2GC4A

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 93
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2gc4A00
2IUPA 3EI2A 4ERYA 4K3JB 2OIZA 5FXYA 3EI1A 3OKTA 4J0XA 3BG1A 4ERZA 2QC5A 2B5NA 2W18A 3SHFA 4J81A 3I7PA 5I5MA 4CY3A 4X3EA 4A0AB 3SBQA 3CFSB 2I3SA 2PBIB 2Z2OA 5FA5B 3F3GA 5FKSA 2CE9A 4AEZA 1Q47A 2IAAA 3W15A 3DWLC 5AJAA 3OKYA 4TZ4A 2QXVA 3RFHA 2J55H 4AOWA 1RI6A 4IMMA 2IWKA 4PSXB 4Z8LA 2HYEA 1NR0A 5AFU3 1K32A 4J8BA 4Y5RD 1GG2B 1B9YA 2GC7A 5HE2B 2CO0C 1OLZA 5IJ8E 5H14A 3L4OD 2AGYA 2OVQB 2OVPB 1XHMA 3SMRA 2XL3A 3ORVD 3AL8A 5JWZA 5K19A 2GC4A 3EMHA 5CXBB 3PE7A 3UVKA 5IGOA 4L9OA 4J8GA 2J56H 4FAVD 5EMLB 5EARA 2OVRB 4X63B 3UVLA 4CZXA 4LG8A 5EAPA 1PEVA 4J0WA 1K8KC 4QT8A 2AH0A 1VYHC 5CXCA 1OMWB 2Z2PA 3I2NA 4JT5C 2H6KA 2XU7A 4CI1A 4J82A 3FRXA 4UI9R 2OK6A 5EMMB 3FM0A 4D0KA 1PBYB 3EI4A 5FLXg 4A08B 2UZYB 4J79A 4OZUA 2CE8A 1MDAH 2P9UC 3PSLA 3C99A 3EWEA 4LG9A 4QQEA 5EMJB 4A11A 4FAND 4O3TB 3FGBA 4I79A 4IA9A 4FA1D 3JAMg 1N6FA 4H5JA 4GGAA 2H14A 2B5MA 4XYHA 3UKUC 2J57G 5B4WA 2H6NA 5CYKA 4YVDA 3KRXB 3DM0A 3EI2B 3PVUB 4JXMA 3EI1B 3MKSB 3I7NA 4GM8A 3SFZA 4LGNA 4E5ZA 2P9LC 2Q7QA 3MXXA 2YNPA 4A7JA 4EWRA 1GOTB 3RSEC 3JZNA 2AQ5A 4X61B 4JD2C 4JT6C 5I5JA 5EM2A 4ESGA 4O1QD 5TEFA 4FA4D 4MK0B 2YNNA 4JSVC 2CNXA 3NVQA 4KFMB 5K1CC 4CY5A 5FKQA 2PM9A 3UVNA 4E54B 3HFQA 2P9PC 4BH6A 4GQ1A 5TDHB 3U4YA 3N0EA 2UZXB 3SBRA 4ZN4A 3AH8B 4CZVA 2CN2A 4FHLA 3DXMC 3CIKB 3V9FA 4ZOXA 5FQDA 3JZGA 5EMKB 2P9KC 4FA5D 5FKRA 3AL8B 5GXHA 3B7FA 4J86A 1N6DA 3NVXA 4XYIA 5CXCB 3UKRC 1JOFA 5HE0B 1S4UX 3V5WB 3J81g 4A09B 3L4MD 4O9DA 3MZKA 2BCJB 3F3PA 5THAA 3EI4B 3J80g 2GNQA 3OTTA 3IIYA 3RFGA 4JSPC 3I89A 4J73A 4O3UB 1R5MA 3EI3B 3C9CA 4GQBB 5IT9g 5H1MA 5HE1B 4A11B 1SQ9A 1SHYB 5C2VB 5HQGA 5I5IA 4K3ID 1XIPA 1TBGA 2HXCA 4D6VA 1U2VC 5CYKB 3IJ0A 5AMSA 1PI6A 3DXKC 1P22A 3K26A 4O45A 4FWWA 5H17A 1ERJA 3IKOA 4E5ZB 2IUVA 5HYNB 3N0DA 4L3GD 3RMZD 4ZOYA 1GXRA 2I0RA 2OK4A 4R7AB 4ZOZA 4XEIC 4J84A 4ZOVA 3VGZA 5EM2B 3EG6A 3OL2A 5EALA 5GMKn 2EBSA 2HKRA 3SCYA 4U1EI 4BUJC 2PM9B 2YNOA 3CFVA 4ES0A 2H9PA 4CY1A 5IC7A 5KDOB 4PNKB 3SVWD 5IJ7E 3IIWA 4FA9D 3RLMD 4QL1A 1QNIA 3OW8A 5C9ZB 4G56B 3MKQA 3IJ1A 3PSCB 3AFCA 3RN1D 4CZYA 3JRPA 4QRJA 3DSMA 3OKYB 4CI2A 3P4FA 4L1QD 5IGQA 1YFQA 2H68A 3EU7A 2AGWA 2P9NC 3PXSD 3AL9A 2I3TA 5HE3B 3KRWB 3I7KA 2H6QA 4L3HD 2CO0A 1A0RB 3E0CA 2H3XA 2I0SA 1GP2B 4J78A 3UR4A 3UVMA 2G99A 2Z2NA 5GXIA 4A0BA 4CC9A 3JZHA 3GFCA 1NEXB 1TYQC 4A2MA 1MG2A 3IJCA 4JSXC 2AGZA 2H9NA 4PXWA 3RN0D 3PVWB 3SLED 2B5LA 4GMBA 3I7HA 3SBPA 2IURA 1SQJA 4GM3A 4GQ2P 2H9LA 5C2WB 2AH1A 4E54A 5EAMA 3C5MA 3BG0A 2O9KA 2HKMA 4A0AA 3JPXA 2I0TA 3I7LA 3I8CA 4J77A 4GZ8A 3PXTD 3I7OA 3A0FA 3ODTA 4Y7RA 2HJ4A 2XL2A 2MTAH 4CY2A 4CI8A 2BBKH 2CN3A 4OWRA 3RRMC 3V7DB 2YB8B 3MZLA 3C75H 4ERQA 4CI3A 1JMZB 3VA6A 1FWXA 3I8EA 3OL2B 2PM6B 4PSWB 2TRCB 2AGLA 2HESX 1JMXB 2AGXA 4BL0A 4A09A 4HDJA 3F3FA 3UVOA 2P9IC 1XKSA 3ULEC 5CXBA 2H13A 3SN6B 4NSXA 4A2LA 2YMUA 4N14A 5A2Qg 4PC0A 1B9XA 4FB1D 3ZWLB 3EI3A 2IUQA 4GGDA 3JB9L 2OJYA 2H47A 5TEEA 3PXWD 4H5IA 4U7AA 3K27A 2G9AA 4X60B 5TF2A 1PGUA 3VH0A 3BWSA 5GSAA 4PBYA 2P9SC 4PBZA 5SXMA 2YBAA 4JSNC 1N6EA 3MMYA 5FKTA 4A08A 2HJBA 3OKWA 4J87A 2B4EA 2H9MA 1L0QA 2IWFA 4GGCA 4A0BB 3JROA 1JJUB 3SJLD 1MG3A 4GM9A 3GREA 3SWSD 2XYIA 3SXTD 2PM7B 1U4CA 3NVNA
chains in the Genus database with same CATH superfamily
2IUPA 3EI2A 4ERYA 4NBMA 4K3JB 2OIZA 5FXYA 3EI1A 3OKTA 3V4PA 1QFSA 4J0XA 2HU7A 3KCIA 1VZ3A 3BG1A 4ERZA 2QC5A 3T3MA 2B5NA 2W18A 3SHFA 4J81A 3I7PA 3MVDK 5I5MA 2VDMA 4CY3A 4X3EA 4A0AB 3SBQA 4UM8A 4WK2A 3CFSB 2I3SA 2PBIB 2Z2OA 5FA5B 3F3GA 1O6GA 2JKXA 5FKSA 2CE9A 4AEZA 1Q47A 4BCDA 2IAAA 3W15A 3DWLC 5AJAA 3OKYA 2VDOA 2WQ8A 4TZ4A 2QXVA 3RFHA 2J55H 5M5SA 4AOWA 1RI6A 4IMMA 2IWKA 4PSXB 4Z8LA 2HYEA 1NR0A 5AFU3 1K32A 3O4HA 4J8BA 4Y5RD 1GG2B 1B9YA 2GC7A 5HE2B 2CO0C 1QFMA 1OLZA 1YR2A 5IJ8E 2EIDA 3L4OD 5H14A 2AGYA 2OVQB 2OVPB 1XHMA 3SMRA 2XL3A 3ORVD 3AL8A 5JWZA 5K19A 2GC4A 3EMHA 5CXBB 3PE7A 3UVKA 5M5RA 5IGOA 4L9OA 2HU8A 4J8GA 3ZDYA 2J56H 4FAVD 2EIEA 5EMLB 5EARA 2OVRB 4X63B 3UVLA 4CZXA 4LG8A 5EAPA 1PEVA 1K8KC 4J0WA 4QT8A 3ZDZA 2AH0A 1VYHC 1L5GA 5CXCA 3IUMA 1OMWB 2Z2PA 3I2NA 4JT5C 2H6KA 2XU7A 4CI1A 4J82A 3FRXA 1C9LA 4UI9R 2OK6A 5EMMB 3FM0A 4D0KA 3MUOA 1PBYB 3EI4A 3V4VA 5FLXg 1UOQA 5HDBA 4A08B 1H2YA 4WK4A 2UZYB 4J79A 4OZUA 2CE8A 1MDAH 2P9UC 3PSLA 3C99A 3EWEA 4LG9A 4QQEA 4DNWA 5EMJB 4A11A 3FCUA 4FAND 4NAAA 4O3TB 3FGBA 4I79A 3FCSA 4IA9A 4FA1D 5C92A 3JAMg 1N6FA 4H5JA 1M1XA 4GGAA 2H14A 3VI4A 2B5MA 4XYHA 3IUNA 3UKUC 2J57G 5B4WA 2H6NA 5CYKA 4YVDA 3KRXB 3DM0A 3EI2B 1VE7A 3PVUB 4JXMA 3EI1B 3MKSB 3I7NA 4GM8A 3SFZA 3EQ7A 3EQ8A 4LGNA 2P9LC 4E5ZA 3DDUA 2Q7QA 3MXXA 2YNPA 1BPOA 3IURA 4A7JA 4EWRA 1GOTB 3T3PA 3RSEC 3JZNA 2AQ5A 4X61B 4JD2C 4JT6C 4G1EA 5I5JA 5FFOA 1E5TA 2VC2A 5EM2A 4ESGA 4O1QD 5TEFA 4FA4D 4Z7QA 4MK0B 1C9IA 3IJEA 1GOHA 2YNNA 4JSVC 2CNXA 3NVQA 4KFMB 5K1CC 1JV2A 4CY5A 5FKQA 3ZE1A 2PM9A 3UVNA 4E54B 3HFQA 1VZ2A 2P9PC 4BH6A 4GQ1A 5TDHB 3U4YA 3N0EA 2UZXB 3GD1I 3SBRA 4ZN4A 3AH8B 1UOOA 2CN2A 4CZVA 4FHLA 3DXMC 4DNUA 3CIKB 3V9FA 3O4IA 2EIBA 1H2XA 4ZOXA 5FQDA 3JZGA 5EMKB 2P9KC 4FA5D 5FKRA 3AL8B 1I2MB 5GXHA 3B7FA 3NIGA 4J86A 1E8NA 1N6DA 3NVXA 4XYIA 4BCCA 5CXCB 3UKRC 1JOFA 5HE0B 1S4UX 3V5WB 3J81g 4O2WA 4A09B 3NIFA 2VDNA 3L4MD 4O9DA 3MZKA 2BCJB 3F3PA 5THAA 3EI4B 3J80g 4QAMA 2GNQA 3OTTA 3IIYA 3RFGA 4JSPC 3I89A 4J73A 4O3UB 1R5MA 3EI3B 4MMYA 3C9CA 4GQBB 5IT9g 5H1MA 5HE1B 4A11B 1SQ9A 2HU5A 4MMXA 1SHYB 3MUNA 5C2VB 2VDPA 5HQGA 4NC4A 5I5IA 4K3ID 1XIPA 1TBGA 2HXCA 4D6VA 3QHYB 1U2VC 5CYKB 3IJ0A 4AN0A 5AMSA 1PI6A 4JHNA 3DXKC 1P22A 2QR5A 3K26A 4O45A 4FWWA 5H17A 1ERJA 3IKOA 4E5ZB 2IUVA 5HYNB 3N0DA 4L3GD 3RMZD 3IUJA 4ZOYA 1GXRA 2I0RA 3IUQA 2OK4A 4R7AB 2XE4A 4ZOZA 4XEIC 4J84A 4ZOVA 3VGZA 5EM2B 2VDKA 3QI0A 3EG6A 3OL2A 5M61A 5EALA 3ZE2A 5GMKn 1TYEA 2EBSA 2QZPA 4O02A 2HKRA 3SCYA 3K6SA 1UOPA 4U1EI 4G1MA 4BUJC 1E8MA 2PM9B 2YNOA 3CFVA 4ES0A 2H9PA 4CY1A 5IC7A 5KDOB 1O6FA 4PNKB 4Z7NA 3GC3B 3SVWD 5IJ7E 3IIWA 4FA9D 3RLMD 4QL1A 1QNIA 3OW8A 3IVMA 2XDWA 5C9ZB 4G56B 3MKQA 3IJ1A 3PSCB 3AFCA 3RN1D 4CZYA 1T2XA 1U8CA 3JRPA 1H2WA 4QRJA 3DSMA 3OKYB 4CI2A 3P4FA 4L1QD 5IGQA 1JTDB 1YFQA 2H68A 3EU7A 4L1MA 2AGWA 2P9NC 3IULA 4NENA 3PXSD 4WJKA 3AL9A 2I3TA 1VE6A 5HE3B 3KRWB 3I7KA 4AX4A 4RE6A 2H6QA 4L3HD 2CO0A 4D9SA 1A0RB 3E0CA 2H3XA 2I0SA 1GP2B 4J78A 3UR4A 3UVMA 1UTCA 2G99A 2Z2NA 5GXIA 3VI3A 3EQ9A 4A0BA 2VDQA 4CC9A 4RE5A 3JZHA 3K72A 4JHPC 3GFCA 1NEXB 1TYQC 4A2MA 1MG2A 4AMZA 3IJCA 4JSXC 2AGZA 2H9NA 3O4JA 4PXWA 3RN0D 3PVWB 3SLED 2B5LA 4GMBA 3I7HA 5E6RA 3SBPA 2IURA 1SQJA 4GM3A 4GQ2P 5E6SA 2H9LA 5C2WB 3ZE0A 2AH1A 3O4GA 5FFGA 4E54A 5EAMA 3C5MA 3BG0A 2BKLA 2O9KA 2HKMA 4A0AA 3JPXA 2VZ1A 2I0TA 3I7LA 3I8CA 4J77A 1GOFA 2EICA 3PXTD 4GZ8A 3I7OA 3A0FA 3ODTA 4Y7RA 2HJ4A 2XL2A 2MTAH 1K3IA 4CY2A 4CI8A 2BBKH 2CN3A 4OWRA 4G55A 3RRMC 3V7DB 5M5UA 2YB8B 3MZLA 3C75H 4ERQA 4CI3A 4UM9A 1JMZB 3VA6A 1FWXA 3I8EA 3OL2B 4Z7OA 4BP8A 2PM6B 4PSWB 4AMYA 2TRCB 2AGLA 2HESX 1JMXB 2AGXA 4BL0A 4A09A 3NIDA 4HDJA 4DNVA 3F3FA 4AN1A 3UVOA 1H2ZA 2P9IC 1XKSA 3ULEC 5CXBA 2H13A 3SN6B 4NSXA 4A2LA 5C86A 2YMUA 4N14A 5A2Qg 4PC0A 1B9XA 4MMZA 4FB1D 3ZWLB 4WK0A 3EI3A 3ZDXA 2IUQA 4GGDA 3JB9L 2OJYA 1A12A 2H47A 5TEEA 3PXWD 5M5TA 4H5IA 4U7AA 3K27A 2G9AA 4X60B 5TF2A 2VZ3A 4IRZA 1PGUA 2VDLA 3K71A 3BWSA 5GSAA 3VH0A 4PBYA 2P9SC 4PBZA 5SXMA 2YBAA 4JSNC 1N6EA 3MMYA 5FKTA 2VDRA 4A08A 2HJBA 5E6UA 3OKWA 4BCBA 4J87A 2B4EA 2H9MA 5M5VA 1L0QA 2IWFA 4GGCA 4A0BB 1GOGA 3JROA 1JJUB 3SJLD 1MG3A 2XZGA 4GM9A 3GREA 3SWSD 2XYIA 3SXTD 4BP9A 3OF7A 2PM7B 1U4CA 3NVNA
chains in the Genus database with same CATH topology
2IUPA 3EI2A 4ERYA 4K3JB 2OIZA 5FXYA 3EI1A 3OKTA 4J0XA 3BG1A 4ERZA 2QC5A 2B5NA 2W18A 3SHFA 4J81A 3I7PA 5I5MA 4CY3A 4X3EA 4A0AB 3SBQA 3CFSB 2I3SA 2PBIB 2Z2OA 5FA5B 3F3GA 5FKSA 2CE9A 4AEZA 1Q47A 2IAAA 3W15A 3DWLC 5AJAA 3OKYA 4TZ4A 2QXVA 3RFHA 2J55H 4AOWA 1RI6A 4IMMA 2IWKA 4PSXB 4Z8LA 2HYEA 1NR0A 5AFU3 1K32A 4J8BA 4Y5RD 1GG2B 1B9YA 2GC7A 5HE2B 2CO0C 1OLZA 5IJ8E 5H14A 3L4OD 2AGYA 2OVQB 2OVPB 1XHMA 3SMRA 2XL3A 3ORVD 3AL8A 5JWZA 5K19A 2GC4A 3EMHA 5CXBB 3PE7A 3UVKA 5IGOA 4L9OA 4J8GA 2J56H 4FAVD 5EMLB 5EARA 2OVRB 4X63B 3UVLA 4CZXA 4LG8A 5EAPA 1PEVA 4J0WA 1K8KC 4QT8A 2AH0A 1VYHC 5CXCA 1OMWB 2Z2PA 3I2NA 4JT5C 2H6KA 2XU7A 4CI1A 4J82A 3FRXA 4UI9R 2OK6A 5EMMB 3FM0A 4D0KA 1PBYB 3EI4A 5FLXg 4A08B 2UZYB 4J79A 4OZUA 2CE8A 1MDAH 2P9UC 3PSLA 3C99A 3EWEA 4LG9A 4QQEA 5EMJB 4A11A 4FAND 4O3TB 3FGBA 4I79A 4IA9A 4FA1D 3JAMg 1N6FA 4H5JA 4GGAA 2H14A 2B5MA 4XYHA 3UKUC 2J57G 5B4WA 2H6NA 5CYKA 4YVDA 3KRXB 3DM0A 3EI2B 3PVUB 4JXMA 3EI1B 3MKSB 3I7NA 4GM8A 3SFZA 4LGNA 4E5ZA 2P9LC 2Q7QA 3MXXA 2YNPA 4A7JA 4EWRA 1GOTB 3RSEC 3JZNA 2AQ5A 4X61B 4JD2C 4JT6C 5I5JA 5EM2A 4ESGA 4O1QD 5TEFA 4FA4D 4MK0B 2YNNA 4JSVC 2CNXA 3NVQA 4KFMB 5K1CC 4CY5A 5FKQA 2PM9A 3UVNA 4E54B 3HFQA 2P9PC 4BH6A 4GQ1A 5TDHB 3U4YA 3N0EA 2UZXB 3SBRA 4ZN4A 3AH8B 4CZVA 2CN2A 4FHLA 3DXMC 3CIKB 3V9FA 4ZOXA 5FQDA 3JZGA 5EMKB 2P9KC 4FA5D 5FKRA 3AL8B 5GXHA 3B7FA 4J86A 1N6DA 3NVXA 4XYIA 5CXCB 3UKRC 1JOFA 5HE0B 1S4UX 3V5WB 3J81g 4A09B 3L4MD 4O9DA 3MZKA 2BCJB 3F3PA 5THAA 3EI4B 3J80g 2GNQA 3OTTA 3IIYA 3RFGA 4JSPC 3I89A 4J73A 4O3UB 1R5MA 3EI3B 3C9CA 4GQBB 5IT9g 5H1MA 5HE1B 4A11B 1SQ9A 1SHYB 5C2VB 5HQGA 5I5IA 4K3ID 1XIPA 1TBGA 2HXCA 4D6VA 1U2VC 5CYKB 3IJ0A 5AMSA 1PI6A 3DXKC 1P22A 3K26A 4O45A 4FWWA 5H17A 1ERJA 3IKOA 4E5ZB 2IUVA 5HYNB 3N0DA 4L3GD 3RMZD 4ZOYA 1GXRA 2I0RA 2OK4A 4R7AB 4ZOZA 4XEIC 4J84A 4ZOVA 3VGZA 5EM2B 3EG6A 3OL2A 5EALA 5GMKn 2EBSA 2HKRA 3SCYA 4U1EI 4BUJC 2PM9B 2YNOA 3CFVA 4ES0A 2H9PA 4CY1A 5IC7A 5KDOB 4PNKB 3SVWD 5IJ7E 3IIWA 4FA9D 3RLMD 4QL1A 1QNIA 3OW8A 5C9ZB 4G56B 3MKQA 3IJ1A 3PSCB 3AFCA 3RN1D 4CZYA 3JRPA 4QRJA 3DSMA 3OKYB 4CI2A 3P4FA 4L1QD 5IGQA 1YFQA 2H68A 3EU7A 2AGWA 2P9NC 3PXSD 3AL9A 2I3TA 5HE3B 3KRWB 3I7KA 2H6QA 4L3HD 2CO0A 1A0RB 3E0CA 2H3XA 2I0SA 1GP2B 4J78A 3UR4A 3UVMA 2G99A 2Z2NA 5GXIA 4A0BA 4CC9A 3JZHA 3GFCA 1NEXB 1TYQC 4A2MA 1MG2A 3IJCA 4JSXC 2AGZA 2H9NA 4PXWA 3RN0D 3PVWB 3SLED 2B5LA 4GMBA 3I7HA 3SBPA 2IURA 1SQJA 4GM3A 4GQ2P 2H9LA 5C2WB 2AH1A 4E54A 5EAMA 3C5MA 3BG0A 2O9KA 2HKMA 4A0AA 3JPXA 2I0TA 3I7LA 3I8CA 4J77A 4GZ8A 3PXTD 3I7OA 3A0FA 3ODTA 4Y7RA 2HJ4A 2XL2A 2MTAH 4CY2A 4CI8A 2BBKH 2CN3A 4OWRA 3RRMC 3V7DB 2YB8B 3MZLA 3C75H 4ERQA 4CI3A 1JMZB 3VA6A 1FWXA 3I8EA 3OL2B 2PM6B 4PSWB 2TRCB 2AGLA 2HESX 1JMXB 2AGXA 4BL0A 4A09A 4HDJA 3F3FA 3UVOA 2P9IC 1XKSA 3ULEC 5CXBA 2H13A 3SN6B 4NSXA 4A2LA 2YMUA 4N14A 5A2Qg 4PC0A 1B9XA 4FB1D 3ZWLB 3EI3A 2IUQA 4GGDA 3JB9L 2OJYA 2H47A 5TEEA 3PXWD 4H5IA 4U7AA 3K27A 2G9AA 4X60B 5TF2A 1PGUA 3VH0A 3BWSA 5GSAA 4PBYA 2P9SC 4PBZA 5SXMA 2YBAA 4JSNC 1N6EA 3MMYA 5FKTA 4A08A 2HJBA 3OKWA 4J87A 2B4EA 2H9MA 1L0QA 2IWFA 4GGCA 4A0BB 3JROA 1JJUB 3SJLD 1MG3A 4GM9A 3GREA 3SWSD 2XYIA 3SXTD 2PM7B 1U4CA 3NVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUP A;  3EI2 A;  4ERY A;  4K3J B;  2OIZ A;  5FXY A;  3EI1 A;  3OKT A;  4J0X A;  3BG1 A;  4ERZ A;  2QC5 A;  2B5N A;  2W18 A;  3SHF A;  4J81 A;  3I7P A;  5I5M A;  4CY3 A;  4X3E A;  4A0A B;  3SBQ A;  3CFS B;  2I3S A;  2PBI B;  2Z2O A;  5FA5 B;  3F3G A;  5FKS A;  2CE9 A;  4AEZ A;  1Q47 A;  2IAA A;  3W15 A;  3DWL C;  5AJA A;  3OKY A;  4TZ4 A;  2QXV A;  3RFH A;  2J55 H;  4AOW A;  1RI6 A;  4IMM A;  2IWK A;  4PSX B;  4Z8L A;  2HYE A;  1NR0 A;  5AFU 3;  1K32 A;  4J8B A;  4Y5R D;  1GG2 B;  1B9Y A;  2GC7 A;  5HE2 B;  2CO0 C;  1OLZ A;  5IJ8 E;  5H14 A;  3L4O D;  2AGY A;  2OVQ B;  2OVP B;  1XHM A;  3SMR A;  2XL3 A;  3ORV D;  3AL8 A;  5JWZ A;  5K19 A;  2GC4 A;  3EMH A;  5CXB B;  3PE7 A;  3UVK A;  5IGO A;  4L9O A;  4J8G A;  2J56 H;  4FAV D;  5EML B;  5EAR A;  2OVR B;  4X63 B;  3UVL A;  4CZX A;  4LG8 A;  5EAP A;  1PEV A;  4J0W A;  1K8K C;  4QT8 A;  2AH0 A;  1VYH C;  5CXC A;  1OMW B;  2Z2P A;  3I2N A;  4JT5 C;  2H6K A;  2XU7 A;  4CI1 A;  4J82 A;  3FRX A;  4UI9 R;  2OK6 A;  5EMM B;  3FM0 A;  4D0K A;  1PBY B;  3EI4 A;  5FLX g;  4A08 B;  2UZY B;  4J79 A;  4OZU A;  2CE8 A;  1MDA H;  2P9U C;  3PSL A;  3C99 A;  3EWE A;  4LG9 A;  4QQE A;  5EMJ B;  4A11 A;  4FAN D;  4O3T B;  3FGB A;  4I79 A;  4IA9 A;  4FA1 D;  3JAM g;  1N6F A;  4H5J A;  4GGA A;  2H14 A;  2B5M A;  4XYH A;  3UKU C;  2J57 G;  5B4W A;  2H6N A;  5CYK A;  4YVD A;  3KRX B;  3DM0 A;  3EI2 B;  3PVU B;  4JXM A;  3EI1 B;  3MKS B;  3I7N A;  4GM8 A;  3SFZ A;  4LGN A;  4E5Z A;  2P9L C;  2Q7Q A;  3MXX A;  2YNP A;  4A7J A;  4EWR A;  1GOT B;  3RSE C;  3JZN A;  2AQ5 A;  4X61 B;  4JD2 C;  4JT6 C;  5I5J A;  5EM2 A;  4ESG A;  4O1Q D;  5TEF A;  4FA4 D;  4MK0 B;  2YNN A;  4JSV C;  2CNX A;  3NVQ A;  4KFM B;  5K1C C;  4CY5 A;  5FKQ A;  2PM9 A;  3UVN A;  4E54 B;  3HFQ A;  2P9P C;  4BH6 A;  4GQ1 A;  5TDH B;  3U4Y A;  3N0E A;  2UZX B;  3SBR A;  4ZN4 A;  3AH8 B;  4CZV A;  2CN2 A;  4FHL A;  3DXM C;  3CIK B;  3V9F A;  4ZOX A;  5FQD A;  3JZG A;  5EMK B;  2P9K C;  4FA5 D;  5FKR A;  3AL8 B;  5GXH A;  3B7F A;  4J86 A;  1N6D A;  3NVX A;  4XYI A;  5CXC B;  3UKR C;  1JOF A;  5HE0 B;  1S4U X;  3V5W B;  3J81 g;  4A09 B;  3L4M D;  4O9D A;  3MZK A;  2BCJ B;  3F3P A;  5THA A;  3EI4 B;  3J80 g;  2GNQ A;  3OTT A;  3IIY A;  3RFG A;  4JSP C;  3I89 A;  4J73 A;  4O3U B;  1R5M A;  3EI3 B;  3C9C A;  4GQB B;  5IT9 g;  5H1M A;  5HE1 B;  4A11 B;  1SQ9 A;  1SHY B;  5C2V B;  5HQG A;  5I5I A;  4K3I D;  1XIP A;  1TBG A;  2HXC A;  4D6V A;  1U2V C;  5CYK B;  3IJ0 A;  5AMS A;  1PI6 A;  3DXK C;  1P22 A;  3K26 A;  4O45 A;  4FWW A;  5H17 A;  1ERJ A;  3IKO A;  4E5Z B;  2IUV A;  5HYN B;  3N0D A;  4L3G D;  3RMZ D;  4ZOY A;  1GXR A;  2I0R A;  2OK4 A;  4R7A B;  4ZOZ A;  4XEI C;  4J84 A;  4ZOV A;  3VGZ A;  5EM2 B;  3EG6 A;  3OL2 A;  5EAL A;  5GMK n;  2EBS A;  2HKR A;  3SCY A;  4U1E I;  4BUJ C;  2PM9 B;  2YNO A;  3CFV A;  4ES0 A;  2H9P A;  4CY1 A;  5IC7 A;  5KDO B;  4PNK B;  3SVW D;  5IJ7 E;  3IIW A;  4FA9 D;  3RLM D;  4QL1 A;  1QNI A;  3OW8 A;  5C9Z B;  4G56 B;  3MKQ A;  3IJ1 A;  3PSC B;  3AFC A;  3RN1 D;  4CZY A;  3JRP A;  4QRJ A;  3DSM A;  3OKY B;  4CI2 A;  3P4F A;  4L1Q D;  5IGQ A;  1YFQ A;  2H68 A;  3EU7 A;  2AGW A;  2P9N C;  3PXS D;  3AL9 A;  2I3T A;  5HE3 B;  3KRW B;  3I7K A;  2H6Q A;  4L3H D;  2CO0 A;  1A0R B;  3E0C A;  2H3X A;  2I0S A;  1GP2 B;  4J78 A;  3UR4 A;  3UVM A;  2G99 A;  2Z2N A;  5GXI A;  4A0B A;  4CC9 A;  3JZH A;  3GFC A;  1NEX B;  1TYQ C;  4A2M A;  1MG2 A;  3IJC A;  4JSX C;  2AGZ A;  2H9N A;  4PXW A;  3RN0 D;  3PVW B;  3SLE D;  2B5L A;  4GMB A;  3I7H A;  3SBP A;  2IUR A;  1SQJ A;  4GM3 A;  4GQ2 P;  2H9L A;  5C2W B;  2AH1 A;  4E54 A;  5EAM A;  3C5M A;  3BG0 A;  2O9K A;  2HKM A;  4A0A A;  3JPX A;  2I0T A;  3I7L A;  3I8C A;  4J77 A;  4GZ8 A;  3PXT D;  3I7O A;  3A0F A;  3ODT A;  4Y7R A;  2HJ4 A;  2XL2 A;  2MTA H;  4CY2 A;  4CI8 A;  2BBK H;  2CN3 A;  4OWR A;  3RRM C;  3V7D B;  2YB8 B;  3MZL A;  3C75 H;  4ERQ A;  4CI3 A;  1JMZ B;  3VA6 A;  1FWX A;  3I8E A;  3OL2 B;  2PM6 B;  4PSW B;  2TRC B;  2AGL A;  2HES X;  1JMX B;  2AGX A;  4BL0 A;  4A09 A;  4HDJ A;  3F3F A;  3UVO A;  2P9I C;  1XKS A;  3ULE C;  5CXB A;  2H13 A;  3SN6 B;  4NSX A;  4A2L A;  2YMU A;  4N14 A;  5A2Q g;  4PC0 A;  1B9X A;  4FB1 D;  3ZWL B;  3EI3 A;  2IUQ A;  4GGD A;  3JB9 L;  2OJY A;  2H47 A;  5TEE A;  3PXW D;  4H5I A;  4U7A A;  3K27 A;  2G9A A;  4X60 B;  5TF2 A;  1PGU A;  3VH0 A;  3BWS A;  5GSA A;  4PBY A;  2P9S C;  4PBZ A;  5SXM A;  2YBA A;  4JSN C;  1N6E A;  3MMY A;  5FKT A;  4A08 A;  2HJB A;  3OKW A;  4J87 A;  2B4E A;  2H9M A;  1L0Q A;  2IWF A;  4GGC A;  4A0B B;  3JRO A;  1JJU B;  3SJL D;  1MG3 A;  4GM9 A;  3GRE A;  3SWS D;  2XYI A;  3SXT D;  2PM7 B;  1U4C A;  3NVN A; 
#chains in the Genus database with same CATH topology
 2IUP A;  3EI2 A;  4ERY A;  4NBM A;  4K3J B;  2OIZ A;  5FXY A;  3EI1 A;  3OKT A;  3V4P A;  1QFS A;  4J0X A;  2HU7 A;  3KCI A;  1VZ3 A;  3BG1 A;  4ERZ A;  2QC5 A;  3T3M A;  2B5N A;  2W18 A;  3SHF A;  4J81 A;  3I7P A;  3MVD K;  5I5M A;  2VDM A;  4CY3 A;  4X3E A;  4A0A B;  3SBQ A;  4UM8 A;  4WK2 A;  3CFS B;  2I3S A;  2PBI B;  2Z2O A;  5FA5 B;  3F3G A;  1O6G A;  2JKX A;  5FKS A;  2CE9 A;  4AEZ A;  1Q47 A;  4BCD A;  2IAA A;  3W15 A;  3DWL C;  5AJA A;  3OKY A;  2VDO A;  2WQ8 A;  4TZ4 A;  2QXV A;  3RFH A;  2J55 H;  5M5S A;  4AOW A;  1RI6 A;  4IMM A;  2IWK A;  4PSX B;  4Z8L A;  2HYE A;  1NR0 A;  5AFU 3;  1K32 A;  3O4H A;  4J8B A;  4Y5R D;  1GG2 B;  1B9Y A;  2GC7 A;  5HE2 B;  2CO0 C;  1QFM A;  1OLZ A;  1YR2 A;  5IJ8 E;  2EID A;  3L4O D;  5H14 A;  2AGY A;  2OVQ B;  2OVP B;  1XHM A;  3SMR A;  2XL3 A;  3ORV D;  3AL8 A;  5JWZ A;  5K19 A;  2GC4 A;  3EMH A;  5CXB B;  3PE7 A;  3UVK A;  5M5R A;  5IGO A;  4L9O A;  2HU8 A;  4J8G A;  3ZDY A;  2J56 H;  4FAV D;  2EIE A;  5EML B;  5EAR A;  2OVR B;  4X63 B;  3UVL A;  4CZX A;  4LG8 A;  5EAP A;  1PEV A;  1K8K C;  4J0W A;  4QT8 A;  3ZDZ A;  2AH0 A;  1VYH C;  1L5G A;  5CXC A;  3IUM A;  1OMW B;  2Z2P A;  3I2N A;  4JT5 C;  2H6K A;  2XU7 A;  4CI1 A;  4J82 A;  3FRX A;  1C9L A;  4UI9 R;  2OK6 A;  5EMM B;  3FM0 A;  4D0K A;  3MUO A;  1PBY B;  3EI4 A;  3V4V A;  5FLX g;  1UOQ A;  5HDB A;  4A08 B;  1H2Y A;  4WK4 A;  2UZY B;  4J79 A;  4OZU A;  2CE8 A;  1MDA H;  2P9U C;  3PSL A;  3C99 A;  3EWE A;  4LG9 A;  4QQE A;  4DNW A;  5EMJ B;  4A11 A;  3FCU A;  4FAN D;  4NAA A;  4O3T B;  3FGB A;  4I79 A;  3FCS A;  4IA9 A;  4FA1 D;  5C92 A;  3JAM g;  1N6F A;  4H5J A;  1M1X A;  4GGA A;  2H14 A;  3VI4 A;  2B5M A;  4XYH A;  3IUN A;  3UKU C;  2J57 G;  5B4W A;  2H6N A;  5CYK A;  4YVD A;  3KRX B;  3DM0 A;  3EI2 B;  1VE7 A;  3PVU B;  4JXM A;  3EI1 B;  3MKS B;  3I7N A;  4GM8 A;  3SFZ A;  3EQ7 A;  3EQ8 A;  4LGN A;  2P9L C;  4E5Z A;  3DDU A;  2Q7Q A;  3MXX A;  2YNP A;  1BPO A;  3IUR A;  4A7J A;  4EWR A;  1GOT B;  3T3P A;  3RSE C;  3JZN A;  2AQ5 A;  4X61 B;  4JD2 C;  4JT6 C;  4G1E A;  5I5J A;  5FFO A;  1E5T A;  2VC2 A;  5EM2 A;  4ESG A;  4O1Q D;  5TEF A;  4FA4 D;  4Z7Q A;  4MK0 B;  1C9I A;  3IJE A;  1GOH A;  2YNN A;  4JSV C;  2CNX A;  3NVQ A;  4KFM B;  5K1C C;  1JV2 A;  4CY5 A;  5FKQ A;  3ZE1 A;  2PM9 A;  3UVN A;  4E54 B;  3HFQ A;  1VZ2 A;  2P9P C;  4BH6 A;  4GQ1 A;  5TDH B;  3U4Y A;  3N0E A;  2UZX B;  3GD1 I;  3SBR A;  4ZN4 A;  3AH8 B;  1UOO A;  2CN2 A;  4CZV A;  4FHL A;  3DXM C;  4DNU A;  3CIK B;  3V9F A;  3O4I A;  2EIB A;  1H2X A;  4ZOX A;  5FQD A;  3JZG A;  5EMK B;  2P9K C;  4FA5 D;  5FKR A;  3AL8 B;  1I2M B;  5GXH A;  3B7F A;  3NIG A;  4J86 A;  1E8N A;  1N6D A;  3NVX A;  4XYI A;  4BCC A;  5CXC B;  3UKR C;  1JOF A;  5HE0 B;  1S4U X;  3V5W B;  3J81 g;  4O2W A;  4A09 B;  3NIF A;  2VDN A;  3L4M D;  4O9D A;  3MZK A;  2BCJ B;  3F3P A;  5THA A;  3EI4 B;  3J80 g;  4QAM A;  2GNQ A;  3OTT A;  3IIY A;  3RFG A;  4JSP C;  3I89 A;  4J73 A;  4O3U B;  1R5M A;  3EI3 B;  4MMY A;  3C9C A;  4GQB B;  5IT9 g;  5H1M A;  5HE1 B;  4A11 B;  1SQ9 A;  2HU5 A;  4MMX A;  1SHY B;  3MUN A;  5C2V B;  2VDP A;  5HQG A;  4NC4 A;  5I5I A;  4K3I D;  1XIP A;  1TBG A;  2HXC A;  4D6V A;  3QHY B;  1U2V C;  5CYK B;  3IJ0 A;  4AN0 A;  5AMS A;  1PI6 A;  4JHN A;  3DXK C;  1P22 A;  2QR5 A;  3K26 A;  4O45 A;  4FWW A;  5H17 A;  1ERJ A;  3IKO A;  4E5Z B;  2IUV A;  5HYN B;  3N0D A;  4L3G D;  3RMZ D;  3IUJ A;  4ZOY A;  1GXR A;  2I0R A;  3IUQ A;  2OK4 A;  4R7A B;  2XE4 A;  4ZOZ A;  4XEI C;  4J84 A;  4ZOV A;  3VGZ A;  5EM2 B;  2VDK A;  3QI0 A;  3EG6 A;  3OL2 A;  5M61 A;  5EAL A;  3ZE2 A;  5GMK n;  1TYE A;  2EBS A;  2QZP A;  4O02 A;  2HKR A;  3SCY A;  3K6S A;  1UOP A;  4U1E I;  4G1M A;  4BUJ C;  1E8M A;  2PM9 B;  2YNO A;  3CFV A;  4ES0 A;  2H9P A;  4CY1 A;  5IC7 A;  5KDO B;  1O6F A;  4PNK B;  4Z7N A;  3GC3 B;  3SVW D;  5IJ7 E;  3IIW A;  4FA9 D;  3RLM D;  4QL1 A;  1QNI A;  3OW8 A;  3IVM A;  2XDW A;  5C9Z B;  4G56 B;  3MKQ A;  3IJ1 A;  3PSC B;  3AFC A;  3RN1 D;  4CZY A;  1T2X A;  1U8C A;  3JRP A;  1H2W A;  4QRJ A;  3DSM A;  3OKY B;  4CI2 A;  3P4F A;  4L1Q D;  5IGQ A;  1JTD B;  1YFQ A;  2H68 A;  3EU7 A;  4L1M A;  2AGW A;  2P9N C;  3IUL A;  4NEN A;  3PXS D;  4WJK A;  3AL9 A;  2I3T A;  1VE6 A;  5HE3 B;  3KRW B;  3I7K A;  4AX4 A;  4RE6 A;  2H6Q A;  4L3H D;  2CO0 A;  4D9S A;  1A0R B;  3E0C A;  2H3X A;  2I0S A;  1GP2 B;  4J78 A;  3UR4 A;  3UVM A;  1UTC A;  2G99 A;  2Z2N A;  5GXI A;  3VI3 A;  3EQ9 A;  4A0B A;  2VDQ A;  4CC9 A;  4RE5 A;  3JZH A;  3K72 A;  4JHP C;  3GFC A;  1NEX B;  1TYQ C;  4A2M A;  1MG2 A;  4AMZ A;  3IJC A;  4JSX C;  2AGZ A;  2H9N A;  3O4J A;  4PXW A;  3RN0 D;  3PVW B;  3SLE D;  2B5L A;  4GMB A;  3I7H A;  5E6R A;  3SBP A;  2IUR A;  1SQJ A;  4GM3 A;  4GQ2 P;  5E6S A;  2H9L A;  5C2W B;  3ZE0 A;  2AH1 A;  3O4G A;  5FFG A;  4E54 A;  5EAM A;  3C5M A;  3BG0 A;  2BKL A;  2O9K A;  2HKM A;  4A0A A;  3JPX A;  2VZ1 A;  2I0T A;  3I7L A;  3I8C A;  4J77 A;  1GOF A;  2EIC A;  3PXT D;  4GZ8 A;  3I7O A;  3A0F A;  3ODT A;  4Y7R A;  2HJ4 A;  2XL2 A;  2MTA H;  1K3I A;  4CY2 A;  4CI8 A;  2BBK H;  2CN3 A;  4OWR A;  4G55 A;  3RRM C;  3V7D B;  5M5U A;  2YB8 B;  3MZL A;  3C75 H;  4ERQ A;  4CI3 A;  4UM9 A;  1JMZ B;  3VA6 A;  1FWX A;  3I8E A;  3OL2 B;  4Z7O A;  4BP8 A;  2PM6 B;  4PSW B;  4AMY A;  2TRC B;  2AGL A;  2HES X;  1JMX B;  2AGX A;  4BL0 A;  4A09 A;  3NID A;  4HDJ A;  4DNV A;  3F3F A;  4AN1 A;  3UVO A;  1H2Z A;  2P9I C;  1XKS A;  3ULE C;  5CXB A;  2H13 A;  3SN6 B;  4NSX A;  4A2L A;  5C86 A;  2YMU A;  4N14 A;  5A2Q g;  4PC0 A;  1B9X A;  4MMZ A;  4FB1 D;  3ZWL B;  4WK0 A;  3EI3 A;  3ZDX A;  2IUQ A;  4GGD A;  3JB9 L;  2OJY A;  1A12 A;  2H47 A;  5TEE A;  3PXW D;  5M5T A;  4H5I A;  4U7A A;  3K27 A;  2G9A A;  4X60 B;  5TF2 A;  2VZ3 A;  4IRZ A;  1PGU A;  2VDL A;  3K71 A;  3BWS A;  5GSA A;  3VH0 A;  4PBY A;  2P9S C;  4PBZ A;  5SXM A;  2YBA A;  4JSN C;  1N6E A;  3MMY A;  5FKT A;  2VDR A;  4A08 A;  2HJB A;  5E6U A;  3OKW A;  4BCB A;  4J87 A;  2B4E A;  2H9M A;  5M5V A;  1L0Q A;  2IWF A;  4GGC A;  4A0B B;  1GOG A;  3JRO A;  1JJU B;  3SJL D;  1MG3 A;  2XZG A;  4GM9 A;  3GRE A;  3SWS D;  2XYI A;  3SXT D;  4BP9 A;  3OF7 A;  2PM7 B;  1U4C A;  3NVN A; 
#chains in the Genus database with same CATH homology
 2IUP A;  3EI2 A;  4ERY A;  4K3J B;  2OIZ A;  5FXY A;  3EI1 A;  3OKT A;  4J0X A;  3BG1 A;  4ERZ A;  2QC5 A;  2B5N A;  2W18 A;  3SHF A;  4J81 A;  3I7P A;  5I5M A;  4CY3 A;  4X3E A;  4A0A B;  3SBQ A;  3CFS B;  2I3S A;  2PBI B;  2Z2O A;  5FA5 B;  3F3G A;  5FKS A;  2CE9 A;  4AEZ A;  1Q47 A;  2IAA A;  3W15 A;  3DWL C;  5AJA A;  3OKY A;  4TZ4 A;  2QXV A;  3RFH A;  2J55 H;  4AOW A;  1RI6 A;  4IMM A;  2IWK A;  4PSX B;  4Z8L A;  2HYE A;  1NR0 A;  5AFU 3;  1K32 A;  4J8B A;  4Y5R D;  1GG2 B;  1B9Y A;  2GC7 A;  5HE2 B;  2CO0 C;  1OLZ A;  5IJ8 E;  5H14 A;  3L4O D;  2AGY A;  2OVQ B;  2OVP B;  1XHM A;  3SMR A;  2XL3 A;  3ORV D;  3AL8 A;  5JWZ A;  5K19 A;  2GC4 A;  3EMH A;  5CXB B;  3PE7 A;  3UVK A;  5IGO A;  4L9O A;  4J8G A;  2J56 H;  4FAV D;  5EML B;  5EAR A;  2OVR B;  4X63 B;  3UVL A;  4CZX A;  4LG8 A;  5EAP A;  1PEV A;  4J0W A;  1K8K C;  4QT8 A;  2AH0 A;  1VYH C;  5CXC A;  1OMW B;  2Z2P A;  3I2N A;  4JT5 C;  2H6K A;  2XU7 A;  4CI1 A;  4J82 A;  3FRX A;  4UI9 R;  2OK6 A;  5EMM B;  3FM0 A;  4D0K A;  1PBY B;  3EI4 A;  5FLX g;  4A08 B;  2UZY B;  4J79 A;  4OZU A;  2CE8 A;  1MDA H;  2P9U C;  3PSL A;  3C99 A;  3EWE A;  4LG9 A;  4QQE A;  5EMJ B;  4A11 A;  4FAN D;  4O3T B;  3FGB A;  4I79 A;  4IA9 A;  4FA1 D;  3JAM g;  1N6F A;  4H5J A;  4GGA A;  2H14 A;  2B5M A;  4XYH A;  3UKU C;  2J57 G;  5B4W A;  2H6N A;  5CYK A;  4YVD A;  3KRX B;  3DM0 A;  3EI2 B;  3PVU B;  4JXM A;  3EI1 B;  3MKS B;  3I7N A;  4GM8 A;  3SFZ A;  4LGN A;  4E5Z A;  2P9L C;  2Q7Q A;  3MXX A;  2YNP A;  4A7J A;  4EWR A;  1GOT B;  3RSE C;  3JZN A;  2AQ5 A;  4X61 B;  4JD2 C;  4JT6 C;  5I5J A;  5EM2 A;  4ESG A;  4O1Q D;  5TEF A;  4FA4 D;  4MK0 B;  2YNN A;  4JSV C;  2CNX A;  3NVQ A;  4KFM B;  5K1C C;  4CY5 A;  5FKQ A;  2PM9 A;  3UVN A;  4E54 B;  3HFQ A;  2P9P C;  4BH6 A;  4GQ1 A;  5TDH B;  3U4Y A;  3N0E A;  2UZX B;  3SBR A;  4ZN4 A;  3AH8 B;  4CZV A;  2CN2 A;  4FHL A;  3DXM C;  3CIK B;  3V9F A;  4ZOX A;  5FQD A;  3JZG A;  5EMK B;  2P9K C;  4FA5 D;  5FKR A;  3AL8 B;  5GXH A;  3B7F A;  4J86 A;  1N6D A;  3NVX A;  4XYI A;  5CXC B;  3UKR C;  1JOF A;  5HE0 B;  1S4U X;  3V5W B;  3J81 g;  4A09 B;  3L4M D;  4O9D A;  3MZK A;  2BCJ B;  3F3P A;  5THA A;  3EI4 B;  3J80 g;  2GNQ A;  3OTT A;  3IIY A;  3RFG A;  4JSP C;  3I89 A;  4J73 A;  4O3U B;  1R5M A;  3EI3 B;  3C9C A;  4GQB B;  5IT9 g;  5H1M A;  5HE1 B;  4A11 B;  1SQ9 A;  1SHY B;  5C2V B;  5HQG A;  5I5I A;  4K3I D;  1XIP A;  1TBG A;  2HXC A;  4D6V A;  1U2V C;  5CYK B;  3IJ0 A;  5AMS A;  1PI6 A;  3DXK C;  1P22 A;  3K26 A;  4O45 A;  4FWW A;  5H17 A;  1ERJ A;  3IKO A;  4E5Z B;  2IUV A;  5HYN B;  3N0D A;  4L3G D;  3RMZ D;  4ZOY A;  1GXR A;  2I0R A;  2OK4 A;  4R7A B;  4ZOZ A;  4XEI C;  4J84 A;  4ZOV A;  3VGZ A;  5EM2 B;  3EG6 A;  3OL2 A;  5EAL A;  5GMK n;  2EBS A;  2HKR A;  3SCY A;  4U1E I;  4BUJ C;  2PM9 B;  2YNO A;  3CFV A;  4ES0 A;  2H9P A;  4CY1 A;  5IC7 A;  5KDO B;  4PNK B;  3SVW D;  5IJ7 E;  3IIW A;  4FA9 D;  3RLM D;  4QL1 A;  1QNI A;  3OW8 A;  5C9Z B;  4G56 B;  3MKQ A;  3IJ1 A;  3PSC B;  3AFC A;  3RN1 D;  4CZY A;  3JRP A;  4QRJ A;  3DSM A;  3OKY B;  4CI2 A;  3P4F A;  4L1Q D;  5IGQ A;  1YFQ A;  2H68 A;  3EU7 A;  2AGW A;  2P9N C;  3PXS D;  3AL9 A;  2I3T A;  5HE3 B;  3KRW B;  3I7K A;  2H6Q A;  4L3H D;  2CO0 A;  1A0R B;  3E0C A;  2H3X A;  2I0S A;  1GP2 B;  4J78 A;  3UR4 A;  3UVM A;  2G99 A;  2Z2N A;  5GXI A;  4A0B A;  4CC9 A;  3JZH A;  3GFC A;  1NEX B;  1TYQ C;  4A2M A;  1MG2 A;  3IJC A;  4JSX C;  2AGZ A;  2H9N A;  4PXW A;  3RN0 D;  3PVW B;  3SLE D;  2B5L A;  4GMB A;  3I7H A;  3SBP A;  2IUR A;  1SQJ A;  4GM3 A;  4GQ2 P;  2H9L A;  5C2W B;  2AH1 A;  4E54 A;  5EAM A;  3C5M A;  3BG0 A;  2O9K A;  2HKM A;  4A0A A;  3JPX A;  2I0T A;  3I7L A;  3I8C A;  4J77 A;  4GZ8 A;  3PXT D;  3I7O A;  3A0F A;  3ODT A;  4Y7R A;  2HJ4 A;  2XL2 A;  2MTA H;  4CY2 A;  4CI8 A;  2BBK H;  2CN3 A;  4OWR A;  3RRM C;  3V7D B;  2YB8 B;  3MZL A;  3C75 H;  4ERQ A;  4CI3 A;  1JMZ B;  3VA6 A;  1FWX A;  3I8E A;  3OL2 B;  2PM6 B;  4PSW B;  2TRC B;  2AGL A;  2HES X;  1JMX B;  2AGX A;  4BL0 A;  4A09 A;  4HDJ A;  3F3F A;  3UVO A;  2P9I C;  1XKS A;  3ULE C;  5CXB A;  2H13 A;  3SN6 B;  4NSX A;  4A2L A;  2YMU A;  4N14 A;  5A2Q g;  4PC0 A;  1B9X A;  4FB1 D;  3ZWL B;  3EI3 A;  2IUQ A;  4GGD A;  3JB9 L;  2OJY A;  2H47 A;  5TEE A;  3PXW D;  4H5I A;  4U7A A;  3K27 A;  2G9A A;  4X60 B;  5TF2 A;  1PGU A;  3VH0 A;  3BWS A;  5GSA A;  4PBY A;  2P9S C;  4PBZ A;  5SXM A;  2YBA A;  4JSN C;  1N6E A;  3MMY A;  5FKT A;  4A08 A;  2HJB A;  3OKW A;  4J87 A;  2B4E A;  2H9M A;  1L0Q A;  2IWF A;  4GGC A;  4A0B B;  3JRO A;  1JJU B;  3SJL D;  1MG3 A;  4GM9 A;  3GRE A;  3SWS D;  2XYI A;  3SXT D;  2PM7 B;  1U4C A;  3NVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...