2H9NA

Wdr5 in complex with monomethylated h3k4 peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, gene regulation
total genus 96
structure length 304
sequence length 304
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h9nA00
1XIPA 3FM0A 3PVWB 5CXCA 4ERYA 4J86A 5TF2A 4O3TB 1MG2A 2AGLA 2HESX 2Z2OA 2YNNA 4HDJA 2G9AA 2HYEA 1QNIA 4R7AB 2OK4A 4J77A 2CO0A 4J78A 1XKSA 2P9LC 4JT5C 5JWZA 4ES0A 1NR0A 3PSLA 3I8EA 2J55H 2CN2A 4D0KA 4X3EA 5C9ZB 3OKTA 3DWLC 4PXWA 4GGDA 2B4EA 3OL2B 1JOFA 2H9MA 3EI4A 2H3XA 2CNXA 4O1QD 4LG9A 2I3SA 4CY1A 2Z2PA 3EMHA 2AGYA 3JPXA 4JSPC 1JJUB 3GFCA 5H14A 3CFSB 3NVNA 1PBYB 4NSXA 3I7KA 3N0EA 1SQJA 3UVLA 3IJCA 2XL3A 3SN6B 3F3GA 3MXXA 4A11B 2P9IC 2XYIA 4BH6A 2XL2A 5GMKn 4QRJA 4XEIC 5I5MA 1JMXB 4A11A 4JSVC 2PM7B 4QQEA 1N6DA 3GREA 1FWXA 3BWSA 3RFHA 3KRWB 4A2LA 3SVWD 3EU7A 3RMZD 5AMSA 2AGWA 1B9XA 3IKOA 3ZWLB 2IUQA 4FA9D 4UI9R 5EMJB 4A09B 2OJYA 2J57G 3DXKC 1B9YA 2YNOA 4JXMA 2H6QA 4A09A 3V9FA 2IURA 4K3ID 3RLMD 3CIKB 3ORVD 5TEEA 3C5MA 3SLED 5I5JA 5AFU3 2PBIB 3MZLA 1PI6A 1SHYB 3N0DA 3PXWD 3RSEC 4J84A 1R5MA 4J81A 3CFVA 3F3PA 2IAAA 5CYKA 3I7PA 2H47A 5EAMA 4PC0A 4PBZA 4FHLA 4ZN4A 3I7NA 4OWRA 3J81g 3JB9L 2H9PA 4GZ8A 4O45A 2H9NA 3PXSD 3HFQA 3L4OD 3SBPA 5EALA 3JZNA 3IJ1A 5EMLB 3I7OA 4XYHA 5THAA 4Y7RA 2I0TA 4K3JB 3VGZA 4E5ZB 4OZUA 3DXMC 3J80g 1NEXB 3IJ0A 5IJ7E 3U4YA 2H6NA 4G56B 5FA5B 3UKUC 3ODTA 4ZOXA 3JROA 2TRCB 2OIZA 2Z2NA 3EI3B 3EI1B 5H17A 4CZXA 3MMYA 5A2Qg 4GQBB 4AOWA 3EG6A 3RFGA 2OVQB 5IC7A 2BCJB 3UR4A 3ULEC 5GXHA 5H1MA 5HE3B 2G99A 4CZYA 2YBAA 3OL2A 2H9LA 4J79A 3DSMA 4JT6C 2H6KA 4MK0B 2AGZA 3AFCA 3DM0A 1ERJA 4H5IA 3A0FA 2OVRB 4J8BA 3VH0A 2P9KC 3MKQA 4GMBA 3L4MD 3PXTD 1SQ9A 5EARA 4BL0A 1VYHC 3C9CA 3AL9A 4J8GA 3OKYB 3BG0A 3JZGA 3BG1A 3PVUB 1GP2B 5EAPA 4CI3A 1U4CA 4IMMA 3OKYA 2B5NA 4A2MA 3F3FA 3JRPA 4I79A 3P4FA 2YB8B 5CXBB 4J87A 1YFQA 1U2VC 1MDAH 5FKSA 5CXBA 3E0CA 4CY5A 3UVOA 3I8CA 1L0QA 3FGBA 2I0RA 4YVDA 4FB1D 3C99A 2OVPB 5HQGA 3C75H 1K32A 4X61B 2O9KA 4J0XA 5TEFA 5AJAA 1TYQC 1OLZA 5FKTA 4L3HD 4FA4D 3OKWA 3NVXA 4N14A 4FA5D 5HE0B 3SCYA 5EM2B 5C2WB 5K19A 1GG2B 3B7FA 2PM9B 4A0BB 2I3TA 5EM2A 4L3GD 3SBRA 2PM9A 4A0BA 3NVQA 2P9NC 5C2VB 3JZHA 1K8KC 2AQ5A 2UZYB 2CO0C 4GM8A 4EWRA 2AH1A 4Y5RD 3SWSD 4GGAA 3W15A 4J82A 4ESGA 2GC7A 4CY2A 4ZOZA 4U1EI 3SJLD 1OMWB 5FQDA 2HKRA 3V7DB 2YMUA 4A7JA 2IUPA 4L1QD 3KRXB 4H5JA 3OTTA 3IIWA 4GQ1A 4QT8A 4E54B 3VA6A 3UVMA 3MZKA 5HYNB 2B5MA 4E5ZA 4AEZA 4BUJC 4E54A 2AGXA 4CI2A 3AL8B 4O9DA 2UZXB 3UVNA 3AL8A 1JMZB 3EI3A 5IGQA 2BBKH 5EMKB 3EI1A 5SXMA 1MG3A 4U7AA 4ERZA 4KFMB 1XHMA 3SHFA 2QXVA 2P9SC 4FA1D 1Q47A 2HKMA 5IJ8E 2H13A 1N6EA 4X60B 3FRXA 1S4UX 4PNKB 4FAVD 3K26A 3PSCB 5HE2B 3SFZA 4FWWA 1P22A 4CZVA 3RRMC 2AH0A 5B4WA 1GOTB 4QL1A 4TZ4A 3EI4B 2YNPA 4IA9A 4LG8A 4J0WA 3EWEA 2MTAH 4CC9A 4ERQA 5IGOA 4JD2C 2PM6B 2Q7QA 3I7LA 4A0AB 2I0SA 5EMMB 2H68A 5I5IA 4PSXB 4O3UB 4LGNA 3IIYA 2P9UC 3SMRA 4PSWB 1TBGA 4A0AA 4GM3A 5GSAA 4D6VA 3RN0D 2P9PC 4CI1A 1RI6A 3I7HA 2HJBA 4JSXC 1GXRA 3UVKA 4GQ2P 3OW8A 1A0RB 5HE1B 2EBSA 5GXIA 5IT9g 5FXYA 2CE8A 2IWFA 4Z8LA 2B5LA 3MKSB 4A08B 2GC4A 4FAND 3K27A 4A08A 4GGCA 3AH8B 2IWKA 3I2NA 4GM9A 5TDHB 3I89A 4J73A 2HXCA 2XU7A 4JSNC 5CYKB 4CY3A 5K1CC 4ZOVA 2GNQA 4XYIA 2OK6A 4ZOYA 2CN3A 2J56H 5FLXg 5FKQA 5FKRA 3UKRC 2QC5A 2HJ4A 2CE9A 2H14A 3PE7A 3SBQA 5KDOB 3V5WB 3SXTD 2W18A 3EI2B 4L9OA 4CI8A 2IUVA 1PGUA 1N6FA 3RN1D 1PEVA 3JAMg 3EI2A 5CXCB 4X63B 4PBYA
chains in the Genus database with same CATH superfamily
1XIPA 3FM0A 3PVWB 5CXCA 4ERYA 4J86A 4NAAA 5TF2A 3FCSA 4O3TB 1MG2A 2AGLA 2HESX 2Z2OA 2YNNA 1VZ2A 3QHYB 4HDJA 4WK4A 3QI0A 2G9AA 2HYEA 1QNIA 4R7AB 1L5GA 2OK4A 4J77A 2CO0A 4J78A 1XKSA 2P9LC 3O4GA 4JT5C 5JWZA 4ES0A 1NR0A 4NC4A 3PSLA 5C86A 2VC2A 3I8EA 2J55H 4D9SA 3T3PA 2BKLA 2CN2A 4D0KA 4X3EA 5C9ZB 3OKTA 3DWLC 4PXWA 4GGDA 2VDPA 2QZPA 2B4EA 3OL2B 2HU8A 1JOFA 2H9MA 3EI4A 2H3XA 2CNXA 4O1QD 4LG9A 3ZDXA 2I3SA 4CY1A 4UM9A 4AN0A 1GOFA 2Z2PA 1BPOA 3EMHA 2AGYA 3JPXA 4JSPC 1JJUB 3GFCA 1VE6A 5H14A 3VI4A 3CFSB 3NVNA 4AN1A 1PBYB 4NSXA 3I7KA 3N0EA 1SQJA 3UVLA 3IJCA 2XL3A 2VDKA 4WK0A 1I2MB 3F3GA 3SN6B 3MXXA 4A11B 1K3IA 2P9IC 2XYIA 4BH6A 2XL2A 5GMKn 4QRJA 4XEIC 5I5MA 1JMXB 4A11A 4JSVC 1QFMA 4QAMA 2PM7B 5FFGA 4QQEA 1N6DA 3GREA 4BP9A 1TYEA 1FWXA 1U8CA 3BWSA 3KRWB 3RFHA 4A2LA 3SVWD 3EU7A 3RMZD 3GC3B 5E6SA 5AMSA 2AGWA 1B9XA 3VI3A 3IKOA 3ZWLB 2IUQA 4FA9D 4UI9R 5EMJB 3ZE2A 2OJYA 4A09B 2HU7A 2J57G 3DXKC 1B9YA 4BCDA 2YNOA 3V4VA 4JXMA 2H6QA 4A09A 3V9FA 2IURA 4AMYA 1UOPA 4K3ID 4G55A 3V4PA 1GOHA 4AX4A 3RLMD 3CIKB 2HU5A 3ORVD 5TEEA 3C5MA 3SLED 5I5JA 5AFU3 2PBIB 3MZLA 1PI6A 1SHYB 3N0DA 3PXWD 3RSEC 4J84A 1R5MA 4J81A 3CFVA 3F3PA 2IAAA 5CYKA 3I7PA 2H47A 5EAMA 4PC0A 4PBZA 4FHLA 4ZN4A 3I7NA 4OWRA 1JTDB 1A12A 2VDQA 3J81g 3JB9L 2H9PA 4GZ8A 4O45A 2H9NA 2EIBA 2XDWA 3PXSD 3HFQA 3L4OD 3SBPA 5EALA 5HDBA 3JZNA 3IJ1A 5EMLB 3I7OA 4XYHA 4UM8A 3IUQA 5THAA 4Y7RA 1UOQA 2I0TA 4K3JB 3VGZA 4E5ZB 4OZUA 3EQ8A 3DXMC 3J80g 1NEXB 4DNVA 3IJ0A 5IJ7E 3U4YA 2H6NA 4G56B 5FA5B 3UKUC 3ODTA 4ZOXA 3JROA 2TRCB 3MUOA 2OIZA 2Z2NA 3EI3B 3K72A 4NENA 3EI1B 5H17A 1UTCA 4CZXA 3MMYA 5A2Qg 2VDNA 4GQBB 4AOWA 3EG6A 3RFGA 2OVQB 5IC7A 2BCJB 3UR4A 3ULEC 5M5VA 5GXHA 5H1MA 5HE3B 1YR2A 2G99A 2YBAA 4CZYA 3OL2A 1O6FA 2H9LA 4J79A 4IRZA 4AMZA 2JKXA 3DSMA 4JT6C 2H6KA 4MK0B 1H2XA 2AGZA 3AFCA 3DM0A 1ERJA 4DNUA 4H5IA 3A0FA 2OVRB 4J8BA 4Z7OA 3VH0A 2P9KC 3IUJA 3MKQA 3L4MD 4GMBA 3NIDA 1H2ZA 1SQ9A 3PXTD 5EARA 4BL0A 1VYHC 3C9CA 3AL9A 3EQ9A 3GD1I 3BG0A 3JZGA 3BG1A 3OKYB 4J8GA 3T3MA 3PVUB 1GP2B 5EAPA 4CI3A 1U4CA 4IMMA 3OKYA 2B5NA 4A2MA 3F3FA 3JRPA 4I79A 3P4FA 2YB8B 5CXBB 5M5UA 4J87A 1YFQA 1U2VC 1MDAH 5FKSA 5CXBA 3E0CA 4CY5A 3IJEA 3UVOA 3I8CA 3NIFA 1L0QA 3O4HA 4MMZA 3FGBA 2I0RA 4YVDA 4FB1D 3C99A 2OVPB 2XE4A 4DNWA 4NBMA 1E5TA 2EIEA 4WJKA 5HQGA 3C75H 1K32A 4X61B 2O9KA 4J0XA 3ZE1A 5TEFA 5AJAA 1TYQC 1OLZA 3EQ7A 5FKTA 3IULA 1C9IA 4L3HD 4FA4D 3OKWA 3NVXA 4N14A 1VZ3A 2WQ8A 4FA5D 5HE0B 3SCYA 3O4IA 5EM2B 5C2WB 5K19A 1GG2B 3B7FA 2PM9B 5M5RA 4A0BB 2I3TA 5EM2A 1H2WA 4L3GD 3SBRA 2PM9A 4A0BA 3FCUA 1H2YA 1JV2A 3NVQA 2P9NC 5C2VB 3JZHA 1K8KC 2AQ5A 3K71A 2VZ3A 2UZYB 2VDRA 2CO0C 4GM8A 4EWRA 2AH1A 4Y5RD 3SWSD 4MMXA 4GGAA 3W15A 4J82A 4ESGA 2GC7A 3ZDZA 4CY2A 3MVDK 4ZOZA 4U1EI 3SJLD 1OMWB 5FQDA 2HKRA 1E8NA 3V7DB 2YMUA 4MMYA 4A7JA 2IUPA 4L1QD 3KRXB 4H5JA 5M61A 3OTTA 3IIWA 4GQ1A 4QT8A 4E54B 3VA6A 3UVMA 3MZKA 5HYNB 2B5MA 4Z7QA 4O02A 4E5ZA 4AEZA 4BUJC 4E54A 4G1MA 2AGXA 4CI2A 3AL8B 4O9DA 3DDUA 4RE5A 2UZXB 3UVNA 3AL8A 1JMZB 4RE6A 4O2WA 1O6GA 5FFOA 3EI3A 5IGQA 2BBKH 5EMKB 3K6SA 5SXMA 3EI1A 1MG3A 4U7AA 2QR5A 4ERZA 4KFMB 1XHMA 2EICA 3SHFA 2QXVA 2P9SC 4FA1D 1Q47A 3O4JA 2HKMA 1UOOA 5IJ8E 2H13A 1N6EA 4X60B 3FRXA 1S4UX 4PNKB 4FAVD 3K26A 3PSCB 5HE2B 3SFZA 4FWWA 1P22A 4CZVA 3RRMC 2EIDA 2AH0A 5B4WA 4L1MA 1M1XA 4BCCA 1GOTB 4QL1A 4TZ4A 3EI4B 2YNPA 4BP8A 3ZDYA 4IA9A 4LG8A 4J0WA 3EWEA 2MTAH 4CC9A 4ERQA 5IGOA 4JD2C 2PM6B 5M5TA 2Q7QA 3I7LA 4A0AB 2I0SA 5EMMB 2H68A 3OF7A 3KCIA 5I5IA 4PSXB 4O3UB 4LGNA 3IIYA 2P9UC 2VDLA 3SMRA 4PSWB 1TBGA 4A0AA 5M5SA 4GM3A 5GSAA 4D6VA 3RN0D 3ZE0A 2P9PC 4JHPC 4WK2A 4CI1A 1RI6A 3I7HA 2HJBA 4JSXC 5C92A 5E6RA 1GXRA 3UVKA 4GQ2P 3OW8A 1A0RB 5HE1B 2EBSA 5GXIA 3IUNA 5IT9g 1C9LA 3IUMA 5FXYA 2CE8A 2VDOA 2IWFA 4Z8LA 2B5LA 3MKSB 4A08B 2GC4A 4FAND 3K27A 4A08A 4GGCA 2VZ1A 3AH8B 2IWKA 3I2NA 4GM9A 3MUNA 1T2XA 5TDHB 3IVMA 3I89A 4J73A 2HXCA 2XU7A 4JSNC 5E6UA 5CYKB 4CY3A 5K1CC 4ZOVA 2GNQA 4XYIA 1VE7A 2OK6A 4ZOYA 1QFSA 2CN3A 2J56H 4BCBA 5FLXg 5FKQA 5FKRA 3UKRC 2QC5A 2HJ4A 2CE9A 2H14A 3PE7A 2VDMA 3SBQA 3IURA 5KDOB 3V5WB 3SXTD 1GOGA 4Z7NA 2W18A 2XZGA 3EI2B 4L9OA 4CI8A 2IUVA 4JHNA 1PGUA 3NIGA 1N6FA 1E8MA 3RN1D 1PEVA 3JAMg 3EI2A 5CXCB 4X63B 4G1EA 4PBYA
chains in the Genus database with same CATH topology
1XIPA 3FM0A 3PVWB 5CXCA 4ERYA 4J86A 5TF2A 4O3TB 1MG2A 2AGLA 2HESX 2Z2OA 2YNNA 4HDJA 2G9AA 2HYEA 1QNIA 4R7AB 2OK4A 4J77A 2CO0A 4J78A 1XKSA 2P9LC 4JT5C 5JWZA 4ES0A 1NR0A 3PSLA 3I8EA 2J55H 2CN2A 4D0KA 4X3EA 5C9ZB 3OKTA 3DWLC 4PXWA 4GGDA 2B4EA 3OL2B 1JOFA 2H9MA 3EI4A 2H3XA 2CNXA 4O1QD 4LG9A 2I3SA 4CY1A 2Z2PA 3EMHA 2AGYA 3JPXA 4JSPC 1JJUB 3GFCA 5H14A 3CFSB 3NVNA 1PBYB 4NSXA 3I7KA 3N0EA 1SQJA 3UVLA 3IJCA 2XL3A 3SN6B 3F3GA 3MXXA 4A11B 2P9IC 2XYIA 4BH6A 2XL2A 5GMKn 4QRJA 4XEIC 5I5MA 1JMXB 4A11A 4JSVC 2PM7B 4QQEA 1N6DA 3GREA 1FWXA 3BWSA 3RFHA 3KRWB 4A2LA 3SVWD 3EU7A 3RMZD 5AMSA 2AGWA 1B9XA 3IKOA 3ZWLB 2IUQA 4FA9D 4UI9R 5EMJB 4A09B 2OJYA 2J57G 3DXKC 1B9YA 2YNOA 4JXMA 2H6QA 4A09A 3V9FA 2IURA 4K3ID 3RLMD 3CIKB 3ORVD 5TEEA 3C5MA 3SLED 5I5JA 5AFU3 2PBIB 3MZLA 1PI6A 1SHYB 3N0DA 3PXWD 3RSEC 4J84A 1R5MA 4J81A 3CFVA 3F3PA 2IAAA 5CYKA 3I7PA 2H47A 5EAMA 4PC0A 4PBZA 4FHLA 4ZN4A 3I7NA 4OWRA 3J81g 3JB9L 2H9PA 4GZ8A 4O45A 2H9NA 3PXSD 3HFQA 3L4OD 3SBPA 5EALA 3JZNA 3IJ1A 5EMLB 3I7OA 4XYHA 5THAA 4Y7RA 2I0TA 4K3JB 3VGZA 4E5ZB 4OZUA 3DXMC 3J80g 1NEXB 3IJ0A 5IJ7E 3U4YA 2H6NA 4G56B 5FA5B 3UKUC 3ODTA 4ZOXA 3JROA 2TRCB 2OIZA 2Z2NA 3EI3B 3EI1B 5H17A 4CZXA 3MMYA 5A2Qg 4GQBB 4AOWA 3EG6A 3RFGA 2OVQB 5IC7A 2BCJB 3UR4A 3ULEC 5GXHA 5H1MA 5HE3B 2G99A 4CZYA 2YBAA 3OL2A 2H9LA 4J79A 3DSMA 4JT6C 2H6KA 4MK0B 2AGZA 3AFCA 3DM0A 1ERJA 4H5IA 3A0FA 2OVRB 4J8BA 3VH0A 2P9KC 3MKQA 4GMBA 3L4MD 3PXTD 1SQ9A 5EARA 4BL0A 1VYHC 3C9CA 3AL9A 4J8GA 3OKYB 3BG0A 3JZGA 3BG1A 3PVUB 1GP2B 5EAPA 4CI3A 1U4CA 4IMMA 3OKYA 2B5NA 4A2MA 3F3FA 3JRPA 4I79A 3P4FA 2YB8B 5CXBB 4J87A 1YFQA 1U2VC 1MDAH 5FKSA 5CXBA 3E0CA 4CY5A 3UVOA 3I8CA 1L0QA 3FGBA 2I0RA 4YVDA 4FB1D 3C99A 2OVPB 5HQGA 3C75H 1K32A 4X61B 2O9KA 4J0XA 5TEFA 5AJAA 1TYQC 1OLZA 5FKTA 4L3HD 4FA4D 3OKWA 3NVXA 4N14A 4FA5D 5HE0B 3SCYA 5EM2B 5C2WB 5K19A 1GG2B 3B7FA 2PM9B 4A0BB 2I3TA 5EM2A 4L3GD 3SBRA 2PM9A 4A0BA 3NVQA 2P9NC 5C2VB 3JZHA 1K8KC 2AQ5A 2UZYB 2CO0C 4GM8A 4EWRA 2AH1A 4Y5RD 3SWSD 4GGAA 3W15A 4J82A 4ESGA 2GC7A 4CY2A 4ZOZA 4U1EI 3SJLD 1OMWB 5FQDA 2HKRA 3V7DB 2YMUA 4A7JA 2IUPA 4L1QD 3KRXB 4H5JA 3OTTA 3IIWA 4GQ1A 4QT8A 4E54B 3VA6A 3UVMA 3MZKA 5HYNB 2B5MA 4E5ZA 4AEZA 4BUJC 4E54A 2AGXA 4CI2A 3AL8B 4O9DA 2UZXB 3UVNA 3AL8A 1JMZB 3EI3A 5IGQA 2BBKH 5EMKB 3EI1A 5SXMA 1MG3A 4U7AA 4ERZA 4KFMB 1XHMA 3SHFA 2QXVA 2P9SC 4FA1D 1Q47A 2HKMA 5IJ8E 2H13A 1N6EA 4X60B 3FRXA 1S4UX 4PNKB 4FAVD 3K26A 3PSCB 5HE2B 3SFZA 4FWWA 1P22A 4CZVA 3RRMC 2AH0A 5B4WA 1GOTB 4QL1A 4TZ4A 3EI4B 2YNPA 4IA9A 4LG8A 4J0WA 3EWEA 2MTAH 4CC9A 4ERQA 5IGOA 4JD2C 2PM6B 2Q7QA 3I7LA 4A0AB 2I0SA 5EMMB 2H68A 5I5IA 4PSXB 4O3UB 4LGNA 3IIYA 2P9UC 3SMRA 4PSWB 1TBGA 4A0AA 4GM3A 5GSAA 4D6VA 3RN0D 2P9PC 4CI1A 1RI6A 3I7HA 2HJBA 4JSXC 1GXRA 3UVKA 4GQ2P 3OW8A 1A0RB 5HE1B 2EBSA 5GXIA 5IT9g 5FXYA 2CE8A 2IWFA 4Z8LA 2B5LA 3MKSB 4A08B 2GC4A 4FAND 3K27A 4A08A 4GGCA 3AH8B 2IWKA 3I2NA 4GM9A 5TDHB 3I89A 4J73A 2HXCA 2XU7A 4JSNC 5CYKB 4CY3A 5K1CC 4ZOVA 2GNQA 4XYIA 2OK6A 4ZOYA 2CN3A 2J56H 5FLXg 5FKQA 5FKRA 3UKRC 2QC5A 2HJ4A 2CE9A 2H14A 3PE7A 3SBQA 5KDOB 3V5WB 3SXTD 2W18A 3EI2B 4L9OA 4CI8A 2IUVA 1PGUA 1N6FA 3RN1D 1PEVA 3JAMg 3EI2A 5CXCB 4X63B 4PBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XIP A;  3FM0 A;  3PVW B;  5CXC A;  4ERY A;  4J86 A;  5TF2 A;  4O3T B;  1MG2 A;  2AGL A;  2HES X;  2Z2O A;  2YNN A;  4HDJ A;  2G9A A;  2HYE A;  1QNI A;  4R7A B;  2OK4 A;  4J77 A;  2CO0 A;  4J78 A;  1XKS A;  2P9L C;  4JT5 C;  5JWZ A;  4ES0 A;  1NR0 A;  3PSL A;  3I8E A;  2J55 H;  2CN2 A;  4D0K A;  4X3E A;  5C9Z B;  3OKT A;  3DWL C;  4PXW A;  4GGD A;  2B4E A;  3OL2 B;  1JOF A;  2H9M A;  3EI4 A;  2H3X A;  2CNX A;  4O1Q D;  4LG9 A;  2I3S A;  4CY1 A;  2Z2P A;  3EMH A;  2AGY A;  3JPX A;  4JSP C;  1JJU B;  3GFC A;  5H14 A;  3CFS B;  3NVN A;  1PBY B;  4NSX A;  3I7K A;  3N0E A;  1SQJ A;  3UVL A;  3IJC A;  2XL3 A;  3SN6 B;  3F3G A;  3MXX A;  4A11 B;  2P9I C;  2XYI A;  4BH6 A;  2XL2 A;  5GMK n;  4QRJ A;  4XEI C;  5I5M A;  1JMX B;  4A11 A;  4JSV C;  2PM7 B;  4QQE A;  1N6D A;  3GRE A;  1FWX A;  3BWS A;  3RFH A;  3KRW B;  4A2L A;  3SVW D;  3EU7 A;  3RMZ D;  5AMS A;  2AGW A;  1B9X A;  3IKO A;  3ZWL B;  2IUQ A;  4FA9 D;  4UI9 R;  5EMJ B;  4A09 B;  2OJY A;  2J57 G;  3DXK C;  1B9Y A;  2YNO A;  4JXM A;  2H6Q A;  4A09 A;  3V9F A;  2IUR A;  4K3I D;  3RLM D;  3CIK B;  3ORV D;  5TEE A;  3C5M A;  3SLE D;  5I5J A;  5AFU 3;  2PBI B;  3MZL A;  1PI6 A;  1SHY B;  3N0D A;  3PXW D;  3RSE C;  4J84 A;  1R5M A;  4J81 A;  3CFV A;  3F3P A;  2IAA A;  5CYK A;  3I7P A;  2H47 A;  5EAM A;  4PC0 A;  4PBZ A;  4FHL A;  4ZN4 A;  3I7N A;  4OWR A;  3J81 g;  3JB9 L;  2H9P A;  4GZ8 A;  4O45 A;  2H9N A;  3PXS D;  3HFQ A;  3L4O D;  3SBP A;  5EAL A;  3JZN A;  3IJ1 A;  5EML B;  3I7O A;  4XYH A;  5THA A;  4Y7R A;  2I0T A;  4K3J B;  3VGZ A;  4E5Z B;  4OZU A;  3DXM C;  3J80 g;  1NEX B;  3IJ0 A;  5IJ7 E;  3U4Y A;  2H6N A;  4G56 B;  5FA5 B;  3UKU C;  3ODT A;  4ZOX A;  3JRO A;  2TRC B;  2OIZ A;  2Z2N A;  3EI3 B;  3EI1 B;  5H17 A;  4CZX A;  3MMY A;  5A2Q g;  4GQB B;  4AOW A;  3EG6 A;  3RFG A;  2OVQ B;  5IC7 A;  2BCJ B;  3UR4 A;  3ULE C;  5GXH A;  5H1M A;  5HE3 B;  2G99 A;  4CZY A;  2YBA A;  3OL2 A;  2H9L A;  4J79 A;  3DSM A;  4JT6 C;  2H6K A;  4MK0 B;  2AGZ A;  3AFC A;  3DM0 A;  1ERJ A;  4H5I A;  3A0F A;  2OVR B;  4J8B A;  3VH0 A;  2P9K C;  3MKQ A;  4GMB A;  3L4M D;  3PXT D;  1SQ9 A;  5EAR A;  4BL0 A;  1VYH C;  3C9C A;  3AL9 A;  4J8G A;  3OKY B;  3BG0 A;  3JZG A;  3BG1 A;  3PVU B;  1GP2 B;  5EAP A;  4CI3 A;  1U4C A;  4IMM A;  3OKY A;  2B5N A;  4A2M A;  3F3F A;  3JRP A;  4I79 A;  3P4F A;  2YB8 B;  5CXB B;  4J87 A;  1YFQ A;  1U2V C;  1MDA H;  5FKS A;  5CXB A;  3E0C A;  4CY5 A;  3UVO A;  3I8C A;  1L0Q A;  3FGB A;  2I0R A;  4YVD A;  4FB1 D;  3C99 A;  2OVP B;  5HQG A;  3C75 H;  1K32 A;  4X61 B;  2O9K A;  4J0X A;  5TEF A;  5AJA A;  1TYQ C;  1OLZ A;  5FKT A;  4L3H D;  4FA4 D;  3OKW A;  3NVX A;  4N14 A;  4FA5 D;  5HE0 B;  3SCY A;  5EM2 B;  5C2W B;  5K19 A;  1GG2 B;  3B7F A;  2PM9 B;  4A0B B;  2I3T A;  5EM2 A;  4L3G D;  3SBR A;  2PM9 A;  4A0B A;  3NVQ A;  2P9N C;  5C2V B;  3JZH A;  1K8K C;  2AQ5 A;  2UZY B;  2CO0 C;  4GM8 A;  4EWR A;  2AH1 A;  4Y5R D;  3SWS D;  4GGA A;  3W15 A;  4J82 A;  4ESG A;  2GC7 A;  4CY2 A;  4ZOZ A;  4U1E I;  3SJL D;  1OMW B;  5FQD A;  2HKR A;  3V7D B;  2YMU A;  4A7J A;  2IUP A;  4L1Q D;  3KRX B;  4H5J A;  3OTT A;  3IIW A;  4GQ1 A;  4QT8 A;  4E54 B;  3VA6 A;  3UVM A;  3MZK A;  5HYN B;  2B5M A;  4E5Z A;  4AEZ A;  4BUJ C;  4E54 A;  2AGX A;  4CI2 A;  3AL8 B;  4O9D A;  2UZX B;  3UVN A;  3AL8 A;  1JMZ B;  3EI3 A;  5IGQ A;  2BBK H;  5EMK B;  3EI1 A;  5SXM A;  1MG3 A;  4U7A A;  4ERZ A;  4KFM B;  1XHM A;  3SHF A;  2QXV A;  2P9S C;  4FA1 D;  1Q47 A;  2HKM A;  5IJ8 E;  2H13 A;  1N6E A;  4X60 B;  3FRX A;  1S4U X;  4PNK B;  4FAV D;  3K26 A;  3PSC B;  5HE2 B;  3SFZ A;  4FWW A;  1P22 A;  4CZV A;  3RRM C;  2AH0 A;  5B4W A;  1GOT B;  4QL1 A;  4TZ4 A;  3EI4 B;  2YNP A;  4IA9 A;  4LG8 A;  4J0W A;  3EWE A;  2MTA H;  4CC9 A;  4ERQ A;  5IGO A;  4JD2 C;  2PM6 B;  2Q7Q A;  3I7L A;  4A0A B;  2I0S A;  5EMM B;  2H68 A;  5I5I A;  4PSX B;  4O3U B;  4LGN A;  3IIY A;  2P9U C;  3SMR A;  4PSW B;  1TBG A;  4A0A A;  4GM3 A;  5GSA A;  4D6V A;  3RN0 D;  2P9P C;  4CI1 A;  1RI6 A;  3I7H A;  2HJB A;  4JSX C;  1GXR A;  3UVK A;  4GQ2 P;  3OW8 A;  1A0R B;  5HE1 B;  2EBS A;  5GXI A;  5IT9 g;  5FXY A;  2CE8 A;  2IWF A;  4Z8L A;  2B5L A;  3MKS B;  4A08 B;  2GC4 A;  4FAN D;  3K27 A;  4A08 A;  4GGC A;  3AH8 B;  2IWK A;  3I2N A;  4GM9 A;  5TDH B;  3I89 A;  4J73 A;  2HXC A;  2XU7 A;  4JSN C;  5CYK B;  4CY3 A;  5K1C C;  4ZOV A;  2GNQ A;  4XYI A;  2OK6 A;  4ZOY A;  2CN3 A;  2J56 H;  5FLX g;  5FKQ A;  5FKR A;  3UKR C;  2QC5 A;  2HJ4 A;  2CE9 A;  2H14 A;  3PE7 A;  3SBQ A;  5KDO B;  3V5W B;  3SXT D;  2W18 A;  3EI2 B;  4L9O A;  4CI8 A;  2IUV A;  1PGU A;  1N6F A;  3RN1 D;  1PEV A;  3JAM g;  3EI2 A;  5CXC B;  4X63 B;  4PBY A; 
#chains in the Genus database with same CATH topology
 1XIP A;  3FM0 A;  3PVW B;  5CXC A;  4ERY A;  4J86 A;  4NAA A;  5TF2 A;  3FCS A;  4O3T B;  1MG2 A;  2AGL A;  2HES X;  2Z2O A;  2YNN A;  1VZ2 A;  3QHY B;  4HDJ A;  4WK4 A;  3QI0 A;  2G9A A;  2HYE A;  1QNI A;  4R7A B;  1L5G A;  2OK4 A;  4J77 A;  2CO0 A;  4J78 A;  1XKS A;  2P9L C;  3O4G A;  4JT5 C;  5JWZ A;  4ES0 A;  1NR0 A;  4NC4 A;  3PSL A;  5C86 A;  2VC2 A;  3I8E A;  2J55 H;  4D9S A;  3T3P A;  2BKL A;  2CN2 A;  4D0K A;  4X3E A;  5C9Z B;  3OKT A;  3DWL C;  4PXW A;  4GGD A;  2VDP A;  2QZP A;  2B4E A;  3OL2 B;  2HU8 A;  1JOF A;  2H9M A;  3EI4 A;  2H3X A;  2CNX A;  4O1Q D;  4LG9 A;  3ZDX A;  2I3S A;  4CY1 A;  4UM9 A;  4AN0 A;  1GOF A;  2Z2P A;  1BPO A;  3EMH A;  2AGY A;  3JPX A;  4JSP C;  1JJU B;  3GFC A;  1VE6 A;  5H14 A;  3VI4 A;  3CFS B;  3NVN A;  4AN1 A;  1PBY B;  4NSX A;  3I7K A;  3N0E A;  1SQJ A;  3UVL A;  3IJC A;  2XL3 A;  2VDK A;  4WK0 A;  1I2M B;  3F3G A;  3SN6 B;  3MXX A;  4A11 B;  1K3I A;  2P9I C;  2XYI A;  4BH6 A;  2XL2 A;  5GMK n;  4QRJ A;  4XEI C;  5I5M A;  1JMX B;  4A11 A;  4JSV C;  1QFM A;  4QAM A;  2PM7 B;  5FFG A;  4QQE A;  1N6D A;  3GRE A;  4BP9 A;  1TYE A;  1FWX A;  1U8C A;  3BWS A;  3KRW B;  3RFH A;  4A2L A;  3SVW D;  3EU7 A;  3RMZ D;  3GC3 B;  5E6S A;  5AMS A;  2AGW A;  1B9X A;  3VI3 A;  3IKO A;  3ZWL B;  2IUQ A;  4FA9 D;  4UI9 R;  5EMJ B;  3ZE2 A;  2OJY A;  4A09 B;  2HU7 A;  2J57 G;  3DXK C;  1B9Y A;  4BCD A;  2YNO A;  3V4V A;  4JXM A;  2H6Q A;  4A09 A;  3V9F A;  2IUR A;  4AMY A;  1UOP A;  4K3I D;  4G55 A;  3V4P A;  1GOH A;  4AX4 A;  3RLM D;  3CIK B;  2HU5 A;  3ORV D;  5TEE A;  3C5M A;  3SLE D;  5I5J A;  5AFU 3;  2PBI B;  3MZL A;  1PI6 A;  1SHY B;  3N0D A;  3PXW D;  3RSE C;  4J84 A;  1R5M A;  4J81 A;  3CFV A;  3F3P A;  2IAA A;  5CYK A;  3I7P A;  2H47 A;  5EAM A;  4PC0 A;  4PBZ A;  4FHL A;  4ZN4 A;  3I7N A;  4OWR A;  1JTD B;  1A12 A;  2VDQ A;  3J81 g;  3JB9 L;  2H9P A;  4GZ8 A;  4O45 A;  2H9N A;  2EIB A;  2XDW A;  3PXS D;  3HFQ A;  3L4O D;  3SBP A;  5EAL A;  5HDB A;  3JZN A;  3IJ1 A;  5EML B;  3I7O A;  4XYH A;  4UM8 A;  3IUQ A;  5THA A;  4Y7R A;  1UOQ A;  2I0T A;  4K3J B;  3VGZ A;  4E5Z B;  4OZU A;  3EQ8 A;  3DXM C;  3J80 g;  1NEX B;  4DNV A;  3IJ0 A;  5IJ7 E;  3U4Y A;  2H6N A;  4G56 B;  5FA5 B;  3UKU C;  3ODT A;  4ZOX A;  3JRO A;  2TRC B;  3MUO A;  2OIZ A;  2Z2N A;  3EI3 B;  3K72 A;  4NEN A;  3EI1 B;  5H17 A;  1UTC A;  4CZX A;  3MMY A;  5A2Q g;  2VDN A;  4GQB B;  4AOW A;  3EG6 A;  3RFG A;  2OVQ B;  5IC7 A;  2BCJ B;  3UR4 A;  3ULE C;  5M5V A;  5GXH A;  5H1M A;  5HE3 B;  1YR2 A;  2G99 A;  2YBA A;  4CZY A;  3OL2 A;  1O6F A;  2H9L A;  4J79 A;  4IRZ A;  4AMZ A;  2JKX A;  3DSM A;  4JT6 C;  2H6K A;  4MK0 B;  1H2X A;  2AGZ A;  3AFC A;  3DM0 A;  1ERJ A;  4DNU A;  4H5I A;  3A0F A;  2OVR B;  4J8B A;  4Z7O A;  3VH0 A;  2P9K C;  3IUJ A;  3MKQ A;  3L4M D;  4GMB A;  3NID A;  1H2Z A;  1SQ9 A;  3PXT D;  5EAR A;  4BL0 A;  1VYH C;  3C9C A;  3AL9 A;  3EQ9 A;  3GD1 I;  3BG0 A;  3JZG A;  3BG1 A;  3OKY B;  4J8G A;  3T3M A;  3PVU B;  1GP2 B;  5EAP A;  4CI3 A;  1U4C A;  4IMM A;  3OKY A;  2B5N A;  4A2M A;  3F3F A;  3JRP A;  4I79 A;  3P4F A;  2YB8 B;  5CXB B;  5M5U A;  4J87 A;  1YFQ A;  1U2V C;  1MDA H;  5FKS A;  5CXB A;  3E0C A;  4CY5 A;  3IJE A;  3UVO A;  3I8C A;  3NIF A;  1L0Q A;  3O4H A;  4MMZ A;  3FGB A;  2I0R A;  4YVD A;  4FB1 D;  3C99 A;  2OVP B;  2XE4 A;  4DNW A;  4NBM A;  1E5T A;  2EIE A;  4WJK A;  5HQG A;  3C75 H;  1K32 A;  4X61 B;  2O9K A;  4J0X A;  3ZE1 A;  5TEF A;  5AJA A;  1TYQ C;  1OLZ A;  3EQ7 A;  5FKT A;  3IUL A;  1C9I A;  4L3H D;  4FA4 D;  3OKW A;  3NVX A;  4N14 A;  1VZ3 A;  2WQ8 A;  4FA5 D;  5HE0 B;  3SCY A;  3O4I A;  5EM2 B;  5C2W B;  5K19 A;  1GG2 B;  3B7F A;  2PM9 B;  5M5R A;  4A0B B;  2I3T A;  5EM2 A;  1H2W A;  4L3G D;  3SBR A;  2PM9 A;  4A0B A;  3FCU A;  1H2Y A;  1JV2 A;  3NVQ A;  2P9N C;  5C2V B;  3JZH A;  1K8K C;  2AQ5 A;  3K71 A;  2VZ3 A;  2UZY B;  2VDR A;  2CO0 C;  4GM8 A;  4EWR A;  2AH1 A;  4Y5R D;  3SWS D;  4MMX A;  4GGA A;  3W15 A;  4J82 A;  4ESG A;  2GC7 A;  3ZDZ A;  4CY2 A;  3MVD K;  4ZOZ A;  4U1E I;  3SJL D;  1OMW B;  5FQD A;  2HKR A;  1E8N A;  3V7D B;  2YMU A;  4MMY A;  4A7J A;  2IUP A;  4L1Q D;  3KRX B;  4H5J A;  5M61 A;  3OTT A;  3IIW A;  4GQ1 A;  4QT8 A;  4E54 B;  3VA6 A;  3UVM A;  3MZK A;  5HYN B;  2B5M A;  4Z7Q A;  4O02 A;  4E5Z A;  4AEZ A;  4BUJ C;  4E54 A;  4G1M A;  2AGX A;  4CI2 A;  3AL8 B;  4O9D A;  3DDU A;  4RE5 A;  2UZX B;  3UVN A;  3AL8 A;  1JMZ B;  4RE6 A;  4O2W A;  1O6G A;  5FFO A;  3EI3 A;  5IGQ A;  2BBK H;  5EMK B;  3K6S A;  5SXM A;  3EI1 A;  1MG3 A;  4U7A A;  2QR5 A;  4ERZ A;  4KFM B;  1XHM A;  2EIC A;  3SHF A;  2QXV A;  2P9S C;  4FA1 D;  1Q47 A;  3O4J A;  2HKM A;  1UOO A;  5IJ8 E;  2H13 A;  1N6E A;  4X60 B;  3FRX A;  1S4U X;  4PNK B;  4FAV D;  3K26 A;  3PSC B;  5HE2 B;  3SFZ A;  4FWW A;  1P22 A;  4CZV A;  3RRM C;  2EID A;  2AH0 A;  5B4W A;  4L1M A;  1M1X A;  4BCC A;  1GOT B;  4QL1 A;  4TZ4 A;  3EI4 B;  2YNP A;  4BP8 A;  3ZDY A;  4IA9 A;  4LG8 A;  4J0W A;  3EWE A;  2MTA H;  4CC9 A;  4ERQ A;  5IGO A;  4JD2 C;  2PM6 B;  5M5T A;  2Q7Q A;  3I7L A;  4A0A B;  2I0S A;  5EMM B;  2H68 A;  3OF7 A;  3KCI A;  5I5I A;  4PSX B;  4O3U B;  4LGN A;  3IIY A;  2P9U C;  2VDL A;  3SMR A;  4PSW B;  1TBG A;  4A0A A;  5M5S A;  4GM3 A;  5GSA A;  4D6V A;  3RN0 D;  3ZE0 A;  2P9P C;  4JHP C;  4WK2 A;  4CI1 A;  1RI6 A;  3I7H A;  2HJB A;  4JSX C;  5C92 A;  5E6R A;  1GXR A;  3UVK A;  4GQ2 P;  3OW8 A;  1A0R B;  5HE1 B;  2EBS A;  5GXI A;  3IUN A;  5IT9 g;  1C9L A;  3IUM A;  5FXY A;  2CE8 A;  2VDO A;  2IWF A;  4Z8L A;  2B5L A;  3MKS B;  4A08 B;  2GC4 A;  4FAN D;  3K27 A;  4A08 A;  4GGC A;  2VZ1 A;  3AH8 B;  2IWK A;  3I2N A;  4GM9 A;  3MUN A;  1T2X A;  5TDH B;  3IVM A;  3I89 A;  4J73 A;  2HXC A;  2XU7 A;  4JSN C;  5E6U A;  5CYK B;  4CY3 A;  5K1C C;  4ZOV A;  2GNQ A;  4XYI A;  1VE7 A;  2OK6 A;  4ZOY A;  1QFS A;  2CN3 A;  2J56 H;  4BCB A;  5FLX g;  5FKQ A;  5FKR A;  3UKR C;  2QC5 A;  2HJ4 A;  2CE9 A;  2H14 A;  3PE7 A;  2VDM A;  3SBQ A;  3IUR A;  5KDO B;  3V5W B;  3SXT D;  1GOG A;  4Z7N A;  2W18 A;  2XZG A;  3EI2 B;  4L9O A;  4CI8 A;  2IUV A;  4JHN A;  1PGU A;  3NIG A;  1N6F A;  1E8M A;  3RN1 D;  1PEV A;  3JAM g;  3EI2 A;  5CXC B;  4X63 B;  4G1E A;  4PBY A; 
#chains in the Genus database with same CATH homology
 1XIP A;  3FM0 A;  3PVW B;  5CXC A;  4ERY A;  4J86 A;  5TF2 A;  4O3T B;  1MG2 A;  2AGL A;  2HES X;  2Z2O A;  2YNN A;  4HDJ A;  2G9A A;  2HYE A;  1QNI A;  4R7A B;  2OK4 A;  4J77 A;  2CO0 A;  4J78 A;  1XKS A;  2P9L C;  4JT5 C;  5JWZ A;  4ES0 A;  1NR0 A;  3PSL A;  3I8E A;  2J55 H;  2CN2 A;  4D0K A;  4X3E A;  5C9Z B;  3OKT A;  3DWL C;  4PXW A;  4GGD A;  2B4E A;  3OL2 B;  1JOF A;  2H9M A;  3EI4 A;  2H3X A;  2CNX A;  4O1Q D;  4LG9 A;  2I3S A;  4CY1 A;  2Z2P A;  3EMH A;  2AGY A;  3JPX A;  4JSP C;  1JJU B;  3GFC A;  5H14 A;  3CFS B;  3NVN A;  1PBY B;  4NSX A;  3I7K A;  3N0E A;  1SQJ A;  3UVL A;  3IJC A;  2XL3 A;  3SN6 B;  3F3G A;  3MXX A;  4A11 B;  2P9I C;  2XYI A;  4BH6 A;  2XL2 A;  5GMK n;  4QRJ A;  4XEI C;  5I5M A;  1JMX B;  4A11 A;  4JSV C;  2PM7 B;  4QQE A;  1N6D A;  3GRE A;  1FWX A;  3BWS A;  3RFH A;  3KRW B;  4A2L A;  3SVW D;  3EU7 A;  3RMZ D;  5AMS A;  2AGW A;  1B9X A;  3IKO A;  3ZWL B;  2IUQ A;  4FA9 D;  4UI9 R;  5EMJ B;  4A09 B;  2OJY A;  2J57 G;  3DXK C;  1B9Y A;  2YNO A;  4JXM A;  2H6Q A;  4A09 A;  3V9F A;  2IUR A;  4K3I D;  3RLM D;  3CIK B;  3ORV D;  5TEE A;  3C5M A;  3SLE D;  5I5J A;  5AFU 3;  2PBI B;  3MZL A;  1PI6 A;  1SHY B;  3N0D A;  3PXW D;  3RSE C;  4J84 A;  1R5M A;  4J81 A;  3CFV A;  3F3P A;  2IAA A;  5CYK A;  3I7P A;  2H47 A;  5EAM A;  4PC0 A;  4PBZ A;  4FHL A;  4ZN4 A;  3I7N A;  4OWR A;  3J81 g;  3JB9 L;  2H9P A;  4GZ8 A;  4O45 A;  2H9N A;  3PXS D;  3HFQ A;  3L4O D;  3SBP A;  5EAL A;  3JZN A;  3IJ1 A;  5EML B;  3I7O A;  4XYH A;  5THA A;  4Y7R A;  2I0T A;  4K3J B;  3VGZ A;  4E5Z B;  4OZU A;  3DXM C;  3J80 g;  1NEX B;  3IJ0 A;  5IJ7 E;  3U4Y A;  2H6N A;  4G56 B;  5FA5 B;  3UKU C;  3ODT A;  4ZOX A;  3JRO A;  2TRC B;  2OIZ A;  2Z2N A;  3EI3 B;  3EI1 B;  5H17 A;  4CZX A;  3MMY A;  5A2Q g;  4GQB B;  4AOW A;  3EG6 A;  3RFG A;  2OVQ B;  5IC7 A;  2BCJ B;  3UR4 A;  3ULE C;  5GXH A;  5H1M A;  5HE3 B;  2G99 A;  4CZY A;  2YBA A;  3OL2 A;  2H9L A;  4J79 A;  3DSM A;  4JT6 C;  2H6K A;  4MK0 B;  2AGZ A;  3AFC A;  3DM0 A;  1ERJ A;  4H5I A;  3A0F A;  2OVR B;  4J8B A;  3VH0 A;  2P9K C;  3MKQ A;  4GMB A;  3L4M D;  3PXT D;  1SQ9 A;  5EAR A;  4BL0 A;  1VYH C;  3C9C A;  3AL9 A;  4J8G A;  3OKY B;  3BG0 A;  3JZG A;  3BG1 A;  3PVU B;  1GP2 B;  5EAP A;  4CI3 A;  1U4C A;  4IMM A;  3OKY A;  2B5N A;  4A2M A;  3F3F A;  3JRP A;  4I79 A;  3P4F A;  2YB8 B;  5CXB B;  4J87 A;  1YFQ A;  1U2V C;  1MDA H;  5FKS A;  5CXB A;  3E0C A;  4CY5 A;  3UVO A;  3I8C A;  1L0Q A;  3FGB A;  2I0R A;  4YVD A;  4FB1 D;  3C99 A;  2OVP B;  5HQG A;  3C75 H;  1K32 A;  4X61 B;  2O9K A;  4J0X A;  5TEF A;  5AJA A;  1TYQ C;  1OLZ A;  5FKT A;  4L3H D;  4FA4 D;  3OKW A;  3NVX A;  4N14 A;  4FA5 D;  5HE0 B;  3SCY A;  5EM2 B;  5C2W B;  5K19 A;  1GG2 B;  3B7F A;  2PM9 B;  4A0B B;  2I3T A;  5EM2 A;  4L3G D;  3SBR A;  2PM9 A;  4A0B A;  3NVQ A;  2P9N C;  5C2V B;  3JZH A;  1K8K C;  2AQ5 A;  2UZY B;  2CO0 C;  4GM8 A;  4EWR A;  2AH1 A;  4Y5R D;  3SWS D;  4GGA A;  3W15 A;  4J82 A;  4ESG A;  2GC7 A;  4CY2 A;  4ZOZ A;  4U1E I;  3SJL D;  1OMW B;  5FQD A;  2HKR A;  3V7D B;  2YMU A;  4A7J A;  2IUP A;  4L1Q D;  3KRX B;  4H5J A;  3OTT A;  3IIW A;  4GQ1 A;  4QT8 A;  4E54 B;  3VA6 A;  3UVM A;  3MZK A;  5HYN B;  2B5M A;  4E5Z A;  4AEZ A;  4BUJ C;  4E54 A;  2AGX A;  4CI2 A;  3AL8 B;  4O9D A;  2UZX B;  3UVN A;  3AL8 A;  1JMZ B;  3EI3 A;  5IGQ A;  2BBK H;  5EMK B;  3EI1 A;  5SXM A;  1MG3 A;  4U7A A;  4ERZ A;  4KFM B;  1XHM A;  3SHF A;  2QXV A;  2P9S C;  4FA1 D;  1Q47 A;  2HKM A;  5IJ8 E;  2H13 A;  1N6E A;  4X60 B;  3FRX A;  1S4U X;  4PNK B;  4FAV D;  3K26 A;  3PSC B;  5HE2 B;  3SFZ A;  4FWW A;  1P22 A;  4CZV A;  3RRM C;  2AH0 A;  5B4W A;  1GOT B;  4QL1 A;  4TZ4 A;  3EI4 B;  2YNP A;  4IA9 A;  4LG8 A;  4J0W A;  3EWE A;  2MTA H;  4CC9 A;  4ERQ A;  5IGO A;  4JD2 C;  2PM6 B;  2Q7Q A;  3I7L A;  4A0A B;  2I0S A;  5EMM B;  2H68 A;  5I5I A;  4PSX B;  4O3U B;  4LGN A;  3IIY A;  2P9U C;  3SMR A;  4PSW B;  1TBG A;  4A0A A;  4GM3 A;  5GSA A;  4D6V A;  3RN0 D;  2P9P C;  4CI1 A;  1RI6 A;  3I7H A;  2HJB A;  4JSX C;  1GXR A;  3UVK A;  4GQ2 P;  3OW8 A;  1A0R B;  5HE1 B;  2EBS A;  5GXI A;  5IT9 g;  5FXY A;  2CE8 A;  2IWF A;  4Z8L A;  2B5L A;  3MKS B;  4A08 B;  2GC4 A;  4FAN D;  3K27 A;  4A08 A;  4GGC A;  3AH8 B;  2IWK A;  3I2N A;  4GM9 A;  5TDH B;  3I89 A;  4J73 A;  2HXC A;  2XU7 A;  4JSN C;  5CYK B;  4CY3 A;  5K1C C;  4ZOV A;  2GNQ A;  4XYI A;  2OK6 A;  4ZOY A;  2CN3 A;  2J56 H;  5FLX g;  5FKQ A;  5FKR A;  3UKR C;  2QC5 A;  2HJ4 A;  2CE9 A;  2H14 A;  3PE7 A;  3SBQ A;  5KDO B;  3V5W B;  3SXT D;  2W18 A;  3EI2 B;  4L9O A;  4CI8 A;  2IUV A;  1PGU A;  1N6F A;  3RN1 D;  1PEV A;  3JAM g;  3EI2 A;  5CXC B;  4X63 B;  4PBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...