4J86A 4QT8A 3SBPA 5KDOB 2O9KA 4JSXC 4FWWA 3V9FA 4A09B 3GFCA 2P9KC 3I2NA 3VA6A 5C2VB 4K3ID 4FAND 3SVWD 1XKSA 4OZUA 5TEFA 2AQ5A 3JROA 4A11B 2HYEA 4LGNA 5AMSA 3JZHA 5HQGA 3W15A 2I0SA 1B9YA 3C9CA 3IJ0A 1MG3A 3NVNA 2XL2A 2TRCB 2CO0A 2G9AA 2PM9A 4GGCA 4J77A 3I8EA 5IT9g 3RFGA 4E54B 5EMMB 2J56H 4A0BA 4GQ2P 2B4EA 2OJYA 3I89A 4JSPC 4O3TB 5GSAA 5IGOA 3PVUB 3MKQA 2HXCA 4ERYA 3AH8B 3MKSB 3MZKA 2H6QA 3KRXB 2P9LC 3IIWA 3EI4B 2H3XA 3PE7A 3SN6B 4J82A 3F3GA 2HJBA 3CIKB 2OK4A 2Z2NA 3P4FA 2CNXA 2PBIB 4XEIC 4GGAA 5CXCB 2P9IC 4JT6C 4NSXA 5FKQA 3JZNA 1TBGA 2PM7B 4LG9A 2MTAH 1PI6A 3DWLC 2QC5A 3SJLD 2H68A 1NEXB 4LG8A 3UVKA 4Z8LA 4O3UB 3OL2A 4JXMA 3AFCA 3C5MA 4ESGA 2GC7A 2P9SC 3RFHA 3SWSD 5C9ZB 3IKOA 1GP2B 1N6DA 5C2WB 5AJAA 3SBQA 2B5MA 1OLZA 4CY1A 1PEVA 1OMWB 3RLMD 3VH0A 4J81A 1SHYB 5EM2A 5AFU3 1K8KC 4BH6A 2EBSA 3DXMC 2H9NA 3OKTA 5B4WA 3PXTD 2XYIA 3PXSD 3UVLA 3FRXA 2AH0A 2AGZA 4CZVA 1GXRA 3NVQA 5EAPA 3SCYA 4J8GA 2UZXB 4U1EI 4GM9A 3IIYA 4MK0B 2OK6A 4A08A 3MMYA 3FGBA 2QXVA 2I3TA 2IURA 4BL0A 3V5WB 3I7PA 3AL9A 4L3HD 4X60B 3RMZD 2H13A 2GNQA 3EMHA 5HE3B 5FLXg 4JT5C 2OVQB 2H47A 4Y7RA 5FA5B 1N6EA 4GZ8A 2BBKH 2H9PA 2P9PC 3I7HA 4ZOVA 3I7NA 2CE8A 4J78A 4EWRA 2H9MA 1VYHC 4JSNC 2B5NA 1JMXB 4UI9R 3VGZA 3KRWB 4A2MA 4A0AA 5H1MA 4ZN4A 2AGWA 5IJ7E 3SBRA 3AL8A 1MG2A 4YVDA 2I0RA 5H17A 5GXHA 3U4YA 2PM9B 2AGYA 3JAMg 1JOFA 5IC7A 4GMBA 1JJUB 4CI1A 4PBZA 4A0BB 4L1QD 2XL3A 4PXWA 4QQEA 3EG6A 5CYKA 3PVWB 4GGDA 4X61B 3EI1A 5TEEA 1K32A 3EI3A 2BCJB 2AGLA 3V7DB 1B9XA 3OKYA 5FKRA 1Q47A 2AGXA 4PNKB 1JMZB 2YB8B 4AOWA 3BG1A 4FHLA 3SMRA 4QL1A 2Z2PA 3FM0A 4PC0A 5FKTA 2HJ4A 1MDAH 4GQBB 5CXBA 4CI2A 2J57G 3BG0A 4CY2A 3I7KA 4PBYA 5EMLB 3UR4A 2UZYB 4K3JB 1U2VC 2IUPA 1P22A 1PBYB 2AH1A 3JZGA 3I7OA 4PSXB 3C99A 5HE0B 3OL2B 3PSLA 2IWFA 3SHFA 4TZ4A 1YFQA 4A7JA 3PXWD 3IJ1A 2G99A 2YMUA 1GG2B 3ORVD 1SQ9A 4GM3A 4X63B 3MXXA 3I7LA 2W18A 5EM2B 3L4MD 4CY3A 4GQ1A 4ERZA 5EALA 3PSCB 2H9LA 5SXMA 3E0CA 4A09A 2CO0C 5A2Qg 4J0XA 3UKUC 4ES0A 3C75H 5HE1B 4A2LA 4I79A 4CY5A 4AEZA 3RRMC 2CN2A 4CZYA 3RN1D 3ZWLB 4A11A 5GXIA 2P9UC 3UVNA 5IGQA 5K1CC 5EMJB 2GC4A 2IAAA 3K26A 2IUVA 4A08B 3GREA 4FA5D 2OVPB 3DM0A 4L3GD 2IWKA 2Q7QA 1FWXA 1NR0A 1L0QA 3DXKC 4GM8A 2I0TA 3F3FA 4E54A 3ODTA 4J87A 4X3EA 1R5MA 2H14A 5FXYA 3K27A 3UVOA 4OWRA 4D6VA 2OVRB 2IUQA 4ZOYA 5JWZA 3NVXA 2YNNA 3MZLA 4XYHA 3JRPA 3B7FA 3N0EA 3SFZA 3HFQA 1N6FA 4FA1D 2Z2OA 3EI4A 4JSVC 5FKSA 1RI6A 3RSEC 5I5IA 5EAMA 3EWEA 4A0AB 3N0DA 3SLED 3UVMA 5HE2B 2CE9A 4H5JA
chains in the Genus database with same CATH superfamily
1H2WA 3IUJA 2XE4A 3AL8B 4IA9A 4XYIA 3ZE2A 4FB1D 3OTTA 3QI0A 4DNVA 5CXCA 4Y5RD 3A0FA 2YBAA 5I5JA 2H6KA 1GOGA 5HDBA 2VZ1A 1A12A 2YNPA 3OKWA 3ZDYA 2B5LA 1U4CA 4PSWB 5K19A 4J73A 3JPXA 4HDJA 5FFOA 3MUOA 1YR2A 4J84A 2P9NC 4D0KA 4UM9A 4CI3A 5CYKB 5TDHB 4J8BA 4N14A 2HKRA 2XU7A 3EI1B 3EI3B 3J80g 5THAA 3IJCA 4L9OA 3OKYB 5I5MA 4FA4D 4H5IA 2HKMA 2HU5A 2I3SA 4G56B 4O45A 4BUJC 3L4OD 3GC3B 4E5ZA 5EMKB 4FA9D 2VC2A 3EI2A 1SQJA 2H6NA 5EARA 4CC9A 3ZDZA 4U7AA 4J0WA 5E6RA 3I8CA 5FQDA 3ULEC 3UKRC 1XIPA 5CXBB 5TF2A 4KFMB 4Z7OA 4AN1A 4O1QD 1A0RB 3OW8A 4MMYA 4RE5A 4QRJA 3SXTD 5FFGA 4E5ZB 3BWSA 4NAAA 3EI2B 3JB9L 3FCSA 4IMMA 4R7AB 2EICA 2J55H 4JD2C 5GMKn 4G1MA 3DSMA 5IJ8E 1QNIA 3CFVA 1UTCA 3RN0D 3J81g 2PM6B 2YNOA 3EU7A 2HESX 3IUQA 4J79A 4ZOXA 1GOTB 5H14A 3CFSB 4ZOZA 4FAVD 3O4JA 5HYNB 3F3PA 2VDKA 4O9DA 1TYQC 1PGUA 2OIZA 4ERQA 1XHMA 4CZXA 2CN3A 3VI4A 4CI8A 1S4UX 5M5UA 1ERJA 4JHNA 4J86A 4QT8A 3SBPA 5KDOB 2O9KA 1GOFA 4JSXC 1JV2A 4FWWA 3V9FA 4A09B 1M1XA 3GFCA 2P9KC 1H2XA 3I2NA 3VA6A 5C2VB 4K3ID 2VDOA 3IUNA 3O4HA 4O2WA 4AMYA 3K6SA 4FAND 3KCIA 4NENA 4WK4A 4UM8A 3SVWD 1XKSA 4OZUA 5TEFA 2AQ5A 3JROA 4A11B 2HYEA 4LGNA 1I2MB 5AMSA 3JZHA 5HQGA 3W15A 2I0SA 1B9YA 3C9CA 3IJ0A 1MG3A 3NVNA 2XL2A 2TRCB 2CO0A 2G9AA 2PM9A 4GGCA 4J77A 3I8EA 2VDPA 5IT9g 3RFGA 4O02A 3OF7A 4E54B 5EMMB 4BCDA 2J56H 4A0BA 2VDQA 3NIFA 4GQ2P 2B4EA 2OJYA 3I89A 4JSPC 4NBMA 2QZPA 4O3TB 5GSAA 5IGOA 3K72A 1UOQA 3QHYB 3PVUB 3MKQA 2HXCA 4ERYA 3AH8B 3MKSB 1JTDB 3MZKA 2H6QA 3KRXB 2P9LC 3IIWA 5M61A 3EI4B 2H3XA 3PE7A 3SN6B 1BPOA 4J82A 3F3GA 2HJBA 1VZ2A 1E8NA 2VZ3A 3CIKB 2OK4A 2Z2NA 3P4FA 4JHPC 2CNXA 4QAMA 2PBIB 4XEIC 4GGAA 5CXCB 1E8MA 2P9IC 4JT6C 4NSXA 3JZNA 5FKQA 1TBGA 2PM7B 4LG9A 2MTAH 4WK2A 1PI6A 2XDWA 3DWLC 2VDRA 3EQ8A 2QC5A 3SJLD 2H68A 1UOPA 1NEXB 4LG8A 3UVKA 4Z8LA 3MUNA 4O3UB 3OL2A 3AFCA 3C5MA 4JXMA 2VDNA 4ESGA 5E6SA 2GC7A 2P9SC 3RFHA 3SWSD 4AX4A 3IKOA 5C9ZB 1GP2B 1N6DA 5C2WB 5AJAA 3SBQA 2B5MA 1OLZA 4CY1A 1PEVA 1OMWB 1C9LA 4IRZA 3RLMD 3VH0A 4J81A 1SHYB 4WJKA 5EM2A 5AFU3 1K8KC 4BH6A 4WK0A 2EBSA 3DXMC 2H9NA 3T3PA 3FCUA 3OKTA 5B4WA 3PXTD 2XYIA 5C86A 3PXSD 4AN0A 4DNUA 3UVLA 3FRXA 2AH0A 2AGZA 4BCBA 4CZVA 1GXRA 3IUMA 3NVQA 5EAPA 4BCCA 5M5VA 3SCYA 4J8GA 3ZE1A 2UZXB 1VZ3A 4U1EI 4GM9A 3IIYA 3ZDXA 2JKXA 4MK0B 5M5TA 2OK6A 4A08A 3MMYA 3FGBA 2QXVA 2I3TA 3T3MA 2IURA 4BL0A 3V5WB 3I7PA 3AL9A 4L3HD 4MMZA 4X60B 3RMZD 4NC4A 2H13A 2GNQA 3K71A 3EMHA 5HE3B 5FLXg 5M5SA 4JT5C 2OVQB 2H47A 5E6UA 4Y7RA 3O4GA 5FA5B 1N6EA 4GZ8A 2BBKH 2H9PA 2P9PC 3I7HA 4ZOVA 3I7NA 3NIDA 2XZGA 2CE8A 4J78A 4EWRA 5C92A 2H9MA 1VYHC 2EIBA 4G1EA 4JSNC 2B5NA 1JMXB 4UI9R 3VGZA 3KRWB 4A2MA 4A0AA 3GD1I 5H1MA 4ZN4A 2AGWA 5IJ7E 1K3IA 3V4VA 3SBRA 1QFMA 1O6GA 3AL8A 1MG2A 4YVDA 2I0RA 5H17A 5GXHA 3U4YA 2PM9B 2AGYA 4MMXA 3ZE0A 2HU7A 3JAMg 1JOFA 5IC7A 4GMBA 1JJUB 4RE6A 4CI1A 1L5GA 2BKLA 1U8CA 4PBZA 4A0BB 1VE6A 4L1QD 2XL3A 3EQ7A 4PXWA 4QQEA 3EG6A 5CYKA 3PVWB 4GGDA 3V4PA 4Z7NA 4X61B 3EI1A 3IVMA 5TEEA 1K32A 3EI3A 2BCJB 2AGLA 3V7DB 1B9XA 3OKYA 5FKRA 1O6FA 1Q47A 2AGXA 4PNKB 1JMZB 4D9SA 2YB8B 4G55A 4AOWA 1H2YA 3BG1A 4FHLA 3SMRA 4QL1A 2Z2PA 3FM0A 4PC0A 1UOOA 3O4IA 5FKTA 2HJ4A 1MDAH 4GQBB 5CXBA 4CI2A 2J57G 2VDLA 3NIGA 3BG0A 2EIEA 4CY2A 5M5RA 3I7KA 4PBYA 5EMLB 3UR4A 2UZYB 4Z7QA 4K3JB 1U2VC 2IUPA 1P22A 1PBYB 2AH1A 3JZGA 3I7OA 4PSXB 3C99A 5HE0B 3IJEA 4AMZA 3OL2B 3PSLA 2IWFA 3SHFA 4TZ4A 1YFQA 4A7JA 3PXWD 3IJ1A 2G99A 2YMUA 1GG2B 3ORVD 1QFSA 1SQ9A 4GM3A 4X63B 3MXXA 1VE7A 3I7LA 2W18A 5EM2B 3L4MD 4CY3A 1C9IA 1GOHA 3IULA 4GQ1A 4ERZA 1T2XA 3VI3A 5EALA 3PSCB 2H9LA 5SXMA 3E0CA 4A09A 2CO0C 5A2Qg 2VDMA 4J0XA 3UKUC 4ES0A 4BP9A 3C75H 1TYEA 5HE1B 4BP8A 4A2LA 4I79A 4CY5A 4AEZA 3EQ9A 3RRMC 2CN2A 4CZYA 3RN1D 3ZWLB 4A11A 5GXIA 2P9UC 3UVNA 5IGQA 4DNWA 1E5TA 5EMJB 5K1CC 2GC4A 2IAAA 3K26A 2IUVA 3DDUA 4A08B 3GREA 4FA5D 2OVPB 3DM0A 4L3GD 2IWKA 2Q7QA 1FWXA 1NR0A 1L0QA 3DXKC 4GM8A 2I0TA 3F3FA 4E54A 3ODTA 2HU8A 4J87A 4X3EA 3MVDK 1R5MA 2H14A 5FXYA 3K27A 3UVOA 4OWRA 4D6VA 2OVRB 1H2ZA 2IUQA 3IURA 4ZOYA 5JWZA 2QR5A 3NVXA 2YNNA 3MZLA 4XYHA 3JRPA 3B7FA 3N0EA 3SFZA 3HFQA 1N6FA 4FA1D 2Z2OA 3EI4A 4JSVC 5FKSA 1RI6A 4L1MA 3RSEC 5I5IA 5EAMA 3EWEA 4A0AB 3N0DA 3SLED 2EIDA 5HE2B 2WQ8A 3UVMA 2CE9A 4H5JA
chains in the Genus database with same CATH topology
3AL8B 4IA9A 4XYIA 4FB1D 3OTTA 5CXCA 4Y5RD 3A0FA 2YBAA 5I5JA 2H6KA 2YNPA 3OKWA 2B5LA 1U4CA 4PSWB 5K19A 4J73A 3JPXA 4HDJA 4J84A 2P9NC 4D0KA 4CI3A 5CYKB 5TDHB 4J8BA 4N14A 2HKRA 2XU7A 3EI1B 3EI3B 3J80g 5THAA 3IJCA 4L9OA 3OKYB 5I5MA 4FA4D 4H5IA 2HKMA 2I3SA 4G56B 4O45A 4BUJC 3L4OD 4E5ZA 5EMKB 4FA9D 3EI2A 1SQJA 2H6NA 5EARA 4CC9A 4U7AA 4J0WA 3I8CA 5FQDA 3ULEC 3UKRC 1XIPA 5CXBB 5TF2A 4KFMB 4O1QD 1A0RB 3OW8A 4QRJA 3SXTD 4E5ZB 3BWSA 3EI2B 3JB9L 4IMMA 4R7AB 2J55H 5GMKn 4JD2C 3DSMA 5IJ8E 1QNIA 3CFVA 3RN0D 3J81g 2PM6B 2YNOA 3EU7A 2HESX 4J79A 4ZOXA 1GOTB 5H14A 3CFSB 4ZOZA 4FAVD 5HYNB 3F3PA 4O9DA 1TYQC 1PGUA 2OIZA 4ERQA 1XHMA 4CZXA 2CN3A 4CI8A 1S4UX 1ERJA 4J86A 4QT8A 3SBPA 5KDOB 2O9KA 4JSXC 4FWWA 3V9FA 4A09B 3GFCA 2P9KC 3I2NA 3VA6A 5C2VB 4K3ID 4FAND 3SVWD 1XKSA 4OZUA 5TEFA 2AQ5A 3JROA 4A11B 2HYEA 4LGNA 5AMSA 3JZHA 5HQGA 3W15A 2I0SA 1B9YA 3C9CA 3IJ0A 1MG3A 3NVNA 2XL2A 2TRCB 2CO0A 2G9AA 2PM9A 4GGCA 4J77A 3I8EA 5IT9g 3RFGA 4E54B 5EMMB 2J56H 4A0BA 4GQ2P 2B4EA 2OJYA 3I89A 4JSPC 4O3TB 5GSAA 5IGOA 3PVUB 3MKQA 2HXCA 4ERYA 3AH8B 3MKSB 3MZKA 2H6QA 3KRXB 2P9LC 3IIWA 3EI4B 2H3XA 3PE7A 3SN6B 4J82A 3F3GA 2HJBA 3CIKB 2OK4A 2Z2NA 3P4FA 2CNXA 2PBIB 4XEIC 4GGAA 5CXCB 2P9IC 4JT6C 4NSXA 5FKQA 3JZNA 1TBGA 2PM7B 4LG9A 2MTAH 1PI6A 3DWLC 2QC5A 3SJLD 2H68A 1NEXB 4LG8A 3UVKA 4Z8LA 4O3UB 3OL2A 4JXMA 3AFCA 3C5MA 4ESGA 2GC7A 2P9SC 3RFHA 3SWSD 5C9ZB 3IKOA 1GP2B 1N6DA 5C2WB 5AJAA 3SBQA 2B5MA 1OLZA 4CY1A 1PEVA 1OMWB 3RLMD 3VH0A 4J81A 1SHYB 5EM2A 5AFU3 1K8KC 4BH6A 2EBSA 3DXMC 2H9NA 3OKTA 5B4WA 3PXTD 2XYIA 3PXSD 3UVLA 3FRXA 2AH0A 2AGZA 4CZVA 1GXRA 3NVQA 5EAPA 3SCYA 4J8GA 2UZXB 4U1EI 4GM9A 3IIYA 4MK0B 2OK6A 4A08A 3MMYA 3FGBA 2QXVA 2I3TA 2IURA 4BL0A 3V5WB 3I7PA 3AL9A 4L3HD 4X60B 3RMZD 2H13A 2GNQA 3EMHA 5HE3B 5FLXg 4JT5C 2OVQB 2H47A 4Y7RA 5FA5B 1N6EA 4GZ8A 2BBKH 2H9PA 2P9PC 3I7HA 4ZOVA 3I7NA 2CE8A 4J78A 4EWRA 2H9MA 1VYHC 4JSNC 2B5NA 1JMXB 4UI9R 3VGZA 3KRWB 4A2MA 4A0AA 5H1MA 4ZN4A 2AGWA 5IJ7E 3SBRA 3AL8A 1MG2A 4YVDA 2I0RA 5H17A 5GXHA 3U4YA 2PM9B 2AGYA 3JAMg 1JOFA 5IC7A 4GMBA 1JJUB 4CI1A 4PBZA 4A0BB 4L1QD 2XL3A 4PXWA 4QQEA 3EG6A 5CYKA 3PVWB 4GGDA 4X61B 3EI1A 5TEEA 1K32A 3EI3A 2BCJB 2AGLA 3V7DB 1B9XA 3OKYA 5FKRA 1Q47A 2AGXA 4PNKB 1JMZB 2YB8B 4AOWA 3BG1A 4FHLA 3SMRA 4QL1A 2Z2PA 3FM0A 4PC0A 5FKTA 2HJ4A 1MDAH 4GQBB 5CXBA 4CI2A 2J57G 3BG0A 4CY2A 3I7KA 4PBYA 5EMLB 3UR4A 2UZYB 4K3JB 1U2VC 2IUPA 1P22A 1PBYB 2AH1A 3JZGA 3I7OA 4PSXB 3C99A 5HE0B 3OL2B 3PSLA 2IWFA 3SHFA 4TZ4A 1YFQA 4A7JA 3PXWD 3IJ1A 2G99A 2YMUA 1GG2B 3ORVD 1SQ9A 4GM3A 4X63B 3MXXA 3I7LA 2W18A 5EM2B 3L4MD 4CY3A 4GQ1A 4ERZA 5EALA 3PSCB 2H9LA 5SXMA 3E0CA 4A09A 2CO0C 5A2Qg 4J0XA 3UKUC 4ES0A 3C75H 5HE1B 4A2LA 4I79A 4CY5A 4AEZA 3RRMC 2CN2A 4CZYA 3RN1D 3ZWLB 4A11A 5GXIA 2P9UC 3UVNA 5IGQA 5K1CC 5EMJB 2GC4A 2IAAA 3K26A 2IUVA 4A08B 3GREA 4FA5D 2OVPB 3DM0A 4L3GD 2IWKA 2Q7QA 1FWXA 1NR0A 1L0QA 3DXKC 4GM8A 2I0TA 3F3FA 4E54A 3ODTA 4J87A 4X3EA 1R5MA 2H14A 5FXYA 3K27A 3UVOA 4OWRA 4D6VA 2OVRB 2IUQA 4ZOYA 5JWZA 3NVXA 2YNNA 3MZLA 4XYHA 3JRPA 3B7FA 3N0EA 3SFZA 3HFQA 1N6FA 4FA1D 2Z2OA 3EI4A 4JSVC 5FKSA 1RI6A 3RSEC 5I5IA 5EAMA 3EWEA 4A0AB 3N0DA 3SLED 3UVMA 5HE2B 2CE9A 4H5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL8 B;  4IA9 A;  4XYI A;  4FB1 D;  3OTT A;  5CXC A;  4Y5R D;  3A0F A;  2YBA A;  5I5J A;  2H6K A;  2YNP A;  3OKW A;  2B5L A;  1U4C A;  4PSW B;  5K19 A;  4J73 A;  3JPX A;  4HDJ A;  4J84 A;  2P9N C;  4D0K A;  4CI3 A;  5CYK B;  5TDH B;  4J8B A;  4N14 A;  2HKR A;  2XU7 A;  3EI1 B;  3EI3 B;  3J80 g;  5THA A;  3IJC A;  4L9O A;  3OKY B;  5I5M A;  4FA4 D;  4H5I A;  2HKM A;  2I3S A;  4G56 B;  4O45 A;  4BUJ C;  3L4O D;  4E5Z A;  5EMK B;  4FA9 D;  3EI2 A;  1SQJ A;  2H6N A;  5EAR A;  4CC9 A;  4U7A A;  4J0W A;  3I8C A;  5FQD A;  3ULE C;  3UKR C;  1XIP A;  5CXB B;  5TF2 A;  4KFM B;  4O1Q D;  1A0R B;  3OW8 A;  4QRJ A;  3SXT D;  4E5Z B;  3BWS A;  3EI2 B;  3JB9 L;  4IMM A;  4R7A B;  2J55 H;  5GMK n;  4JD2 C;  3DSM A;  5IJ8 E;  1QNI A;  3CFV A;  3RN0 D;  3J81 g;  2PM6 B;  2YNO A;  3EU7 A;  2HES X;  4J79 A;  4ZOX A;  1GOT B;  5H14 A;  3CFS B;  4ZOZ A;  4FAV D;  5HYN B;  3F3P A;  4O9D A;  1TYQ C;  1PGU A;  2OIZ A;  4ERQ A;  1XHM A;  4CZX A;  2CN3 A;  4CI8 A;  1S4U X;  1ERJ A;  4J86 A;  4QT8 A;  3SBP A;  5KDO B;  2O9K A;  4JSX C;  4FWW A;  3V9F A;  4A09 B;  3GFC A;  2P9K C;  3I2N A;  3VA6 A;  5C2V B;  4K3I D;  4FAN D;  3SVW D;  1XKS A;  4OZU A;  5TEF A;  2AQ5 A;  3JRO A;  4A11 B;  2HYE A;  4LGN A;  5AMS A;  3JZH A;  5HQG A;  3W15 A;  2I0S A;  1B9Y A;  3C9C A;  3IJ0 A;  1MG3 A;  3NVN A;  2XL2 A;  2TRC B;  2CO0 A;  2G9A A;  2PM9 A;  4GGC A;  4J77 A;  3I8E A;  5IT9 g;  3RFG A;  4E54 B;  5EMM B;  2J56 H;  4A0B A;  4GQ2 P;  2B4E A;  2OJY A;  3I89 A;  4JSP C;  4O3T B;  5GSA A;  5IGO A;  3PVU B;  3MKQ A;  2HXC A;  4ERY A;  3AH8 B;  3MKS B;  3MZK A;  2H6Q A;  3KRX B;  2P9L C;  3IIW A;  3EI4 B;  2H3X A;  3PE7 A;  3SN6 B;  4J82 A;  3F3G A;  2HJB A;  3CIK B;  2OK4 A;  2Z2N A;  3P4F A;  2CNX A;  2PBI B;  4XEI C;  4GGA A;  5CXC B;  2P9I C;  4JT6 C;  4NSX A;  5FKQ A;  3JZN A;  1TBG A;  2PM7 B;  4LG9 A;  2MTA H;  1PI6 A;  3DWL C;  2QC5 A;  3SJL D;  2H68 A;  1NEX B;  4LG8 A;  3UVK A;  4Z8L A;  4O3U B;  3OL2 A;  4JXM A;  3AFC A;  3C5M A;  4ESG A;  2GC7 A;  2P9S C;  3RFH A;  3SWS D;  5C9Z B;  3IKO A;  1GP2 B;  1N6D A;  5C2W B;  5AJA A;  3SBQ A;  2B5M A;  1OLZ A;  4CY1 A;  1PEV A;  1OMW B;  3RLM D;  3VH0 A;  4J81 A;  1SHY B;  5EM2 A;  5AFU 3;  1K8K C;  4BH6 A;  2EBS A;  3DXM C;  2H9N A;  3OKT A;  5B4W A;  3PXT D;  2XYI A;  3PXS D;  3UVL A;  3FRX A;  2AH0 A;  2AGZ A;  4CZV A;  1GXR A;  3NVQ A;  5EAP A;  3SCY A;  4J8G A;  2UZX B;  4U1E I;  4GM9 A;  3IIY A;  4MK0 B;  2OK6 A;  4A08 A;  3MMY A;  3FGB A;  2QXV A;  2I3T A;  2IUR A;  4BL0 A;  3V5W B;  3I7P A;  3AL9 A;  4L3H D;  4X60 B;  3RMZ D;  2H13 A;  2GNQ A;  3EMH A;  5HE3 B;  5FLX g;  4JT5 C;  2OVQ B;  2H47 A;  4Y7R A;  5FA5 B;  1N6E A;  4GZ8 A;  2BBK H;  2H9P A;  2P9P C;  3I7H A;  4ZOV A;  3I7N A;  2CE8 A;  4J78 A;  4EWR A;  2H9M A;  1VYH C;  4JSN C;  2B5N A;  1JMX B;  4UI9 R;  3VGZ A;  3KRW B;  4A2M A;  4A0A A;  5H1M A;  4ZN4 A;  2AGW A;  5IJ7 E;  3SBR A;  3AL8 A;  1MG2 A;  4YVD A;  2I0R A;  5H17 A;  5GXH A;  3U4Y A;  2PM9 B;  2AGY A;  3JAM g;  1JOF A;  5IC7 A;  4GMB A;  1JJU B;  4CI1 A;  4PBZ A;  4A0B B;  4L1Q D;  2XL3 A;  4PXW A;  4QQE A;  3EG6 A;  5CYK A;  3PVW B;  4GGD A;  4X61 B;  3EI1 A;  5TEE A;  1K32 A;  3EI3 A;  2BCJ B;  2AGL A;  3V7D B;  1B9X A;  3OKY A;  5FKR A;  1Q47 A;  2AGX A;  4PNK B;  1JMZ B;  2YB8 B;  4AOW A;  3BG1 A;  4FHL A;  3SMR A;  4QL1 A;  2Z2P A;  3FM0 A;  4PC0 A;  5FKT A;  2HJ4 A;  1MDA H;  4GQB B;  5CXB A;  4CI2 A;  2J57 G;  3BG0 A;  4CY2 A;  3I7K A;  4PBY A;  5EML B;  3UR4 A;  2UZY B;  4K3J B;  1U2V C;  2IUP A;  1P22 A;  1PBY B;  2AH1 A;  3JZG A;  3I7O A;  4PSX B;  3C99 A;  5HE0 B;  3OL2 B;  3PSL A;  2IWF A;  3SHF A;  4TZ4 A;  1YFQ A;  4A7J A;  3PXW D;  3IJ1 A;  2G99 A;  2YMU A;  1GG2 B;  3ORV D;  1SQ9 A;  4GM3 A;  4X63 B;  3MXX A;  3I7L A;  2W18 A;  5EM2 B;  3L4M D;  4CY3 A;  4GQ1 A;  4ERZ A;  5EAL A;  3PSC B;  2H9L A;  5SXM A;  3E0C A;  4A09 A;  2CO0 C;  5A2Q g;  4J0X A;  3UKU C;  4ES0 A;  3C75 H;  5HE1 B;  4A2L A;  4I79 A;  4CY5 A;  4AEZ A;  3RRM C;  2CN2 A;  4CZY A;  3RN1 D;  3ZWL B;  4A11 A;  5GXI A;  2P9U C;  3UVN A;  5IGQ A;  5K1C C;  5EMJ B;  2GC4 A;  2IAA A;  3K26 A;  2IUV A;  4A08 B;  3GRE A;  4FA5 D;  2OVP B;  3DM0 A;  4L3G D;  2IWK A;  2Q7Q A;  1FWX A;  1NR0 A;  1L0Q A;  3DXK C;  4GM8 A;  2I0T A;  3F3F A;  4E54 A;  3ODT A;  4J87 A;  4X3E A;  1R5M A;  2H14 A;  5FXY A;  3K27 A;  3UVO A;  4OWR A;  4D6V A;  2OVR B;  2IUQ A;  4ZOY A;  5JWZ A;  3NVX A;  2YNN A;  3MZL A;  4XYH A;  3JRP A;  3B7F A;  3N0E A;  3SFZ A;  3HFQ A;  1N6F A;  4FA1 D;  2Z2O A;  3EI4 A;  4JSV C;  5FKS A;  1RI6 A;  3RSE C;  5I5I A;  5EAM A;  3EWE A;  4A0A B;  3N0D A;  3SLE D;  3UVM A;  5HE2 B;  2CE9 A;  4H5J A; 
#chains in the Genus database with same CATH topology
 1H2W A;  3IUJ A;  2XE4 A;  3AL8 B;  4IA9 A;  4XYI A;  3ZE2 A;  4FB1 D;  3OTT A;  3QI0 A;  4DNV A;  5CXC A;  4Y5R D;  3A0F A;  2YBA A;  5I5J A;  2H6K A;  1GOG A;  5HDB A;  2VZ1 A;  1A12 A;  2YNP A;  3OKW A;  3ZDY A;  2B5L A;  1U4C A;  4PSW B;  5K19 A;  4J73 A;  3JPX A;  4HDJ A;  5FFO A;  3MUO A;  1YR2 A;  4J84 A;  2P9N C;  4D0K A;  4UM9 A;  4CI3 A;  5CYK B;  5TDH B;  4J8B A;  4N14 A;  2HKR A;  2XU7 A;  3EI1 B;  3EI3 B;  3J80 g;  5THA A;  3IJC A;  4L9O A;  3OKY B;  5I5M A;  4FA4 D;  4H5I A;  2HKM A;  2HU5 A;  2I3S A;  4G56 B;  4O45 A;  4BUJ C;  3L4O D;  3GC3 B;  4E5Z A;  5EMK B;  4FA9 D;  2VC2 A;  3EI2 A;  1SQJ A;  2H6N A;  5EAR A;  4CC9 A;  3ZDZ A;  4U7A A;  4J0W A;  5E6R A;  3I8C A;  5FQD A;  3ULE C;  3UKR C;  1XIP A;  5CXB B;  5TF2 A;  4KFM B;  4Z7O A;  4AN1 A;  4O1Q D;  1A0R B;  3OW8 A;  4MMY A;  4RE5 A;  4QRJ A;  3SXT D;  5FFG A;  4E5Z B;  3BWS A;  4NAA A;  3EI2 B;  3JB9 L;  3FCS A;  4IMM A;  4R7A B;  2EIC A;  2J55 H;  4JD2 C;  5GMK n;  4G1M A;  3DSM A;  5IJ8 E;  1QNI A;  3CFV A;  1UTC A;  3RN0 D;  3J81 g;  2PM6 B;  2YNO A;  3EU7 A;  2HES X;  3IUQ A;  4J79 A;  4ZOX A;  1GOT B;  5H14 A;  3CFS B;  4ZOZ A;  4FAV D;  3O4J A;  5HYN B;  3F3P A;  2VDK A;  4O9D A;  1TYQ C;  1PGU A;  2OIZ A;  4ERQ A;  1XHM A;  4CZX A;  2CN3 A;  3VI4 A;  4CI8 A;  1S4U X;  5M5U A;  1ERJ A;  4JHN A;  4J86 A;  4QT8 A;  3SBP A;  5KDO B;  2O9K A;  1GOF A;  4JSX C;  1JV2 A;  4FWW A;  3V9F A;  4A09 B;  1M1X A;  3GFC A;  2P9K C;  1H2X A;  3I2N A;  3VA6 A;  5C2V B;  4K3I D;  2VDO A;  3IUN A;  3O4H A;  4O2W A;  4AMY A;  3K6S A;  4FAN D;  3KCI A;  4NEN A;  4WK4 A;  4UM8 A;  3SVW D;  1XKS A;  4OZU A;  5TEF A;  2AQ5 A;  3JRO A;  4A11 B;  2HYE A;  4LGN A;  1I2M B;  5AMS A;  3JZH A;  5HQG A;  3W15 A;  2I0S A;  1B9Y A;  3C9C A;  3IJ0 A;  1MG3 A;  3NVN A;  2XL2 A;  2TRC B;  2CO0 A;  2G9A A;  2PM9 A;  4GGC A;  4J77 A;  3I8E A;  2VDP A;  5IT9 g;  3RFG A;  4O02 A;  3OF7 A;  4E54 B;  5EMM B;  4BCD A;  2J56 H;  4A0B A;  2VDQ A;  3NIF A;  4GQ2 P;  2B4E A;  2OJY A;  3I89 A;  4JSP C;  4NBM A;  2QZP A;  4O3T B;  5GSA A;  5IGO A;  3K72 A;  1UOQ A;  3QHY B;  3PVU B;  3MKQ A;  2HXC A;  4ERY A;  3AH8 B;  3MKS B;  1JTD B;  3MZK A;  2H6Q A;  3KRX B;  2P9L C;  3IIW A;  5M61 A;  3EI4 B;  2H3X A;  3PE7 A;  3SN6 B;  1BPO A;  4J82 A;  3F3G A;  2HJB A;  1VZ2 A;  1E8N A;  2VZ3 A;  3CIK B;  2OK4 A;  2Z2N A;  3P4F A;  4JHP C;  2CNX A;  4QAM A;  2PBI B;  4XEI C;  4GGA A;  5CXC B;  1E8M A;  2P9I C;  4JT6 C;  4NSX A;  3JZN A;  5FKQ A;  1TBG A;  2PM7 B;  4LG9 A;  2MTA H;  4WK2 A;  1PI6 A;  2XDW A;  3DWL C;  2VDR A;  3EQ8 A;  2QC5 A;  3SJL D;  2H68 A;  1UOP A;  1NEX B;  4LG8 A;  3UVK A;  4Z8L A;  3MUN A;  4O3U B;  3OL2 A;  3AFC A;  3C5M A;  4JXM A;  2VDN A;  4ESG A;  5E6S A;  2GC7 A;  2P9S C;  3RFH A;  3SWS D;  4AX4 A;  3IKO A;  5C9Z B;  1GP2 B;  1N6D A;  5C2W B;  5AJA A;  3SBQ A;  2B5M A;  1OLZ A;  4CY1 A;  1PEV A;  1OMW B;  1C9L A;  4IRZ A;  3RLM D;  3VH0 A;  4J81 A;  1SHY B;  4WJK A;  5EM2 A;  5AFU 3;  1K8K C;  4BH6 A;  4WK0 A;  2EBS A;  3DXM C;  2H9N A;  3T3P A;  3FCU A;  3OKT A;  5B4W A;  3PXT D;  2XYI A;  5C86 A;  3PXS D;  4AN0 A;  4DNU A;  3UVL A;  3FRX A;  2AH0 A;  2AGZ A;  4BCB A;  4CZV A;  1GXR A;  3IUM A;  3NVQ A;  5EAP A;  4BCC A;  5M5V A;  3SCY A;  4J8G A;  3ZE1 A;  2UZX B;  1VZ3 A;  4U1E I;  4GM9 A;  3IIY A;  3ZDX A;  2JKX A;  4MK0 B;  5M5T A;  2OK6 A;  4A08 A;  3MMY A;  3FGB A;  2QXV A;  2I3T A;  3T3M A;  2IUR A;  4BL0 A;  3V5W B;  3I7P A;  3AL9 A;  4L3H D;  4MMZ A;  4X60 B;  3RMZ D;  4NC4 A;  2H13 A;  2GNQ A;  3K71 A;  3EMH A;  5HE3 B;  5FLX g;  5M5S A;  4JT5 C;  2OVQ B;  2H47 A;  5E6U A;  4Y7R A;  3O4G A;  5FA5 B;  1N6E A;  4GZ8 A;  2BBK H;  2H9P A;  2P9P C;  3I7H A;  4ZOV A;  3I7N A;  3NID A;  2XZG A;  2CE8 A;  4J78 A;  4EWR A;  5C92 A;  2H9M A;  1VYH C;  2EIB A;  4G1E A;  4JSN C;  2B5N A;  1JMX B;  4UI9 R;  3VGZ A;  3KRW B;  4A2M A;  4A0A A;  3GD1 I;  5H1M A;  4ZN4 A;  2AGW A;  5IJ7 E;  1K3I A;  3V4V A;  3SBR A;  1QFM A;  1O6G A;  3AL8 A;  1MG2 A;  4YVD A;  2I0R A;  5H17 A;  5GXH A;  3U4Y A;  2PM9 B;  2AGY A;  4MMX A;  3ZE0 A;  2HU7 A;  3JAM g;  1JOF A;  5IC7 A;  4GMB A;  1JJU B;  4RE6 A;  4CI1 A;  1L5G A;  2BKL A;  1U8C A;  4PBZ A;  4A0B B;  1VE6 A;  4L1Q D;  2XL3 A;  3EQ7 A;  4PXW A;  4QQE A;  3EG6 A;  5CYK A;  3PVW B;  4GGD A;  3V4P A;  4Z7N A;  4X61 B;  3EI1 A;  3IVM A;  5TEE A;  1K32 A;  3EI3 A;  2BCJ B;  2AGL A;  3V7D B;  1B9X A;  3OKY A;  5FKR A;  1O6F A;  1Q47 A;  2AGX A;  4PNK B;  1JMZ B;  4D9S A;  2YB8 B;  4G55 A;  4AOW A;  1H2Y A;  3BG1 A;  4FHL A;  3SMR A;  4QL1 A;  2Z2P A;  3FM0 A;  4PC0 A;  1UOO A;  3O4I A;  5FKT A;  2HJ4 A;  1MDA H;  4GQB B;  5CXB A;  4CI2 A;  2J57 G;  2VDL A;  3NIG A;  3BG0 A;  2EIE A;  4CY2 A;  5M5R A;  3I7K A;  4PBY A;  5EML B;  3UR4 A;  2UZY B;  4Z7Q A;  4K3J B;  1U2V C;  2IUP A;  1P22 A;  1PBY B;  2AH1 A;  3JZG A;  3I7O A;  4PSX B;  3C99 A;  5HE0 B;  3IJE A;  4AMZ A;  3OL2 B;  3PSL A;  2IWF A;  3SHF A;  4TZ4 A;  1YFQ A;  4A7J A;  3PXW D;  3IJ1 A;  2G99 A;  2YMU A;  1GG2 B;  3ORV D;  1QFS A;  1SQ9 A;  4GM3 A;  4X63 B;  3MXX A;  1VE7 A;  3I7L A;  2W18 A;  5EM2 B;  3L4M D;  4CY3 A;  1C9I A;  1GOH A;  3IUL A;  4GQ1 A;  4ERZ A;  1T2X A;  3VI3 A;  5EAL A;  3PSC B;  2H9L A;  5SXM A;  3E0C A;  4A09 A;  2CO0 C;  5A2Q g;  2VDM A;  4J0X A;  3UKU C;  4ES0 A;  4BP9 A;  3C75 H;  1TYE A;  5HE1 B;  4BP8 A;  4A2L A;  4I79 A;  4CY5 A;  4AEZ A;  3EQ9 A;  3RRM C;  2CN2 A;  4CZY A;  3RN1 D;  3ZWL B;  4A11 A;  5GXI A;  2P9U C;  3UVN A;  5IGQ A;  4DNW A;  1E5T A;  5EMJ B;  5K1C C;  2GC4 A;  2IAA A;  3K26 A;  2IUV A;  3DDU A;  4A08 B;  3GRE A;  4FA5 D;  2OVP B;  3DM0 A;  4L3G D;  2IWK A;  2Q7Q A;  1FWX A;  1NR0 A;  1L0Q A;  3DXK C;  4GM8 A;  2I0T A;  3F3F A;  4E54 A;  3ODT A;  2HU8 A;  4J87 A;  4X3E A;  3MVD K;  1R5M A;  2H14 A;  5FXY A;  3K27 A;  3UVO A;  4OWR A;  4D6V A;  2OVR B;  1H2Z A;  2IUQ A;  3IUR A;  4ZOY A;  5JWZ A;  2QR5 A;  3NVX A;  2YNN A;  3MZL A;  4XYH A;  3JRP A;  3B7F A;  3N0E A;  3SFZ A;  3HFQ A;  1N6F A;  4FA1 D;  2Z2O A;  3EI4 A;  4JSV C;  5FKS A;  1RI6 A;  4L1M A;  3RSE C;  5I5I A;  5EAM A;  3EWE A;  4A0A B;  3N0D A;  3SLE D;  2EID A;  5HE2 B;  2WQ8 A;  3UVM A;  2CE9 A;  4H5J A; 
#chains in the Genus database with same CATH homology
 3AL8 B;  4IA9 A;  4XYI A;  4FB1 D;  3OTT A;  5CXC A;  4Y5R D;  3A0F A;  2YBA A;  5I5J A;  2H6K A;  2YNP A;  3OKW A;  2B5L A;  1U4C A;  4PSW B;  5K19 A;  4J73 A;  3JPX A;  4HDJ A;  4J84 A;  2P9N C;  4D0K A;  4CI3 A;  5CYK B;  5TDH B;  4J8B A;  4N14 A;  2HKR A;  2XU7 A;  3EI1 B;  3EI3 B;  3J80 g;  5THA A;  3IJC A;  4L9O A;  3OKY B;  5I5M A;  4FA4 D;  4H5I A;  2HKM A;  2I3S A;  4G56 B;  4O45 A;  4BUJ C;  3L4O D;  4E5Z A;  5EMK B;  4FA9 D;  3EI2 A;  1SQJ A;  2H6N A;  5EAR A;  4CC9 A;  4U7A A;  4J0W A;  3I8C A;  5FQD A;  3ULE C;  3UKR C;  1XIP A;  5CXB B;  5TF2 A;  4KFM B;  4O1Q D;  1A0R B;  3OW8 A;  4QRJ A;  3SXT D;  4E5Z B;  3BWS A;  3EI2 B;  3JB9 L;  4IMM A;  4R7A B;  2J55 H;  5GMK n;  4JD2 C;  3DSM A;  5IJ8 E;  1QNI A;  3CFV A;  3RN0 D;  3J81 g;  2PM6 B;  2YNO A;  3EU7 A;  2HES X;  4J79 A;  4ZOX A;  1GOT B;  5H14 A;  3CFS B;  4ZOZ A;  4FAV D;  5HYN B;  3F3P A;  4O9D A;  1TYQ C;  1PGU A;  2OIZ A;  4ERQ A;  1XHM A;  4CZX A;  2CN3 A;  4CI8 A;  1S4U X;  1ERJ A;  4J86 A;  4QT8 A;  3SBP A;  5KDO B;  2O9K A;  4JSX C;  4FWW A;  3V9F A;  4A09 B;  3GFC A;  2P9K C;  3I2N A;  3VA6 A;  5C2V B;  4K3I D;  4FAN D;  3SVW D;  1XKS A;  4OZU A;  5TEF A;  2AQ5 A;  3JRO A;  4A11 B;  2HYE A;  4LGN A;  5AMS A;  3JZH A;  5HQG A;  3W15 A;  2I0S A;  1B9Y A;  3C9C A;  3IJ0 A;  1MG3 A;  3NVN A;  2XL2 A;  2TRC B;  2CO0 A;  2G9A A;  2PM9 A;  4GGC A;  4J77 A;  3I8E A;  5IT9 g;  3RFG A;  4E54 B;  5EMM B;  2J56 H;  4A0B A;  4GQ2 P;  2B4E A;  2OJY A;  3I89 A;  4JSP C;  4O3T B;  5GSA A;  5IGO A;  3PVU B;  3MKQ A;  2HXC A;  4ERY A;  3AH8 B;  3MKS B;  3MZK A;  2H6Q A;  3KRX B;  2P9L C;  3IIW A;  3EI4 B;  2H3X A;  3PE7 A;  3SN6 B;  4J82 A;  3F3G A;  2HJB A;  3CIK B;  2OK4 A;  2Z2N A;  3P4F A;  2CNX A;  2PBI B;  4XEI C;  4GGA A;  5CXC B;  2P9I C;  4JT6 C;  4NSX A;  5FKQ A;  3JZN A;  1TBG A;  2PM7 B;  4LG9 A;  2MTA H;  1PI6 A;  3DWL C;  2QC5 A;  3SJL D;  2H68 A;  1NEX B;  4LG8 A;  3UVK A;  4Z8L A;  4O3U B;  3OL2 A;  4JXM A;  3AFC A;  3C5M A;  4ESG A;  2GC7 A;  2P9S C;  3RFH A;  3SWS D;  5C9Z B;  3IKO A;  1GP2 B;  1N6D A;  5C2W B;  5AJA A;  3SBQ A;  2B5M A;  1OLZ A;  4CY1 A;  1PEV A;  1OMW B;  3RLM D;  3VH0 A;  4J81 A;  1SHY B;  5EM2 A;  5AFU 3;  1K8K C;  4BH6 A;  2EBS A;  3DXM C;  2H9N A;  3OKT A;  5B4W A;  3PXT D;  2XYI A;  3PXS D;  3UVL A;  3FRX A;  2AH0 A;  2AGZ A;  4CZV A;  1GXR A;  3NVQ A;  5EAP A;  3SCY A;  4J8G A;  2UZX B;  4U1E I;  4GM9 A;  3IIY A;  4MK0 B;  2OK6 A;  4A08 A;  3MMY A;  3FGB A;  2QXV A;  2I3T A;  2IUR A;  4BL0 A;  3V5W B;  3I7P A;  3AL9 A;  4L3H D;  4X60 B;  3RMZ D;  2H13 A;  2GNQ A;  3EMH A;  5HE3 B;  5FLX g;  4JT5 C;  2OVQ B;  2H47 A;  4Y7R A;  5FA5 B;  1N6E A;  4GZ8 A;  2BBK H;  2H9P A;  2P9P C;  3I7H A;  4ZOV A;  3I7N A;  2CE8 A;  4J78 A;  4EWR A;  2H9M A;  1VYH C;  4JSN C;  2B5N A;  1JMX B;  4UI9 R;  3VGZ A;  3KRW B;  4A2M A;  4A0A A;  5H1M A;  4ZN4 A;  2AGW A;  5IJ7 E;  3SBR A;  3AL8 A;  1MG2 A;  4YVD A;  2I0R A;  5H17 A;  5GXH A;  3U4Y A;  2PM9 B;  2AGY A;  3JAM g;  1JOF A;  5IC7 A;  4GMB A;  1JJU B;  4CI1 A;  4PBZ A;  4A0B B;  4L1Q D;  2XL3 A;  4PXW A;  4QQE A;  3EG6 A;  5CYK A;  3PVW B;  4GGD A;  4X61 B;  3EI1 A;  5TEE A;  1K32 A;  3EI3 A;  2BCJ B;  2AGL A;  3V7D B;  1B9X A;  3OKY A;  5FKR A;  1Q47 A;  2AGX A;  4PNK B;  1JMZ B;  2YB8 B;  4AOW A;  3BG1 A;  4FHL A;  3SMR A;  4QL1 A;  2Z2P A;  3FM0 A;  4PC0 A;  5FKT A;  2HJ4 A;  1MDA H;  4GQB B;  5CXB A;  4CI2 A;  2J57 G;  3BG0 A;  4CY2 A;  3I7K A;  4PBY A;  5EML B;  3UR4 A;  2UZY B;  4K3J B;  1U2V C;  2IUP A;  1P22 A;  1PBY B;  2AH1 A;  3JZG A;  3I7O A;  4PSX B;  3C99 A;  5HE0 B;  3OL2 B;  3PSL A;  2IWF A;  3SHF A;  4TZ4 A;  1YFQ A;  4A7J A;  3PXW D;  3IJ1 A;  2G99 A;  2YMU A;  1GG2 B;  3ORV D;  1SQ9 A;  4GM3 A;  4X63 B;  3MXX A;  3I7L A;  2W18 A;  5EM2 B;  3L4M D;  4CY3 A;  4GQ1 A;  4ERZ A;  5EAL A;  3PSC B;  2H9L A;  5SXM A;  3E0C A;  4A09 A;  2CO0 C;  5A2Q g;  4J0X A;  3UKU C;  4ES0 A;  3C75 H;  5HE1 B;  4A2L A;  4I79 A;  4CY5 A;  4AEZ A;  3RRM C;  2CN2 A;  4CZY A;  3RN1 D;  3ZWL B;  4A11 A;  5GXI A;  2P9U C;  3UVN A;  5IGQ A;  5K1C C;  5EMJ B;  2GC4 A;  2IAA A;  3K26 A;  2IUV A;  4A08 B;  3GRE A;  4FA5 D;  2OVP B;  3DM0 A;  4L3G D;  2IWK A;  2Q7Q A;  1FWX A;  1NR0 A;  1L0Q A;  3DXK C;  4GM8 A;  2I0T A;  3F3F A;  4E54 A;  3ODT A;  4J87 A;  4X3E A;  1R5M A;  2H14 A;  5FXY A;  3K27 A;  3UVO A;  4OWR A;  4D6V A;  2OVR B;  2IUQ A;  4ZOY A;  5JWZ A;  3NVX A;  2YNN A;  3MZL A;  4XYH A;  3JRP A;  3B7F A;  3N0E A;  3SFZ A;  3HFQ A;  1N6F A;  4FA1 D;  2Z2O A;  3EI4 A;  4JSV C;  5FKS A;  1RI6 A;  3RSE C;  5I5I A;  5EAM A;  3EWE A;  4A0A B;  3N0D A;  3SLE D;  3UVM A;  5HE2 B;  2CE9 A;  4H5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...