2H9NA

Wdr5 in complex with monomethylated h3k4 peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, gene regulation
molecule keywords WD-repeat protein 5
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 304
sequence length 304
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h9nA00
4LG8A 2HKMA 4BL0A 5EMMB 3RMZD 3C75H 3I8EA 4A08B 1NR0A 3OW8A 3EI3B 2H9LA 5IT9g 4A0AB 3B7FA 4D0KA 3JRPA 1GOTB 2H14A 3NVQA 4ZN4A 4J82A 2OVRB 4PXWA 3AFCA 4CY5A 4CY2A 5I5MA 3A0FA 5FLXg 4A7JA 3MZLA 3MXXA 2AH0A 3RLMD 4BUJC 2P9KC 4JD2C 2B5LA 2AGXA 2QXVA 2YNPA 1JMXB 4A09B 3MZKA 2P9PC 4CY1A 2H47A 1XHMA 5CYKA 3UKUC 4Y7RA 4JXMA 4QT8A 3SN6B 3OTTA 1JMZB 4BH6A 2TRCB 4R7AB 1K32A 4CZYA 2IAAA 2IURA 3JZNA 3OKWA 3PXSD 3VH0A 2Z2NA 4OWRA 3OKTA 4QRJA 4XEIC 2P9IC 4JT6C 3PXWD 4FB1D 1XIPA 3EI4A 3V5WB 2OVQB 5H1MA 2HXCA 3KRXB 2B5NA 5GSAA 5H14A 2MTAH 4FA9D 4AOWA 1S4UX 4CI1A 4PSXB 1MDAH 2PM9B 4G56B 3J81g 1NEXB 3ORVD 5CXBA 2G9AA 2IWFA 5H17A 3I2NA 1GP2B 2J56H 2H13A 3OL2A 1R5MA 2YBAA 3BG1A 4J87A 4ZOVA 4PSWB 2IWKA 4A11A 3AL8B 2H6KA 1JJUB 3SFZA 2PM6B 3FM0A 5C9ZB 1JOFA 4ZOYA 3JROA 2HJBA 5EMLB 4CI3A 3NVNA 4H5IA 5EARA 5FQDA 1U4CA 1TBGA 4OZUA 2P9NC 4Y5RD 2CO0A 1MG3A 3I7KA 3C5MA 2OK6A 3UVOA 4O3TB 1B9XA 3OKYA 1GXRA 2HJ4A 3EI1B 1P22A 4XYIA 3GFCA 3DXKC 3C9CA 4E5ZB 4GM8A 1SQ9A 2H9PA 1FWXA 4I79A 5IJ8E 5EM2B 2O9KA 4EWRA 3AH8B 3JPXA 2H6QA 3I7LA 1YFQA 4XYHA 2H68A 3UVNA 4FA1D 3I7NA 4J77A 5TEEA 4U1EI 5SXMA 3JZHA 5EAMA 4FA5D 5GMKn 2I0TA 4TZ4A 5EMKB 4ERZA 4GQ2P 3MMYA 3N0DA 3MKQA 3VA6A 5CXCA 4JT5C 4FHLA 2Z2PA 5HE0B 3IJ1A 2B5MA 4E54A 2XL3A 2J57G 1Q47A 5EALA 4ZOZA 2YB8B 4J0WA 5HYNB 5KDOB 3C99A 5AMSA 3PXTD 2P9UC 4GQ1A 1U2VC 4J8GA 3DWLC 3PSLA 5FA5B 2EBSA 1N6FA 4K3JB 3UVMA 3N0EA 1QNIA 3KRWB 4A0BA 5I5JA 5K19A 3UVKA 4J0XA 4GZ8A 4CC9A 5IGQA 4LG9A 4PBYA 5A2Qg 2HESX 1OMWB 2W18A 2G99A 4A2LA 4LGNA 4CI8A 3EI2B 4GM3A 4MK0B 3EMHA 3RFHA 2P9LC 3SBRA 3DSMA 1B9YA 2OJYA 3SLED 5FKQA 4GMBA 4FWWA 5TEFA 2OIZA 2CE9A 2H9NA 4JSXC 3MKSB 4L3HD 4IA9A 2GC4A 3UKRC 4A08A 2GC7A 5EMJB 3EI3A 4A0AA 2Z2OA 3RN0D 3SVWD 2XL2A 4O1QD 3SBPA 3DXMC 3SCYA 5TF2A 4FAVD 3ZWLB 3E0CA 4J8BA 3I89A 5C2VB 3P4FA 2UZYB 2P9SC 4L3GD 3W15A 4Z8LA 1VYHC 4ERYA 2Q7QA 5EAPA 5AJAA 4A09A 2H6NA 4ES0A 5JWZA 2I0SA 3PE7A 3RSEC 4YVDA 1PBYB 1OLZA 3FRXA 4J86A 5B4WA 4GGDA 4X61B 4J78A 3ULEC 4L9OA 4CZXA 1A0RB 3I7PA 3F3GA 4QQEA 3EU7A 2CN2A 4H5JA 3BG0A 3V9FA 1PEVA 2YNOA 5C2WB 4J79A 3IKOA 2GNQA 1SQJA 2XYIA 4FA4D 3OL2B 3DM0A 2CNXA 4X3EA 2I3SA 1RI6A 2PM7B 4J81A 4A11B 3EI2A 1MG2A 4J73A 2PM9A 4IMMA 4HDJA 3IJ0A 1PI6A 2CN3A 2IUVA 3L4MD 4CZVA 2HKRA 2QC5A 2PBIB 4GGCA 4O45A 3NVXA 5I5IA 2UZXB 3JZGA 5K1CC 2CE8A 3AL8A 3V7DB 2I3TA 3SJLD 3FGBA 5HQGA 1SHYB 3SWSD 4ESGA 2B4EA 3OKYB 3IIYA 5GXHA 4ZOXA 4GQBB 1PGUA 5HE3B 2YNNA 4QL1A 4UI9R 3PVUB 3I8CA 3PSCB 4L1QD 4X60B 4PNKB 2AGLA 2H9MA 3F3PA 2BCJB 5TDHB 3CIKB 3PVWB 3I7OA 2H3XA 4O9DA 4K3ID 4FAND 3F3FA 3GREA 2OK4A 4JSNC 3EI1A 4PBZA 4GM9A 4J84A 4E5ZA 3UR4A 5FKTA 5EM2A 3EG6A 5CXCB 2XU7A 3U4YA 3SBQA 3VGZA 4U7AA 4E54B 4JSVC 1GG2B 3AL9A 3K26A 5IJ7E 5CYKB 2HYEA 2J55H 1ERJA 2AGWA 4N14A 2OVPB 5FKRA 3J80g 3RFGA 4O3UB 5FKSA 4X63B 4A2MA 4AEZA 3IJCA 3SXTD 4PC0A 3L4OD 3CFSB 3ODTA 4D6VA 2IUPA 3CFVA 5FXYA 3RN1D 2AGZA 5HE1B 2I0RA 3K27A 4CY3A 5AFU3 4A0BB 3JAMg 3IIWA 1N6EA 3JB9L 1L0QA 4NSXA 3HFQA 5THAA 3I7HA 3RRMC 5HE2B 2AQ5A 2BBKH 3EI4B 2AGYA 4KFMB 2CO0C 4JSPC 2IUQA 2AH1A 1N6DA 3UVLA 2YMUA 4CI2A 1K8KC 1XKSA 3SHFA 5IC7A 3BWSA 5IGOA 3SMRA 1TYQC 5GXIA 5CXBB 4ERQA 3EWEA 4GGAA
chains in the Genus database with same CATH superfamily
4LG8A 2HKMA 4BL0A 5EMMB 3RMZD 3O4IA 3C75H 3ZE0A 3I8EA 4A08B 1NR0A 3OW8A 3EI3B 2H9LA 5IT9g 4A0AB 1E5TA 3B7FA 4D0KA 1UOQA 3JRPA 1GOTB 2EIEA 2H14A 5FFOA 3NVQA 4ZN4A 3FCSA 4J82A 2OVRB 2HU7A 1A12A 3NIGA 4PXWA 3AFCA 4NC4A 4CY5A 4CY2A 5I5MA 3ZDXA 3A0FA 5FLXg 4A7JA 4Z7NA 1BPOA 3MXXA 2AH0A 3MZLA 3RLMD 4BUJC 4G55A 2P9KC 4JD2C 2B5LA 3K71A 2AGXA 2QXVA 2YNPA 1JMXB 4O2WA 4A09B 3MZKA 2P9PC 4CY1A 2H47A 1XHMA 5CYKA 3UKUC 3ZDYA 4Y7RA 4JXMA 1C9LA 4QT8A 3SN6B 3GD1I 3OTTA 3EQ7A 4WK4A 1JMZB 4BH6A 2TRCB 2XDWA 1K32A 2JKXA 4R7AB 4CZYA 2IAAA 2VDLA 3IVMA 2IURA 3JZNA 3OKWA 3PXSD 3VH0A 2Z2NA 3IUJA 4OWRA 3OKTA 1GOFA 4BCBA 4QRJA 4XEIC 2P9IC 4JT6C 3PXWD 1E8NA 1L5GA 4FB1D 1XIPA 4L1MA 4MMZA 3EI4A 3V5WB 2OVQB 5H1MA 2HXCA 2HU8A 3KRXB 2B5NA 5GSAA 5H14A 2MTAH 4FA9D 5M61A 4AOWA 1S4UX 4CI1A 4PSXB 1MDAH 2BKLA 2PM9B 4G56B 3J81g 1NEXB 3ORVD 5CXBA 1U8CA 2G9AA 2IWFA 2XZGA 3I2NA 5H17A 1TYEA 1GP2B 2J56H 3NIDA 2H13A 3OL2A 1R5MA 2YBAA 5E6UA 3BG1A 4J87A 4ZOVA 4PSWB 2IWKA 2XE4A 3IUQA 4A11A 3AL8B 5FFGA 2H6KA 1JJUB 3SFZA 2PM6B 3FM0A 5C9ZB 1JOFA 4ZOYA 3JROA 2HJBA 5EMLB 4CI3A 3NVNA 1VE6A 4H5IA 5EARA 5FQDA 1U4CA 1TBGA 4OZUA 3QI0A 2P9NC 4Y5RD 2CO0A 1MG3A 3I7KA 2VZ1A 3C5MA 3MUNA 2OK6A 3ZE1A 3UVOA 4O3TB 1VE7A 4DNUA 1B9XA 3OKYA 1GXRA 4IRZA 2HJ4A 3EI1B 1P22A 4XYIA 3GFCA 3DXKC 3C9CA 1UOOA 4GM8A 1SQ9A 4E5ZB 2H9PA 1FWXA 4I79A 5IJ8E 5EM2B 2O9KA 4EWRA 3AH8B 2EIDA 3JPXA 2H6QA 3I7LA 3DDUA 1YFQA 4XYHA 2H68A 3UVNA 1I2MB 4FA1D 3I7NA 4J77A 5TEEA 4U1EI 5SXMA 3JZHA 5EAMA 4FA5D 5GMKn 2I0TA 4TZ4A 5EMKB 4ERZA 4GQ2P 4AX4A 3MMYA 3N0DA 4NBMA 3MKQA 3VA6A 5CXCA 4JT5C 4FHLA 2Z2PA 5HE0B 4RE5A 3IJ1A 2B5MA 4E54A 2XL3A 2J57G 1Q47A 5EALA 4ZOZA 2YB8B 4J0WA 5HYNB 2VZ3A 4MMYA 5KDOB 3C99A 5AMSA 3PXTD 1O6GA 1E8MA 1U2VC 2P9UC 4GQ1A 4J8GA 4RE6A 3DWLC 3K6SA 3PSLA 5FA5B 2EBSA 1N6FA 4K3JB 3UVMA 4NAAA 2EIBA 4AN1A 4D9SA 3N0EA 1QNIA 3KRWB 4A0BA 5I5JA 5K19A 3UVKA 4J0XA 4GZ8A 4CC9A 5IGQA 4LG9A 3FCUA 4PBYA 5A2Qg 2VC2A 2HESX 1OMWB 3T3PA 2W18A 2G99A 4A2LA 4LGNA 4CI8A 3EI2B 4GM3A 4MK0B 3EMHA 3RFHA 2P9LC 3SBRA 3DSMA 1B9YA 2OJYA 3SLED 5FKQA 4GMBA 4FWWA 5TEFA 2OIZA 2CE9A 2H9NA 4JSXC 3MKSB 4L3HD 4IA9A 3T3MA 2GC4A 4AMZA 4DNWA 3UKRC 3ZE2A 4A08A 2GC7A 2VDKA 4NENA 5EMJB 3EI3A 4A0AA 2Z2OA 3EQ8A 3RN0D 3SVWD 5C92A 2XL2A 4O1QD 3OF7A 3SBPA 3DXMC 3SCYA 5M5UA 1GOHA 5TF2A 1GOGA 4FAVD 2HU5A 3EQ9A 3IUMA 3ZWLB 3E0CA 4J8BA 3I89A 3IURA 5C2VB 3P4FA 4QAMA 3IULA 2UZYB 2P9SC 4L3GD 3W15A 2VDNA 4Z8LA 4JHNA 1VYHC 1H2YA 4ERYA 2Q7QA 3MUOA 5EAPA 2QZPA 5AJAA 4A09A 2H6NA 4ES0A 1JV2A 5JWZA 2I0SA 3PE7A 3VI4A 3RSEC 4YVDA 1PBYB 1OLZA 2VDOA 1UOPA 3MVDK 4AN0A 3FRXA 4J86A 5B4WA 4GGDA 4X61B 4J78A 3ULEC 4AMYA 4L9OA 4CZXA 1A0RB 4MMXA 3I7PA 1H2ZA 1YR2A 3F3GA 4QQEA 3EU7A 2CN2A 4H5JA 3BG0A 5M5TA 2EICA 3V9FA 5M5SA 1VZ2A 1PEVA 2YNOA 5C2WB 4J79A 3IKOA 2GNQA 3ZDZA 1SQJA 2XYIA 4FA4D 3OL2B 3DM0A 2CNXA 4WJKA 4JHPC 3V4VA 4X3EA 2I3SA 1RI6A 1K3IA 2PM7B 4J81A 4A11B 3EI2A 1MG2A 4J73A 1H2XA 2PM9A 4IMMA 4HDJA 3IJ0A 1JTDB 1PI6A 2CN3A 2IUVA 3L4MD 4CZVA 2HKRA 2VDQA 4DNVA 2QC5A 4UM8A 2PBIB 4GGCA 1UTCA 3NVXA 4O45A 3O4HA 5I5IA 2UZXB 3O4JA 3JZGA 5K1CC 2CE8A 3AL8A 3V7DB 2I3TA 3SJLD 3FGBA 5HQGA 1SHYB 3SWSD 4ESGA 3O4GA 2B4EA 3OKYB 3IIYA 5GXHA 3GC3B 4ZOXA 5M5VA 4GQBB 1PGUA 5HE3B 2YNNA 4QL1A 2VDRA 4BCCA 4UI9R 3PVUB 3I8CA 3PSCB 5C86A 4L1QD 4X60B 4PNKB 4BCDA 2AGLA 2H9MA 3F3PA 3KCIA 4Z7OA 1QFMA 3QHYB 2BCJB 5TDHB 3CIKB 3PVWB 3I7OA 1O6FA 1QFSA 2H3XA 4K3ID 4O9DA 1T2XA 4FAND 3F3FA 3GREA 3K72A 2OK4A 3IJEA 4JSNC 3IUNA 4O02A 3EI1A 4PBZA 2VDPA 4GM9A 4J84A 4E5ZA 1VZ3A 3UR4A 5FKTA 2QR5A 5EM2A 3EG6A 5CXCB 5E6SA 2XU7A 3U4YA 3SBQA 2VDMA 3VGZA 4U7AA 4E54B 4JSVC 1GG2B 3AL9A 3K26A 5IJ7E 5CYKB 2HYEA 2J55H 1ERJA 2AGWA 4N14A 2OVPB 5FKRA 3J80g 3RFGA 4O3UB 5FKSA 4X63B 2WQ8A 4G1MA 4A2MA 4AEZA 3IJCA 3SXTD 4PC0A 3L4OD 3CFSB 3ODTA 4D6VA 2IUPA 3CFVA 5HDBA 5FXYA 3RN1D 2AGZA 5HE1B 2I0RA 3K27A 4CY3A 5AFU3 4A0BB 3JAMg 3IIWA 1N6EA 3JB9L 3NIFA 1L0QA 3V4PA 4NSXA 3HFQA 5THAA 3I7HA 3RRMC 5HE2B 2AQ5A 4BP9A 2BBKH 3EI4B 2AGYA 4KFMB 2CO0C 4JSPC 2IUQA 4WK2A 3VI3A 2AH1A 4WK0A 1N6DA 3UVLA 1M1XA 2YMUA 4Z7QA 4CI2A 1C9IA 5E6RA 4G1EA 1H2WA 1K8KC 1XKSA 5IC7A 3BWSA 5IGOA 3SHFA 3SMRA 1TYQC 4BP8A 5GXIA 4UM9A 5CXBB 4ERQA 3EWEA 4GGAA 5M5RA
chains in the Genus database with same CATH topology
4LG8A 2HKMA 4BL0A 5EMMB 3RMZD 3C75H 3I8EA 4A08B 1NR0A 3OW8A 3EI3B 2H9LA 5IT9g 4A0AB 3B7FA 4D0KA 3JRPA 1GOTB 2H14A 3NVQA 4ZN4A 4J82A 2OVRB 4PXWA 3AFCA 4CY5A 4CY2A 5I5MA 3A0FA 5FLXg 4A7JA 3MZLA 3MXXA 2AH0A 3RLMD 4BUJC 2P9KC 4JD2C 2B5LA 2AGXA 2QXVA 2YNPA 1JMXB 4A09B 3MZKA 2P9PC 4CY1A 2H47A 1XHMA 5CYKA 3UKUC 4Y7RA 4JXMA 4QT8A 3SN6B 3OTTA 1JMZB 4BH6A 2TRCB 4R7AB 1K32A 4CZYA 2IAAA 2IURA 3JZNA 3OKWA 3PXSD 3VH0A 2Z2NA 4OWRA 3OKTA 4QRJA 4XEIC 2P9IC 4JT6C 3PXWD 4FB1D 1XIPA 3EI4A 3V5WB 2OVQB 5H1MA 2HXCA 3KRXB 2B5NA 5GSAA 5H14A 2MTAH 4FA9D 4AOWA 1S4UX 4CI1A 4PSXB 1MDAH 2PM9B 4G56B 3J81g 1NEXB 3ORVD 5CXBA 2G9AA 2IWFA 5H17A 3I2NA 1GP2B 2J56H 2H13A 3OL2A 1R5MA 2YBAA 3BG1A 4J87A 4ZOVA 4PSWB 2IWKA 4A11A 3AL8B 2H6KA 1JJUB 3SFZA 2PM6B 3FM0A 5C9ZB 1JOFA 4ZOYA 3JROA 2HJBA 5EMLB 4CI3A 3NVNA 4H5IA 5EARA 5FQDA 1U4CA 1TBGA 4OZUA 2P9NC 4Y5RD 2CO0A 1MG3A 3I7KA 3C5MA 2OK6A 3UVOA 4O3TB 1B9XA 3OKYA 1GXRA 2HJ4A 3EI1B 1P22A 4XYIA 3GFCA 3DXKC 3C9CA 4E5ZB 4GM8A 1SQ9A 2H9PA 1FWXA 4I79A 5IJ8E 5EM2B 2O9KA 4EWRA 3AH8B 3JPXA 2H6QA 3I7LA 1YFQA 4XYHA 2H68A 3UVNA 4FA1D 3I7NA 4J77A 5TEEA 4U1EI 5SXMA 3JZHA 5EAMA 4FA5D 5GMKn 2I0TA 4TZ4A 5EMKB 4ERZA 4GQ2P 3MMYA 3N0DA 3MKQA 3VA6A 5CXCA 4JT5C 4FHLA 2Z2PA 5HE0B 3IJ1A 2B5MA 4E54A 2XL3A 2J57G 1Q47A 5EALA 4ZOZA 2YB8B 4J0WA 5HYNB 5KDOB 3C99A 5AMSA 3PXTD 2P9UC 4GQ1A 1U2VC 4J8GA 3DWLC 3PSLA 5FA5B 2EBSA 1N6FA 4K3JB 3UVMA 3N0EA 1QNIA 3KRWB 4A0BA 5I5JA 5K19A 3UVKA 4J0XA 4GZ8A 4CC9A 5IGQA 4LG9A 4PBYA 5A2Qg 2HESX 1OMWB 2W18A 2G99A 4A2LA 4LGNA 4CI8A 3EI2B 4GM3A 4MK0B 3EMHA 3RFHA 2P9LC 3SBRA 3DSMA 1B9YA 2OJYA 3SLED 5FKQA 4GMBA 4FWWA 5TEFA 2OIZA 2CE9A 2H9NA 4JSXC 3MKSB 4L3HD 4IA9A 2GC4A 3UKRC 4A08A 2GC7A 5EMJB 3EI3A 4A0AA 2Z2OA 3RN0D 3SVWD 2XL2A 4O1QD 3SBPA 3DXMC 3SCYA 5TF2A 4FAVD 3ZWLB 3E0CA 4J8BA 3I89A 5C2VB 3P4FA 2UZYB 2P9SC 4L3GD 3W15A 4Z8LA 1VYHC 4ERYA 2Q7QA 5EAPA 5AJAA 4A09A 2H6NA 4ES0A 5JWZA 2I0SA 3PE7A 3RSEC 4YVDA 1PBYB 1OLZA 3FRXA 4J86A 5B4WA 4GGDA 4X61B 4J78A 3ULEC 4L9OA 4CZXA 1A0RB 3I7PA 3F3GA 4QQEA 3EU7A 2CN2A 4H5JA 3BG0A 3V9FA 1PEVA 2YNOA 5C2WB 4J79A 3IKOA 2GNQA 1SQJA 2XYIA 4FA4D 3OL2B 3DM0A 2CNXA 4X3EA 2I3SA 1RI6A 2PM7B 4J81A 4A11B 3EI2A 1MG2A 4J73A 2PM9A 4IMMA 4HDJA 3IJ0A 1PI6A 2CN3A 2IUVA 3L4MD 4CZVA 2HKRA 2QC5A 2PBIB 4GGCA 4O45A 3NVXA 5I5IA 2UZXB 3JZGA 5K1CC 2CE8A 3AL8A 3V7DB 2I3TA 3SJLD 3FGBA 5HQGA 1SHYB 3SWSD 4ESGA 2B4EA 3OKYB 3IIYA 5GXHA 4ZOXA 4GQBB 1PGUA 5HE3B 2YNNA 4QL1A 4UI9R 3PVUB 3I8CA 3PSCB 4L1QD 4X60B 4PNKB 2AGLA 2H9MA 3F3PA 2BCJB 5TDHB 3CIKB 3PVWB 3I7OA 2H3XA 4O9DA 4K3ID 4FAND 3F3FA 3GREA 2OK4A 4JSNC 3EI1A 4PBZA 4GM9A 4J84A 4E5ZA 3UR4A 5FKTA 5EM2A 3EG6A 5CXCB 2XU7A 3U4YA 3SBQA 3VGZA 4U7AA 4E54B 4JSVC 1GG2B 3AL9A 3K26A 5IJ7E 5CYKB 2HYEA 2J55H 1ERJA 2AGWA 4N14A 2OVPB 5FKRA 3J80g 3RFGA 4O3UB 5FKSA 4X63B 4A2MA 4AEZA 3IJCA 3SXTD 4PC0A 3L4OD 3CFSB 3ODTA 4D6VA 2IUPA 3CFVA 5FXYA 3RN1D 2AGZA 5HE1B 2I0RA 3K27A 4CY3A 5AFU3 4A0BB 3JAMg 3IIWA 1N6EA 3JB9L 1L0QA 4NSXA 3HFQA 5THAA 3I7HA 3RRMC 5HE2B 2AQ5A 2BBKH 3EI4B 2AGYA 4KFMB 2CO0C 4JSPC 2IUQA 2AH1A 1N6DA 3UVLA 2YMUA 4CI2A 1K8KC 1XKSA 3SHFA 5IC7A 3BWSA 5IGOA 3SMRA 1TYQC 5GXIA 5CXBB 4ERQA 3EWEA 4GGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG8 A;  2HKM A;  4BL0 A;  5EMM B;  3RMZ D;  3C75 H;  3I8E A;  4A08 B;  1NR0 A;  3OW8 A;  3EI3 B;  2H9L A;  5IT9 g;  4A0A B;  3B7F A;  4D0K A;  3JRP A;  1GOT B;  2H14 A;  3NVQ A;  4ZN4 A;  4J82 A;  2OVR B;  4PXW A;  3AFC A;  4CY5 A;  4CY2 A;  5I5M A;  3A0F A;  5FLX g;  4A7J A;  3MZL A;  3MXX A;  2AH0 A;  3RLM D;  4BUJ C;  2P9K C;  4JD2 C;  2B5L A;  2AGX A;  2QXV A;  2YNP A;  1JMX B;  4A09 B;  3MZK A;  2P9P C;  4CY1 A;  2H47 A;  1XHM A;  5CYK A;  3UKU C;  4Y7R A;  4JXM A;  4QT8 A;  3SN6 B;  3OTT A;  1JMZ B;  4BH6 A;  2TRC B;  4R7A B;  1K32 A;  4CZY A;  2IAA A;  2IUR A;  3JZN A;  3OKW A;  3PXS D;  3VH0 A;  2Z2N A;  4OWR A;  3OKT A;  4QRJ A;  4XEI C;  2P9I C;  4JT6 C;  3PXW D;  4FB1 D;  1XIP A;  3EI4 A;  3V5W B;  2OVQ B;  5H1M A;  2HXC A;  3KRX B;  2B5N A;  5GSA A;  5H14 A;  2MTA H;  4FA9 D;  4AOW A;  1S4U X;  4CI1 A;  4PSX B;  1MDA H;  2PM9 B;  4G56 B;  3J81 g;  1NEX B;  3ORV D;  5CXB A;  2G9A A;  2IWF A;  5H17 A;  3I2N A;  1GP2 B;  2J56 H;  2H13 A;  3OL2 A;  1R5M A;  2YBA A;  3BG1 A;  4J87 A;  4ZOV A;  4PSW B;  2IWK A;  4A11 A;  3AL8 B;  2H6K A;  1JJU B;  3SFZ A;  2PM6 B;  3FM0 A;  5C9Z B;  1JOF A;  4ZOY A;  3JRO A;  2HJB A;  5EML B;  4CI3 A;  3NVN A;  4H5I A;  5EAR A;  5FQD A;  1U4C A;  1TBG A;  4OZU A;  2P9N C;  4Y5R D;  2CO0 A;  1MG3 A;  3I7K A;  3C5M A;  2OK6 A;  3UVO A;  4O3T B;  1B9X A;  3OKY A;  1GXR A;  2HJ4 A;  3EI1 B;  1P22 A;  4XYI A;  3GFC A;  3DXK C;  3C9C A;  4E5Z B;  4GM8 A;  1SQ9 A;  2H9P A;  1FWX A;  4I79 A;  5IJ8 E;  5EM2 B;  2O9K A;  4EWR A;  3AH8 B;  3JPX A;  2H6Q A;  3I7L A;  1YFQ A;  4XYH A;  2H68 A;  3UVN A;  4FA1 D;  3I7N A;  4J77 A;  5TEE A;  4U1E I;  5SXM A;  3JZH A;  5EAM A;  4FA5 D;  5GMK n;  2I0T A;  4TZ4 A;  5EMK B;  4ERZ A;  4GQ2 P;  3MMY A;  3N0D A;  3MKQ A;  3VA6 A;  5CXC A;  4JT5 C;  4FHL A;  2Z2P A;  5HE0 B;  3IJ1 A;  2B5M A;  4E54 A;  2XL3 A;  2J57 G;  1Q47 A;  5EAL A;  4ZOZ A;  2YB8 B;  4J0W A;  5HYN B;  5KDO B;  3C99 A;  5AMS A;  3PXT D;  2P9U C;  4GQ1 A;  1U2V C;  4J8G A;  3DWL C;  3PSL A;  5FA5 B;  2EBS A;  1N6F A;  4K3J B;  3UVM A;  3N0E A;  1QNI A;  3KRW B;  4A0B A;  5I5J A;  5K19 A;  3UVK A;  4J0X A;  4GZ8 A;  4CC9 A;  5IGQ A;  4LG9 A;  4PBY A;  5A2Q g;  2HES X;  1OMW B;  2W18 A;  2G99 A;  4A2L A;  4LGN A;  4CI8 A;  3EI2 B;  4GM3 A;  4MK0 B;  3EMH A;  3RFH A;  2P9L C;  3SBR A;  3DSM A;  1B9Y A;  2OJY A;  3SLE D;  5FKQ A;  4GMB A;  4FWW A;  5TEF A;  2OIZ A;  2CE9 A;  2H9N A;  4JSX C;  3MKS B;  4L3H D;  4IA9 A;  2GC4 A;  3UKR C;  4A08 A;  2GC7 A;  5EMJ B;  3EI3 A;  4A0A A;  2Z2O A;  3RN0 D;  3SVW D;  2XL2 A;  4O1Q D;  3SBP A;  3DXM C;  3SCY A;  5TF2 A;  4FAV D;  3ZWL B;  3E0C A;  4J8B A;  3I89 A;  5C2V B;  3P4F A;  2UZY B;  2P9S C;  4L3G D;  3W15 A;  4Z8L A;  1VYH C;  4ERY A;  2Q7Q A;  5EAP A;  5AJA A;  4A09 A;  2H6N A;  4ES0 A;  5JWZ A;  2I0S A;  3PE7 A;  3RSE C;  4YVD A;  1PBY B;  1OLZ A;  3FRX A;  4J86 A;  5B4W A;  4GGD A;  4X61 B;  4J78 A;  3ULE C;  4L9O A;  4CZX A;  1A0R B;  3I7P A;  3F3G A;  4QQE A;  3EU7 A;  2CN2 A;  4H5J A;  3BG0 A;  3V9F A;  1PEV A;  2YNO A;  5C2W B;  4J79 A;  3IKO A;  2GNQ A;  1SQJ A;  2XYI A;  4FA4 D;  3OL2 B;  3DM0 A;  2CNX A;  4X3E A;  2I3S A;  1RI6 A;  2PM7 B;  4J81 A;  4A11 B;  3EI2 A;  1MG2 A;  4J73 A;  2PM9 A;  4IMM A;  4HDJ A;  3IJ0 A;  1PI6 A;  2CN3 A;  2IUV A;  3L4M D;  4CZV A;  2HKR A;  2QC5 A;  2PBI B;  4GGC A;  4O45 A;  3NVX A;  5I5I A;  2UZX B;  3JZG A;  5K1C C;  2CE8 A;  3AL8 A;  3V7D B;  2I3T A;  3SJL D;  3FGB A;  5HQG A;  1SHY B;  3SWS D;  4ESG A;  2B4E A;  3OKY B;  3IIY A;  5GXH A;  4ZOX A;  4GQB B;  1PGU A;  5HE3 B;  2YNN A;  4QL1 A;  4UI9 R;  3PVU B;  3I8C A;  3PSC B;  4L1Q D;  4X60 B;  4PNK B;  2AGL A;  2H9M A;  3F3P A;  2BCJ B;  5TDH B;  3CIK B;  3PVW B;  3I7O A;  2H3X A;  4O9D A;  4K3I D;  4FAN D;  3F3F A;  3GRE A;  2OK4 A;  4JSN C;  3EI1 A;  4PBZ A;  4GM9 A;  4J84 A;  4E5Z A;  3UR4 A;  5FKT A;  5EM2 A;  3EG6 A;  5CXC B;  2XU7 A;  3U4Y A;  3SBQ A;  3VGZ A;  4U7A A;  4E54 B;  4JSV C;  1GG2 B;  3AL9 A;  3K26 A;  5IJ7 E;  5CYK B;  2HYE A;  2J55 H;  1ERJ A;  2AGW A;  4N14 A;  2OVP B;  5FKR A;  3J80 g;  3RFG A;  4O3U B;  5FKS A;  4X63 B;  4A2M A;  4AEZ A;  3IJC A;  3SXT D;  4PC0 A;  3L4O D;  3CFS B;  3ODT A;  4D6V A;  2IUP A;  3CFV A;  5FXY A;  3RN1 D;  2AGZ A;  5HE1 B;  2I0R A;  3K27 A;  4CY3 A;  5AFU 3;  4A0B B;  3JAM g;  3IIW A;  1N6E A;  3JB9 L;  1L0Q A;  4NSX A;  3HFQ A;  5THA A;  3I7H A;  3RRM C;  5HE2 B;  2AQ5 A;  2BBK H;  3EI4 B;  2AGY A;  4KFM B;  2CO0 C;  4JSP C;  2IUQ A;  2AH1 A;  1N6D A;  3UVL A;  2YMU A;  4CI2 A;  1K8K C;  1XKS A;  3SHF A;  5IC7 A;  3BWS A;  5IGO A;  3SMR A;  1TYQ C;  5GXI A;  5CXB B;  4ERQ A;  3EWE A;  4GGA A; 
#chains in the Genus database with same CATH topology
 4LG8 A;  2HKM A;  4BL0 A;  5EMM B;  3RMZ D;  3O4I A;  3C75 H;  3ZE0 A;  3I8E A;  4A08 B;  1NR0 A;  3OW8 A;  3EI3 B;  2H9L A;  5IT9 g;  4A0A B;  1E5T A;  3B7F A;  4D0K A;  1UOQ A;  3JRP A;  1GOT B;  2EIE A;  2H14 A;  5FFO A;  3NVQ A;  4ZN4 A;  3FCS A;  4J82 A;  2OVR B;  2HU7 A;  1A12 A;  3NIG A;  4PXW A;  3AFC A;  4NC4 A;  4CY5 A;  4CY2 A;  5I5M A;  3ZDX A;  3A0F A;  5FLX g;  4A7J A;  4Z7N A;  1BPO A;  3MXX A;  2AH0 A;  3MZL A;  3RLM D;  4BUJ C;  4G55 A;  2P9K C;  4JD2 C;  2B5L A;  3K71 A;  2AGX A;  2QXV A;  2YNP A;  1JMX B;  4O2W A;  4A09 B;  3MZK A;  2P9P C;  4CY1 A;  2H47 A;  1XHM A;  5CYK A;  3UKU C;  3ZDY A;  4Y7R A;  4JXM A;  1C9L A;  4QT8 A;  3SN6 B;  3GD1 I;  3OTT A;  3EQ7 A;  4WK4 A;  1JMZ B;  4BH6 A;  2TRC B;  2XDW A;  1K32 A;  2JKX A;  4R7A B;  4CZY A;  2IAA A;  2VDL A;  3IVM A;  2IUR A;  3JZN A;  3OKW A;  3PXS D;  3VH0 A;  2Z2N A;  3IUJ A;  4OWR A;  3OKT A;  1GOF A;  4BCB A;  4QRJ A;  4XEI C;  2P9I C;  4JT6 C;  3PXW D;  1E8N A;  1L5G A;  4FB1 D;  1XIP A;  4L1M A;  4MMZ A;  3EI4 A;  3V5W B;  2OVQ B;  5H1M A;  2HXC A;  2HU8 A;  3KRX B;  2B5N A;  5GSA A;  5H14 A;  2MTA H;  4FA9 D;  5M61 A;  4AOW A;  1S4U X;  4CI1 A;  4PSX B;  1MDA H;  2BKL A;  2PM9 B;  4G56 B;  3J81 g;  1NEX B;  3ORV D;  5CXB A;  1U8C A;  2G9A A;  2IWF A;  2XZG A;  3I2N A;  5H17 A;  1TYE A;  1GP2 B;  2J56 H;  3NID A;  2H13 A;  3OL2 A;  1R5M A;  2YBA A;  5E6U A;  3BG1 A;  4J87 A;  4ZOV A;  4PSW B;  2IWK A;  2XE4 A;  3IUQ A;  4A11 A;  3AL8 B;  5FFG A;  2H6K A;  1JJU B;  3SFZ A;  2PM6 B;  3FM0 A;  5C9Z B;  1JOF A;  4ZOY A;  3JRO A;  2HJB A;  5EML B;  4CI3 A;  3NVN A;  1VE6 A;  4H5I A;  5EAR A;  5FQD A;  1U4C A;  1TBG A;  4OZU A;  3QI0 A;  2P9N C;  4Y5R D;  2CO0 A;  1MG3 A;  3I7K A;  2VZ1 A;  3C5M A;  3MUN A;  2OK6 A;  3ZE1 A;  3UVO A;  4O3T B;  1VE7 A;  4DNU A;  1B9X A;  3OKY A;  1GXR A;  4IRZ A;  2HJ4 A;  3EI1 B;  1P22 A;  4XYI A;  3GFC A;  3DXK C;  3C9C A;  1UOO A;  4GM8 A;  1SQ9 A;  4E5Z B;  2H9P A;  1FWX A;  4I79 A;  5IJ8 E;  5EM2 B;  2O9K A;  4EWR A;  3AH8 B;  2EID A;  3JPX A;  2H6Q A;  3I7L A;  3DDU A;  1YFQ A;  4XYH A;  2H68 A;  3UVN A;  1I2M B;  4FA1 D;  3I7N A;  4J77 A;  5TEE A;  4U1E I;  5SXM A;  3JZH A;  5EAM A;  4FA5 D;  5GMK n;  2I0T A;  4TZ4 A;  5EMK B;  4ERZ A;  4GQ2 P;  4AX4 A;  3MMY A;  3N0D A;  4NBM A;  3MKQ A;  3VA6 A;  5CXC A;  4JT5 C;  4FHL A;  2Z2P A;  5HE0 B;  4RE5 A;  3IJ1 A;  2B5M A;  4E54 A;  2XL3 A;  2J57 G;  1Q47 A;  5EAL A;  4ZOZ A;  2YB8 B;  4J0W A;  5HYN B;  2VZ3 A;  4MMY A;  5KDO B;  3C99 A;  5AMS A;  3PXT D;  1O6G A;  1E8M A;  1U2V C;  2P9U C;  4GQ1 A;  4J8G A;  4RE6 A;  3DWL C;  3K6S A;  3PSL A;  5FA5 B;  2EBS A;  1N6F A;  4K3J B;  3UVM A;  4NAA A;  2EIB A;  4AN1 A;  4D9S A;  3N0E A;  1QNI A;  3KRW B;  4A0B A;  5I5J A;  5K19 A;  3UVK A;  4J0X A;  4GZ8 A;  4CC9 A;  5IGQ A;  4LG9 A;  3FCU A;  4PBY A;  5A2Q g;  2VC2 A;  2HES X;  1OMW B;  3T3P A;  2W18 A;  2G99 A;  4A2L A;  4LGN A;  4CI8 A;  3EI2 B;  4GM3 A;  4MK0 B;  3EMH A;  3RFH A;  2P9L C;  3SBR A;  3DSM A;  1B9Y A;  2OJY A;  3SLE D;  5FKQ A;  4GMB A;  4FWW A;  5TEF A;  2OIZ A;  2CE9 A;  2H9N A;  4JSX C;  3MKS B;  4L3H D;  4IA9 A;  3T3M A;  2GC4 A;  4AMZ A;  4DNW A;  3UKR C;  3ZE2 A;  4A08 A;  2GC7 A;  2VDK A;  4NEN A;  5EMJ B;  3EI3 A;  4A0A A;  2Z2O A;  3EQ8 A;  3RN0 D;  3SVW D;  5C92 A;  2XL2 A;  4O1Q D;  3OF7 A;  3SBP A;  3DXM C;  3SCY A;  5M5U A;  1GOH A;  5TF2 A;  1GOG A;  4FAV D;  2HU5 A;  3EQ9 A;  3IUM A;  3ZWL B;  3E0C A;  4J8B A;  3I89 A;  3IUR A;  5C2V B;  3P4F A;  4QAM A;  3IUL A;  2UZY B;  2P9S C;  4L3G D;  3W15 A;  2VDN A;  4Z8L A;  4JHN A;  1VYH C;  1H2Y A;  4ERY A;  2Q7Q A;  3MUO A;  5EAP A;  2QZP A;  5AJA A;  4A09 A;  2H6N A;  4ES0 A;  1JV2 A;  5JWZ A;  2I0S A;  3PE7 A;  3VI4 A;  3RSE C;  4YVD A;  1PBY B;  1OLZ A;  2VDO A;  1UOP A;  3MVD K;  4AN0 A;  3FRX A;  4J86 A;  5B4W A;  4GGD A;  4X61 B;  4J78 A;  3ULE C;  4AMY A;  4L9O A;  4CZX A;  1A0R B;  4MMX A;  3I7P A;  1H2Z A;  1YR2 A;  3F3G A;  4QQE A;  3EU7 A;  2CN2 A;  4H5J A;  3BG0 A;  5M5T A;  2EIC A;  3V9F A;  5M5S A;  1VZ2 A;  1PEV A;  2YNO A;  5C2W B;  4J79 A;  3IKO A;  2GNQ A;  3ZDZ A;  1SQJ A;  2XYI A;  4FA4 D;  3OL2 B;  3DM0 A;  2CNX A;  4WJK A;  4JHP C;  3V4V A;  4X3E A;  2I3S A;  1RI6 A;  1K3I A;  2PM7 B;  4J81 A;  4A11 B;  3EI2 A;  1MG2 A;  4J73 A;  1H2X A;  2PM9 A;  4IMM A;  4HDJ A;  3IJ0 A;  1JTD B;  1PI6 A;  2CN3 A;  2IUV A;  3L4M D;  4CZV A;  2HKR A;  2VDQ A;  4DNV A;  2QC5 A;  4UM8 A;  2PBI B;  4GGC A;  1UTC A;  3NVX A;  4O45 A;  3O4H A;  5I5I A;  2UZX B;  3O4J A;  3JZG A;  5K1C C;  2CE8 A;  3AL8 A;  3V7D B;  2I3T A;  3SJL D;  3FGB A;  5HQG A;  1SHY B;  3SWS D;  4ESG A;  3O4G A;  2B4E A;  3OKY B;  3IIY A;  5GXH A;  3GC3 B;  4ZOX A;  5M5V A;  4GQB B;  1PGU A;  5HE3 B;  2YNN A;  4QL1 A;  2VDR A;  4BCC A;  4UI9 R;  3PVU B;  3I8C A;  3PSC B;  5C86 A;  4L1Q D;  4X60 B;  4PNK B;  4BCD A;  2AGL A;  2H9M A;  3F3P A;  3KCI A;  4Z7O A;  1QFM A;  3QHY B;  2BCJ B;  5TDH B;  3CIK B;  3PVW B;  3I7O A;  1O6F A;  1QFS A;  2H3X A;  4K3I D;  4O9D A;  1T2X A;  4FAN D;  3F3F A;  3GRE A;  3K72 A;  2OK4 A;  3IJE A;  4JSN C;  3IUN A;  4O02 A;  3EI1 A;  4PBZ A;  2VDP A;  4GM9 A;  4J84 A;  4E5Z A;  1VZ3 A;  3UR4 A;  5FKT A;  2QR5 A;  5EM2 A;  3EG6 A;  5CXC B;  5E6S A;  2XU7 A;  3U4Y A;  3SBQ A;  2VDM A;  3VGZ A;  4U7A A;  4E54 B;  4JSV C;  1GG2 B;  3AL9 A;  3K26 A;  5IJ7 E;  5CYK B;  2HYE A;  2J55 H;  1ERJ A;  2AGW A;  4N14 A;  2OVP B;  5FKR A;  3J80 g;  3RFG A;  4O3U B;  5FKS A;  4X63 B;  2WQ8 A;  4G1M A;  4A2M A;  4AEZ A;  3IJC A;  3SXT D;  4PC0 A;  3L4O D;  3CFS B;  3ODT A;  4D6V A;  2IUP A;  3CFV A;  5HDB A;  5FXY A;  3RN1 D;  2AGZ A;  5HE1 B;  2I0R A;  3K27 A;  4CY3 A;  5AFU 3;  4A0B B;  3JAM g;  3IIW A;  1N6E A;  3JB9 L;  3NIF A;  1L0Q A;  3V4P A;  4NSX A;  3HFQ A;  5THA A;  3I7H A;  3RRM C;  5HE2 B;  2AQ5 A;  4BP9 A;  2BBK H;  3EI4 B;  2AGY A;  4KFM B;  2CO0 C;  4JSP C;  2IUQ A;  4WK2 A;  3VI3 A;  2AH1 A;  4WK0 A;  1N6D A;  3UVL A;  1M1X A;  2YMU A;  4Z7Q A;  4CI2 A;  1C9I A;  5E6R A;  4G1E A;  1H2W A;  1K8K C;  1XKS A;  5IC7 A;  3BWS A;  5IGO A;  3SHF A;  3SMR A;  1TYQ C;  4BP8 A;  5GXI A;  4UM9 A;  5CXB B;  4ERQ A;  3EWE A;  4GGA A;  5M5R A; 
#chains in the Genus database with same CATH homology
 4LG8 A;  2HKM A;  4BL0 A;  5EMM B;  3RMZ D;  3C75 H;  3I8E A;  4A08 B;  1NR0 A;  3OW8 A;  3EI3 B;  2H9L A;  5IT9 g;  4A0A B;  3B7F A;  4D0K A;  3JRP A;  1GOT B;  2H14 A;  3NVQ A;  4ZN4 A;  4J82 A;  2OVR B;  4PXW A;  3AFC A;  4CY5 A;  4CY2 A;  5I5M A;  3A0F A;  5FLX g;  4A7J A;  3MZL A;  3MXX A;  2AH0 A;  3RLM D;  4BUJ C;  2P9K C;  4JD2 C;  2B5L A;  2AGX A;  2QXV A;  2YNP A;  1JMX B;  4A09 B;  3MZK A;  2P9P C;  4CY1 A;  2H47 A;  1XHM A;  5CYK A;  3UKU C;  4Y7R A;  4JXM A;  4QT8 A;  3SN6 B;  3OTT A;  1JMZ B;  4BH6 A;  2TRC B;  4R7A B;  1K32 A;  4CZY A;  2IAA A;  2IUR A;  3JZN A;  3OKW A;  3PXS D;  3VH0 A;  2Z2N A;  4OWR A;  3OKT A;  4QRJ A;  4XEI C;  2P9I C;  4JT6 C;  3PXW D;  4FB1 D;  1XIP A;  3EI4 A;  3V5W B;  2OVQ B;  5H1M A;  2HXC A;  3KRX B;  2B5N A;  5GSA A;  5H14 A;  2MTA H;  4FA9 D;  4AOW A;  1S4U X;  4CI1 A;  4PSX B;  1MDA H;  2PM9 B;  4G56 B;  3J81 g;  1NEX B;  3ORV D;  5CXB A;  2G9A A;  2IWF A;  5H17 A;  3I2N A;  1GP2 B;  2J56 H;  2H13 A;  3OL2 A;  1R5M A;  2YBA A;  3BG1 A;  4J87 A;  4ZOV A;  4PSW B;  2IWK A;  4A11 A;  3AL8 B;  2H6K A;  1JJU B;  3SFZ A;  2PM6 B;  3FM0 A;  5C9Z B;  1JOF A;  4ZOY A;  3JRO A;  2HJB A;  5EML B;  4CI3 A;  3NVN A;  4H5I A;  5EAR A;  5FQD A;  1U4C A;  1TBG A;  4OZU A;  2P9N C;  4Y5R D;  2CO0 A;  1MG3 A;  3I7K A;  3C5M A;  2OK6 A;  3UVO A;  4O3T B;  1B9X A;  3OKY A;  1GXR A;  2HJ4 A;  3EI1 B;  1P22 A;  4XYI A;  3GFC A;  3DXK C;  3C9C A;  4E5Z B;  4GM8 A;  1SQ9 A;  2H9P A;  1FWX A;  4I79 A;  5IJ8 E;  5EM2 B;  2O9K A;  4EWR A;  3AH8 B;  3JPX A;  2H6Q A;  3I7L A;  1YFQ A;  4XYH A;  2H68 A;  3UVN A;  4FA1 D;  3I7N A;  4J77 A;  5TEE A;  4U1E I;  5SXM A;  3JZH A;  5EAM A;  4FA5 D;  5GMK n;  2I0T A;  4TZ4 A;  5EMK B;  4ERZ A;  4GQ2 P;  3MMY A;  3N0D A;  3MKQ A;  3VA6 A;  5CXC A;  4JT5 C;  4FHL A;  2Z2P A;  5HE0 B;  3IJ1 A;  2B5M A;  4E54 A;  2XL3 A;  2J57 G;  1Q47 A;  5EAL A;  4ZOZ A;  2YB8 B;  4J0W A;  5HYN B;  5KDO B;  3C99 A;  5AMS A;  3PXT D;  2P9U C;  4GQ1 A;  1U2V C;  4J8G A;  3DWL C;  3PSL A;  5FA5 B;  2EBS A;  1N6F A;  4K3J B;  3UVM A;  3N0E A;  1QNI A;  3KRW B;  4A0B A;  5I5J A;  5K19 A;  3UVK A;  4J0X A;  4GZ8 A;  4CC9 A;  5IGQ A;  4LG9 A;  4PBY A;  5A2Q g;  2HES X;  1OMW B;  2W18 A;  2G99 A;  4A2L A;  4LGN A;  4CI8 A;  3EI2 B;  4GM3 A;  4MK0 B;  3EMH A;  3RFH A;  2P9L C;  3SBR A;  3DSM A;  1B9Y A;  2OJY A;  3SLE D;  5FKQ A;  4GMB A;  4FWW A;  5TEF A;  2OIZ A;  2CE9 A;  2H9N A;  4JSX C;  3MKS B;  4L3H D;  4IA9 A;  2GC4 A;  3UKR C;  4A08 A;  2GC7 A;  5EMJ B;  3EI3 A;  4A0A A;  2Z2O A;  3RN0 D;  3SVW D;  2XL2 A;  4O1Q D;  3SBP A;  3DXM C;  3SCY A;  5TF2 A;  4FAV D;  3ZWL B;  3E0C A;  4J8B A;  3I89 A;  5C2V B;  3P4F A;  2UZY B;  2P9S C;  4L3G D;  3W15 A;  4Z8L A;  1VYH C;  4ERY A;  2Q7Q A;  5EAP A;  5AJA A;  4A09 A;  2H6N A;  4ES0 A;  5JWZ A;  2I0S A;  3PE7 A;  3RSE C;  4YVD A;  1PBY B;  1OLZ A;  3FRX A;  4J86 A;  5B4W A;  4GGD A;  4X61 B;  4J78 A;  3ULE C;  4L9O A;  4CZX A;  1A0R B;  3I7P A;  3F3G A;  4QQE A;  3EU7 A;  2CN2 A;  4H5J A;  3BG0 A;  3V9F A;  1PEV A;  2YNO A;  5C2W B;  4J79 A;  3IKO A;  2GNQ A;  1SQJ A;  2XYI A;  4FA4 D;  3OL2 B;  3DM0 A;  2CNX A;  4X3E A;  2I3S A;  1RI6 A;  2PM7 B;  4J81 A;  4A11 B;  3EI2 A;  1MG2 A;  4J73 A;  2PM9 A;  4IMM A;  4HDJ A;  3IJ0 A;  1PI6 A;  2CN3 A;  2IUV A;  3L4M D;  4CZV A;  2HKR A;  2QC5 A;  2PBI B;  4GGC A;  4O45 A;  3NVX A;  5I5I A;  2UZX B;  3JZG A;  5K1C C;  2CE8 A;  3AL8 A;  3V7D B;  2I3T A;  3SJL D;  3FGB A;  5HQG A;  1SHY B;  3SWS D;  4ESG A;  2B4E A;  3OKY B;  3IIY A;  5GXH A;  4ZOX A;  4GQB B;  1PGU A;  5HE3 B;  2YNN A;  4QL1 A;  4UI9 R;  3PVU B;  3I8C A;  3PSC B;  4L1Q D;  4X60 B;  4PNK B;  2AGL A;  2H9M A;  3F3P A;  2BCJ B;  5TDH B;  3CIK B;  3PVW B;  3I7O A;  2H3X A;  4O9D A;  4K3I D;  4FAN D;  3F3F A;  3GRE A;  2OK4 A;  4JSN C;  3EI1 A;  4PBZ A;  4GM9 A;  4J84 A;  4E5Z A;  3UR4 A;  5FKT A;  5EM2 A;  3EG6 A;  5CXC B;  2XU7 A;  3U4Y A;  3SBQ A;  3VGZ A;  4U7A A;  4E54 B;  4JSV C;  1GG2 B;  3AL9 A;  3K26 A;  5IJ7 E;  5CYK B;  2HYE A;  2J55 H;  1ERJ A;  2AGW A;  4N14 A;  2OVP B;  5FKR A;  3J80 g;  3RFG A;  4O3U B;  5FKS A;  4X63 B;  4A2M A;  4AEZ A;  3IJC A;  3SXT D;  4PC0 A;  3L4O D;  3CFS B;  3ODT A;  4D6V A;  2IUP A;  3CFV A;  5FXY A;  3RN1 D;  2AGZ A;  5HE1 B;  2I0R A;  3K27 A;  4CY3 A;  5AFU 3;  4A0B B;  3JAM g;  3IIW A;  1N6E A;  3JB9 L;  1L0Q A;  4NSX A;  3HFQ A;  5THA A;  3I7H A;  3RRM C;  5HE2 B;  2AQ5 A;  2BBK H;  3EI4 B;  2AGY A;  4KFM B;  2CO0 C;  4JSP C;  2IUQ A;  2AH1 A;  1N6D A;  3UVL A;  2YMU A;  4CI2 A;  1K8K C;  1XKS A;  3SHF A;  5IC7 A;  3BWS A;  5IGO A;  3SMR A;  1TYQ C;  5GXI A;  5CXB B;  4ERQ A;  3EWE A;  4GGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...