2H9NA

Wdr5 in complex with monomethylated h3k4 peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, gene regulation
total genus 96
structure length 304
sequence length 304
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h9nA00
3EI3A 1B9XA 4X61B 2AGLA 5A2Qg 2I3TA 4G56B 2J57G 3ULEC 2YNPA 3PXTD 4A2MA 3UVOA 2UZXB 4GM8A 1MG2A 1QNIA 1TBGA 4J82A 4N14A 5CXBA 3SBPA 3UKUC 4R7AB 4XEIC 2OVQB 4Y5RD 2CN3A 1S4UX 3C5MA 5EAPA 4ZOYA 4H5IA 2Z2NA 3K27A 4ESGA 2AQ5A 3SHFA 1OMWB 2P9UC 2H14A 2G99A 3EI3B 3DXMC 4JSPC 4L3GD 5EMMB 3JRPA 4J0WA 4U7AA 4H5JA 4ERYA 3PVWB 1JOFA 3V5WB 3PSLA 3PXWD 2B4EA 3SLED 2HESX 4EWRA 5TF2A 5HQGA 3DSMA 3U4YA 1XIPA 1NEXB 4JT6C 4IMMA 3JZGA 1XKSA 4J8GA 5CXBB 4JXMA 3BG0A 4J87A 3I8EA 5AJAA 4FB1D 5H14A 5EMLB 4JSXC 4J78A 4A0AA 2YB8B 1A0RB 4GM3A 5FKSA 3RN1D 2P9KC 5CYKA 3IJ1A 3PSCB 4CY5A 3MZLA 1YFQA 4L9OA 4GZ8A 2Q7QA 3ORVD 3EG6A 3DM0A 4GQ2P 4BL0A 5FLXg 4FWWA 2O9KA 5THAA 2CO0A 3GREA 3IKOA 2B5MA 2PBIB 3NVNA 5IJ7E 3SCYA 5AFU3 5TEEA 2B5NA 3OKWA 2QC5A 3ODTA 1U2VC 4K3JB 4A0AB 2H6QA 4D0KA 3VH0A 2PM9A 4CZYA 5CYKB 4CI1A 4U1EI 4PBYA 5FQDA 2GC4A 2B5LA 3FGBA 3ZWLB 4AOWA 4A09A 3JZHA 4IA9A 5GXIA 2P9IC 3F3PA 2H68A 3B7FA 4J79A 4JT5C 3SXTD 3PVUB 2OK6A 5GMKn 4E54A 4JSNC 3VGZA 3GFCA 2PM6B 2PM9B 4OWRA 3C75H 3CFSB 4XYIA 4KFMB 1SQJA 5FKRA 1GP2B 4FA4D 3RN0D 4A09B 2XYIA 3JAMg 1SHYB 4D6VA 1Q47A 2IAAA 3RFHA 3PXSD 1OLZA 3MKQA 3IIWA 3OL2A 3PE7A 4Z8LA 3EI1A 5SXMA 4O9DA 5C2VB 3I7NA 3RRMC 3OKTA 2OJYA 3I7KA 3N0EA 4E54B 3SJLD 3N0DA 3VA6A 4J77A 1GXRA 4A2LA 2CN2A 1N6FA 3I89A 2CE8A 2AGXA 5EM2A 5IT9g 3OKYA 5EMJB 1MDAH 2XL3A 4FA5D 2AGWA 1PI6A 4CC9A 2IURA 3EU7A 5HE0B 2YMUA 4CZVA 3UVLA 3C9CA 4CZXA 3OL2B 3EI1B 3EI2A 2J55H 2GC7A 2P9NC 5HYNB 2TRCB 1FWXA 4NSXA 1GG2B 5HE3B 5EMKB 1PGUA 2EBSA 2HKRA 5IJ8E 1SQ9A 5IGOA 4J86A 3SMRA 4CY2A 1K8KC 4TZ4A 3W15A 2I0TA 2XL2A 2Z2PA 2MTAH 4GQBB 2P9LC 3JB9L 5EM2B 5I5MA 2HXCA 3OKYB 1VYHC 3KRXB 3IJ0A 3SWSD 4X3EA 5H1MA 1PBYB 2H3XA 4PBZA 5B4WA 3EMHA 2IUQA 3AL9A 3EI4A 3I2NA 2OVPB 2P9PC 3SBQA 1N6EA 2I0RA 3EI2B 3I7HA 3I7PA 4QL1A 5EAMA 3SVWD 4O45A 2H9MA 4O3UB 3F3GA 2YNNA 1JMZB 3I7LA 3NVXA 2H9PA 2IWFA 4MK0B 4Y7RA 1TYQC 5CXCA 5H17A 2H6KA 4ZOVA 1PEVA 3UVMA 3I7OA 5KDOB 4I79A 5TEFA 2HYEA 4A7JA 4L1QD 4GGCA 4BH6A 3UVNA 2YNOA 4ES0A 3RLMD 3AFCA 4J0XA 3RFGA 2BCJB 1MG3A 4J81A 5JWZA 2H13A 3EI4B 4K3ID 4OZUA 4J73A 4PC0A 2HJ4A 1NR0A 4FA1D 2Z2OA 4HDJA 5GXHA 3BG1A 4PSXB 4LG9A 4XYHA 5HE1B 3BWSA 3EWEA 1JJUB 1K32A 4QT8A 4PXWA 3KRWB 4CY3A 2AGZA 4J84A 3IJCA 5CXCB 4A08A 4GQ1A 4BUJC 2I3SA 4GM9A 1N6DA 5I5JA 3F3FA 4QRJA 3MZKA 4ZOZA 5FKTA 3NVQA 3E0CA 3DXKC 2CE9A 2XU7A 2HKMA 2G9AA 4AEZA 2J56H 5K1CC 4GGDA 3JPXA 4J8BA 2OVRB 2OK4A 2AH1A 4PSWB 4A08B 3V9FA 1L0QA 4E5ZA 4LG8A 3UR4A 4CI8A 1RI6A 2CO0C 1XHMA 4ZN4A 4CY1A 3SN6B 2OIZA 2H6NA 3UVKA 4CI3A 3HFQA 5K19A 2IUPA 2PM7B 4X63B 3L4MD 4QQEA 3V7DB 4JSVC 2AH0A 3MMYA 4A11A 1U4CA 3A0FA 4X60B 3JROA 3DWLC 3OTTA 4A0BA 4L3HD 4CI2A 2IWKA 5EARA 5C2WB 3I8CA 3MKSB 1JMXB 2H47A 4ZOXA 5FXYA 4E5ZB 3C99A 3J81g 4JD2C 2P9SC 2W18A 5GSAA 2IUVA 4GMBA 3SBRA 3FRXA 3AH8B 2H9NA 5EALA 5FKQA 2H9LA 4FHLA 2HJBA 4YVDA 3CFVA 5IC7A 3UKRC 1B9YA 4O1QD 4A11B 3J80g 3AL8A 2QXVA 5AMSA 1ERJA 3RSEC 4FA9D 3CIKB 3JZNA 4A0BB 2I0SA 5I5IA 1GOTB 4FAVD 5IGQA 2GNQA 4UI9R 3FM0A 3RMZD 3L4OD 2BBKH 3IIYA 1R5MA 3K26A 1P22A 4LGNA 2YBAA 4ERQA 5C9ZB 2CNXA 4O3TB 2UZYB 3MXXA 3P4FA 4PNKB 3AL8B 5FA5B 5HE2B 4FAND 4ERZA 3OW8A 4GGAA 5TDHB 3SFZA 2AGYA
chains in the Genus database with same CATH superfamily
3EI3A 2JKXA 1B9XA 4X61B 2AGLA 5A2Qg 1C9LA 2I3TA 4G56B 2J57G 3ULEC 1U8CA 2YNPA 3PXTD 4RE6A 4A2MA 3UVOA 3T3PA 2UZXB 4GM8A 2QZPA 1MG2A 5E6RA 1QNIA 4MMZA 1TBGA 4J82A 4N14A 5CXBA 3SBPA 3UKUC 4AMYA 4R7AB 4XEIC 2OVQB 4Y5RD 2CN3A 4G1EA 1S4UX 3C5MA 5EAPA 4ZOYA 4H5IA 2Z2NA 3K27A 4ESGA 2AQ5A 3IVMA 3QI0A 3SHFA 1OMWB 3V4VA 3OF7A 2P9UC 2H14A 4IRZA 2G99A 3EI3B 3GD1I 3DXMC 4JSPC 4L3GD 5EMMB 3JRPA 4J0WA 4U7AA 4H5JA 4ERYA 3PVWB 1JOFA 3V5WB 3PSLA 3PXWD 4WJKA 2B4EA 3SLED 1H2WA 3V4PA 2HESX 4EWRA 5TF2A 5HQGA 3DSMA 3U4YA 2EIEA 1XIPA 1NEXB 4JT6C 4IMMA 3JZGA 1XKSA 4J8GA 1K3IA 4JXMA 5CXBB 3BG0A 4RE5A 5C86A 4J87A 3I8EA 5AJAA 1GOHA 4NENA 5H14A 4FB1D 3ZDYA 5EMLB 4JSXC 4J78A 3ZDZA 4A0AA 2YB8B 1A0RB 4GM3A 5FKSA 4BCCA 3RN1D 2P9KC 5CYKA 4MMYA 3IJ1A 3PSCB 4G55A 4CY5A 3NIDA 3MZLA 1YFQA 4L9OA 4GZ8A 2Q7QA 2QR5A 3ORVD 3MVDK 3EG6A 3DM0A 4GQ2P 4BL0A 5FLXg 1C9IA 2HU8A 4DNWA 4FWWA 2O9KA 5THAA 2CO0A 4UM9A 3GREA 3IKOA 2B5MA 2PBIB 3NVNA 4JHNA 5IJ7E 3SCYA 5FFGA 5AFU3 5TEEA 3IUNA 2B5NA 3EQ9A 3OKWA 2QC5A 3ODTA 3KCIA 5E6SA 2HU5A 1U2VC 2EIBA 4K3JB 4BP8A 4A0AB 2H6QA 4D0KA 3VH0A 2PM9A 4CZYA 5CYKB 4CI1A 4U1EI 4PBYA 5FQDA 2GC4A 2B5LA 3FGBA 3ZWLB 2VZ3A 4AOWA 5M5SA 4A09A 3NIFA 2VDLA 3JZHA 1JV2A 4IA9A 2VDKA 5GXIA 2P9IC 3F3PA 2H68A 3B7FA 2XDWA 4J79A 4JT5C 3SXTD 3IURA 3IJEA 3PVUB 2OK6A 5GMKn 1VE7A 4E54A 4JSNC 3VGZA 3GFCA 2PM6B 2PM9B 4OWRA 3C75H 3CFSB 4XYIA 4KFMB 1SQJA 5FKRA 2BKLA 3MUNA 1GP2B 4FA4D 3RN0D 4A09B 2XYIA 4Z7NA 3JAMg 1SHYB 4D6VA 1Q47A 2IAAA 3QHYB 3RFHA 3PXSD 1OLZA 3MKQA 3IIWA 3OL2A 3PE7A 4Z8LA 3EI1A 5SXMA 4O9DA 3K72A 5C2VB 3I7NA 3RRMC 3OKTA 2OJYA 4DNVA 3I7KA 3N0EA 4E54B 3SJLD 3N0DA 3VA6A 4J77A 1GXRA 4A2LA 2VZ1A 2CN2A 1N6FA 3I89A 1VZ3A 2CE8A 2AGXA 5EM2A 5IT9g 4QAMA 4BP9A 5FFOA 2VC2A 3OKYA 5EMJB 1MDAH 4DNUA 2XL3A 4FA5D 2AGWA 1PI6A 4CC9A 2IURA 3EU7A 4O2WA 5HE0B 2YMUA 4CZVA 3UVLA 3C9CA 4CZXA 3OL2B 3EI1B 3EI2A 2J55H 3K71A 3FCUA 1GOGA 2GC7A 2P9NC 5HYNB 2TRCB 1FWXA 4NSXA 4UM8A 1GG2B 1VZ2A 5HE3B 1L5GA 5EMKB 1PGUA 2EBSA 2HKRA 5IJ8E 1A12A 1SQ9A 5IGOA 3T3MA 4J86A 3SMRA 4CY2A 1K8KC 4BCBA 4TZ4A 1UOPA 3W15A 2I0TA 2XL2A 2Z2PA 2MTAH 1O6FA 4GQBB 2P9LC 3O4JA 3JB9L 5EM2B 5I5MA 2HXCA 3OKYB 1VE6A 1VYHC 3KRXB 3IJ0A 5M5RA 3SWSD 4X3EA 5H1MA 1PBYB 2H3XA 1BPOA 4PBZA 5B4WA 3EMHA 2IUQA 3AL9A 3EI4A 3I2NA 2OVPB 2P9PC 3SBQA 1N6EA 2VDNA 2I0RA 3EI2B 3I7HA 3I7PA 1JTDB 3O4IA 4QL1A 5EAMA 3SVWD 4O45A 2H9MA 1H2YA 3VI4A 4O3UB 1T2XA 3F3GA 2YNNA 4L1MA 1JMZB 3I7LA 3NVXA 2H9PA 2IWFA 4MK0B 4Y7RA 1TYQC 5CXCA 5H17A 2H6KA 1E8MA 4ZOVA 1PEVA 3UVMA 3I7OA 5KDOB 4I79A 5TEFA 4JHPC 2HYEA 4A7JA 4L1QD 4GGCA 4BH6A 3UVNA 2YNOA 4ES0A 1UOQA 3RLMD 3IUQA 3AFCA 3ZE0A 4J0XA 3RFGA 2BCJB 1MG3A 4J81A 5JWZA 4AX4A 2H13A 4O02A 4NAAA 3EI4B 2XE4A 4K3ID 4AN1A 4OZUA 2EICA 1H2XA 4J73A 4BCDA 4PC0A 2HJ4A 1NR0A 4FA1D 2Z2OA 2VDQA 4HDJA 2VDRA 3BG1A 5GXHA 3DDUA 4PSXB 4LG9A 4XYHA 2WQ8A 5HE1B 3BWSA 3EWEA 1JJUB 1K32A 4QT8A 4PXWA 4WK2A 3KRWB 2VDMA 3VI3A 4CY3A 2AGZA 4J84A 3IJCA 5CXCB 5C92A 4A08A 5E6UA 4GQ1A 4BUJC 2I3SA 4GM9A 4Z7QA 1N6DA 5I5JA 3NIGA 3F3FA 3O4HA 3K6SA 5M5VA 4QRJA 3MZKA 4NC4A 4ZOZA 3FCSA 4G1MA 4WK4A 5FKTA 3NVQA 3E0CA 3DXKC 2HU7A 3MUOA 2CE9A 2XU7A 2HKMA 2G9AA 2XZGA 2J56H 4AEZA 5K1CC 4GGDA 3JPXA 4J8BA 2OVRB 2OK4A 3EQ8A 2AH1A 1UOOA 4PSWB 1M1XA 3V9FA 4A08B 1QFSA 1L0QA 4E5ZA 4LG8A 3UR4A 4CI8A 1RI6A 2CO0C 1XHMA 5M61A 4ZN4A 4CY1A 3SN6B 2OIZA 2H6NA 3UVKA 4CI3A 3HFQA 5K19A 3GC3B 2IUPA 2PM7B 4X63B 3L4MD 4QQEA 3ZE1A 3V7DB 4JSVC 2AH0A 3MMYA 4A11A 5M5UA 1U4CA 3A0FA 1GOFA 4X60B 3IULA 4Z7OA 3JROA 3DWLC 3OTTA 4A0BA 4L3HD 4WK0A 4D9SA 4CI2A 5HDBA 3IUJA 2IWKA 5EARA 5C2WB 3I8CA 3MKSB 1JMXB 2H47A 3ZDXA 4ZOXA 5FXYA 4E5ZB 3C99A 3J81g 4JD2C 2P9SC 1TYEA 2W18A 5GSAA 2IUVA 4GMBA 3SBRA 1YR2A 3FRXA 3AH8B 3IUMA 4MMXA 3ZE2A 2H9NA 5EALA 5FKQA 2H9LA 1QFMA 2HJBA 4FHLA 4YVDA 3CFVA 5IC7A 3UKRC 1B9YA 4O1QD 1O6GA 4A11B 3AL8A 3J80g 2QXVA 5AMSA 1ERJA 3RSEC 4FA9D 3CIKB 3JZNA 2VDOA 4A0BB 2I0SA 2VDPA 5I5IA 1GOTB 4FAVD 5IGQA 2GNQA 4UI9R 1UTCA 3FM0A 3RMZD 1H2ZA 3L4OD 4NBMA 2BBKH 3IIYA 1R5MA 3K26A 1P22A 4LGNA 4AN0A 2YBAA 4ERQA 3EQ7A 5C9ZB 1E8NA 2CNXA 4O3TB 1E5TA 3MXXA 2EIDA 2UZYB 3P4FA 4PNKB 3AL8B 5FA5B 5HE2B 4AMZA 4FAND 5M5TA 4ERZA 3OW8A 4GGAA 5TDHB 3O4GA 3SFZA 1I2MB 2AGYA
chains in the Genus database with same CATH topology
3EI3A 1B9XA 4X61B 2AGLA 5A2Qg 2I3TA 4G56B 2J57G 3ULEC 2YNPA 3PXTD 4A2MA 3UVOA 2UZXB 4GM8A 1MG2A 1QNIA 1TBGA 4J82A 4N14A 5CXBA 3SBPA 3UKUC 4R7AB 4XEIC 2OVQB 4Y5RD 2CN3A 1S4UX 3C5MA 5EAPA 4ZOYA 4H5IA 2Z2NA 3K27A 4ESGA 2AQ5A 3SHFA 1OMWB 2P9UC 2H14A 2G99A 3EI3B 3DXMC 4JSPC 4L3GD 5EMMB 3JRPA 4J0WA 4U7AA 4H5JA 4ERYA 3PVWB 1JOFA 3V5WB 3PSLA 3PXWD 2B4EA 3SLED 2HESX 4EWRA 5TF2A 5HQGA 3DSMA 3U4YA 1XIPA 1NEXB 4JT6C 4IMMA 3JZGA 1XKSA 4J8GA 5CXBB 4JXMA 3BG0A 4J87A 3I8EA 5AJAA 4FB1D 5H14A 5EMLB 4JSXC 4J78A 4A0AA 2YB8B 1A0RB 4GM3A 5FKSA 3RN1D 2P9KC 5CYKA 3IJ1A 3PSCB 4CY5A 3MZLA 1YFQA 4L9OA 4GZ8A 2Q7QA 3ORVD 3EG6A 3DM0A 4GQ2P 4BL0A 5FLXg 4FWWA 2O9KA 5THAA 2CO0A 3GREA 3IKOA 2B5MA 2PBIB 3NVNA 5IJ7E 3SCYA 5AFU3 5TEEA 2B5NA 3OKWA 2QC5A 3ODTA 1U2VC 4K3JB 4A0AB 2H6QA 4D0KA 3VH0A 2PM9A 4CZYA 5CYKB 4CI1A 4U1EI 4PBYA 5FQDA 2GC4A 2B5LA 3FGBA 3ZWLB 4AOWA 4A09A 3JZHA 4IA9A 5GXIA 2P9IC 3F3PA 2H68A 3B7FA 4J79A 4JT5C 3SXTD 3PVUB 2OK6A 5GMKn 4E54A 4JSNC 3VGZA 3GFCA 2PM6B 2PM9B 4OWRA 3C75H 3CFSB 4XYIA 4KFMB 1SQJA 5FKRA 1GP2B 4FA4D 3RN0D 4A09B 2XYIA 3JAMg 1SHYB 4D6VA 1Q47A 2IAAA 3RFHA 3PXSD 1OLZA 3MKQA 3IIWA 3OL2A 3PE7A 4Z8LA 3EI1A 5SXMA 4O9DA 5C2VB 3I7NA 3RRMC 3OKTA 2OJYA 3I7KA 3N0EA 4E54B 3SJLD 3N0DA 3VA6A 4J77A 1GXRA 4A2LA 2CN2A 1N6FA 3I89A 2CE8A 2AGXA 5EM2A 5IT9g 3OKYA 5EMJB 1MDAH 2XL3A 4FA5D 2AGWA 1PI6A 4CC9A 2IURA 3EU7A 5HE0B 2YMUA 4CZVA 3UVLA 3C9CA 4CZXA 3OL2B 3EI1B 3EI2A 2J55H 2GC7A 2P9NC 5HYNB 2TRCB 1FWXA 4NSXA 1GG2B 5HE3B 5EMKB 1PGUA 2EBSA 2HKRA 5IJ8E 1SQ9A 5IGOA 4J86A 3SMRA 4CY2A 1K8KC 4TZ4A 3W15A 2I0TA 2XL2A 2Z2PA 2MTAH 4GQBB 2P9LC 3JB9L 5EM2B 5I5MA 2HXCA 3OKYB 1VYHC 3KRXB 3IJ0A 3SWSD 4X3EA 5H1MA 1PBYB 2H3XA 4PBZA 5B4WA 3EMHA 2IUQA 3AL9A 3EI4A 3I2NA 2OVPB 2P9PC 3SBQA 1N6EA 2I0RA 3EI2B 3I7HA 3I7PA 4QL1A 5EAMA 3SVWD 4O45A 2H9MA 4O3UB 3F3GA 2YNNA 1JMZB 3I7LA 3NVXA 2H9PA 2IWFA 4MK0B 4Y7RA 1TYQC 5CXCA 5H17A 2H6KA 4ZOVA 1PEVA 3UVMA 3I7OA 5KDOB 4I79A 5TEFA 2HYEA 4A7JA 4L1QD 4GGCA 4BH6A 3UVNA 2YNOA 4ES0A 3RLMD 3AFCA 4J0XA 3RFGA 2BCJB 1MG3A 4J81A 5JWZA 2H13A 3EI4B 4K3ID 4OZUA 4J73A 4PC0A 2HJ4A 1NR0A 4FA1D 2Z2OA 4HDJA 5GXHA 3BG1A 4PSXB 4LG9A 4XYHA 5HE1B 3BWSA 3EWEA 1JJUB 1K32A 4QT8A 4PXWA 3KRWB 4CY3A 2AGZA 4J84A 3IJCA 5CXCB 4A08A 4GQ1A 4BUJC 2I3SA 4GM9A 1N6DA 5I5JA 3F3FA 4QRJA 3MZKA 4ZOZA 5FKTA 3NVQA 3E0CA 3DXKC 2CE9A 2XU7A 2HKMA 2G9AA 4AEZA 2J56H 5K1CC 4GGDA 3JPXA 4J8BA 2OVRB 2OK4A 2AH1A 4PSWB 4A08B 3V9FA 1L0QA 4E5ZA 4LG8A 3UR4A 4CI8A 1RI6A 2CO0C 1XHMA 4ZN4A 4CY1A 3SN6B 2OIZA 2H6NA 3UVKA 4CI3A 3HFQA 5K19A 2IUPA 2PM7B 4X63B 3L4MD 4QQEA 3V7DB 4JSVC 2AH0A 3MMYA 4A11A 1U4CA 3A0FA 4X60B 3JROA 3DWLC 3OTTA 4A0BA 4L3HD 4CI2A 2IWKA 5EARA 5C2WB 3I8CA 3MKSB 1JMXB 2H47A 4ZOXA 5FXYA 4E5ZB 3C99A 3J81g 4JD2C 2P9SC 2W18A 5GSAA 2IUVA 4GMBA 3SBRA 3FRXA 3AH8B 2H9NA 5EALA 5FKQA 2H9LA 4FHLA 2HJBA 4YVDA 3CFVA 5IC7A 3UKRC 1B9YA 4O1QD 4A11B 3J80g 3AL8A 2QXVA 5AMSA 1ERJA 3RSEC 4FA9D 3CIKB 3JZNA 4A0BB 2I0SA 5I5IA 1GOTB 4FAVD 5IGQA 2GNQA 4UI9R 3FM0A 3RMZD 3L4OD 2BBKH 3IIYA 1R5MA 3K26A 1P22A 4LGNA 2YBAA 4ERQA 5C9ZB 2CNXA 4O3TB 2UZYB 3MXXA 3P4FA 4PNKB 3AL8B 5FA5B 5HE2B 4FAND 4ERZA 3OW8A 4GGAA 5TDHB 3SFZA 2AGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI3 A;  1B9X A;  4X61 B;  2AGL A;  5A2Q g;  2I3T A;  4G56 B;  2J57 G;  3ULE C;  2YNP A;  3PXT D;  4A2M A;  3UVO A;  2UZX B;  4GM8 A;  1MG2 A;  1QNI A;  1TBG A;  4J82 A;  4N14 A;  5CXB A;  3SBP A;  3UKU C;  4R7A B;  4XEI C;  2OVQ B;  4Y5R D;  2CN3 A;  1S4U X;  3C5M A;  5EAP A;  4ZOY A;  4H5I A;  2Z2N A;  3K27 A;  4ESG A;  2AQ5 A;  3SHF A;  1OMW B;  2P9U C;  2H14 A;  2G99 A;  3EI3 B;  3DXM C;  4JSP C;  4L3G D;  5EMM B;  3JRP A;  4J0W A;  4U7A A;  4H5J A;  4ERY A;  3PVW B;  1JOF A;  3V5W B;  3PSL A;  3PXW D;  2B4E A;  3SLE D;  2HES X;  4EWR A;  5TF2 A;  5HQG A;  3DSM A;  3U4Y A;  1XIP A;  1NEX B;  4JT6 C;  4IMM A;  3JZG A;  1XKS A;  4J8G A;  5CXB B;  4JXM A;  3BG0 A;  4J87 A;  3I8E A;  5AJA A;  4FB1 D;  5H14 A;  5EML B;  4JSX C;  4J78 A;  4A0A A;  2YB8 B;  1A0R B;  4GM3 A;  5FKS A;  3RN1 D;  2P9K C;  5CYK A;  3IJ1 A;  3PSC B;  4CY5 A;  3MZL A;  1YFQ A;  4L9O A;  4GZ8 A;  2Q7Q A;  3ORV D;  3EG6 A;  3DM0 A;  4GQ2 P;  4BL0 A;  5FLX g;  4FWW A;  2O9K A;  5THA A;  2CO0 A;  3GRE A;  3IKO A;  2B5M A;  2PBI B;  3NVN A;  5IJ7 E;  3SCY A;  5AFU 3;  5TEE A;  2B5N A;  3OKW A;  2QC5 A;  3ODT A;  1U2V C;  4K3J B;  4A0A B;  2H6Q A;  4D0K A;  3VH0 A;  2PM9 A;  4CZY A;  5CYK B;  4CI1 A;  4U1E I;  4PBY A;  5FQD A;  2GC4 A;  2B5L A;  3FGB A;  3ZWL B;  4AOW A;  4A09 A;  3JZH A;  4IA9 A;  5GXI A;  2P9I C;  3F3P A;  2H68 A;  3B7F A;  4J79 A;  4JT5 C;  3SXT D;  3PVU B;  2OK6 A;  5GMK n;  4E54 A;  4JSN C;  3VGZ A;  3GFC A;  2PM6 B;  2PM9 B;  4OWR A;  3C75 H;  3CFS B;  4XYI A;  4KFM B;  1SQJ A;  5FKR A;  1GP2 B;  4FA4 D;  3RN0 D;  4A09 B;  2XYI A;  3JAM g;  1SHY B;  4D6V A;  1Q47 A;  2IAA A;  3RFH A;  3PXS D;  1OLZ A;  3MKQ A;  3IIW A;  3OL2 A;  3PE7 A;  4Z8L A;  3EI1 A;  5SXM A;  4O9D A;  5C2V B;  3I7N A;  3RRM C;  3OKT A;  2OJY A;  3I7K A;  3N0E A;  4E54 B;  3SJL D;  3N0D A;  3VA6 A;  4J77 A;  1GXR A;  4A2L A;  2CN2 A;  1N6F A;  3I89 A;  2CE8 A;  2AGX A;  5EM2 A;  5IT9 g;  3OKY A;  5EMJ B;  1MDA H;  2XL3 A;  4FA5 D;  2AGW A;  1PI6 A;  4CC9 A;  2IUR A;  3EU7 A;  5HE0 B;  2YMU A;  4CZV A;  3UVL A;  3C9C A;  4CZX A;  3OL2 B;  3EI1 B;  3EI2 A;  2J55 H;  2GC7 A;  2P9N C;  5HYN B;  2TRC B;  1FWX A;  4NSX A;  1GG2 B;  5HE3 B;  5EMK B;  1PGU A;  2EBS A;  2HKR A;  5IJ8 E;  1SQ9 A;  5IGO A;  4J86 A;  3SMR A;  4CY2 A;  1K8K C;  4TZ4 A;  3W15 A;  2I0T A;  2XL2 A;  2Z2P A;  2MTA H;  4GQB B;  2P9L C;  3JB9 L;  5EM2 B;  5I5M A;  2HXC A;  3OKY B;  1VYH C;  3KRX B;  3IJ0 A;  3SWS D;  4X3E A;  5H1M A;  1PBY B;  2H3X A;  4PBZ A;  5B4W A;  3EMH A;  2IUQ A;  3AL9 A;  3EI4 A;  3I2N A;  2OVP B;  2P9P C;  3SBQ A;  1N6E A;  2I0R A;  3EI2 B;  3I7H A;  3I7P A;  4QL1 A;  5EAM A;  3SVW D;  4O45 A;  2H9M A;  4O3U B;  3F3G A;  2YNN A;  1JMZ B;  3I7L A;  3NVX A;  2H9P A;  2IWF A;  4MK0 B;  4Y7R A;  1TYQ C;  5CXC A;  5H17 A;  2H6K A;  4ZOV A;  1PEV A;  3UVM A;  3I7O A;  5KDO B;  4I79 A;  5TEF A;  2HYE A;  4A7J A;  4L1Q D;  4GGC A;  4BH6 A;  3UVN A;  2YNO A;  4ES0 A;  3RLM D;  3AFC A;  4J0X A;  3RFG A;  2BCJ B;  1MG3 A;  4J81 A;  5JWZ A;  2H13 A;  3EI4 B;  4K3I D;  4OZU A;  4J73 A;  4PC0 A;  2HJ4 A;  1NR0 A;  4FA1 D;  2Z2O A;  4HDJ A;  5GXH A;  3BG1 A;  4PSX B;  4LG9 A;  4XYH A;  5HE1 B;  3BWS A;  3EWE A;  1JJU B;  1K32 A;  4QT8 A;  4PXW A;  3KRW B;  4CY3 A;  2AGZ A;  4J84 A;  3IJC A;  5CXC B;  4A08 A;  4GQ1 A;  4BUJ C;  2I3S A;  4GM9 A;  1N6D A;  5I5J A;  3F3F A;  4QRJ A;  3MZK A;  4ZOZ A;  5FKT A;  3NVQ A;  3E0C A;  3DXK C;  2CE9 A;  2XU7 A;  2HKM A;  2G9A A;  4AEZ A;  2J56 H;  5K1C C;  4GGD A;  3JPX A;  4J8B A;  2OVR B;  2OK4 A;  2AH1 A;  4PSW B;  4A08 B;  3V9F A;  1L0Q A;  4E5Z A;  4LG8 A;  3UR4 A;  4CI8 A;  1RI6 A;  2CO0 C;  1XHM A;  4ZN4 A;  4CY1 A;  3SN6 B;  2OIZ A;  2H6N A;  3UVK A;  4CI3 A;  3HFQ A;  5K19 A;  2IUP A;  2PM7 B;  4X63 B;  3L4M D;  4QQE A;  3V7D B;  4JSV C;  2AH0 A;  3MMY A;  4A11 A;  1U4C A;  3A0F A;  4X60 B;  3JRO A;  3DWL C;  3OTT A;  4A0B A;  4L3H D;  4CI2 A;  2IWK A;  5EAR A;  5C2W B;  3I8C A;  3MKS B;  1JMX B;  2H47 A;  4ZOX A;  5FXY A;  4E5Z B;  3C99 A;  3J81 g;  4JD2 C;  2P9S C;  2W18 A;  5GSA A;  2IUV A;  4GMB A;  3SBR A;  3FRX A;  3AH8 B;  2H9N A;  5EAL A;  5FKQ A;  2H9L A;  4FHL A;  2HJB A;  4YVD A;  3CFV A;  5IC7 A;  3UKR C;  1B9Y A;  4O1Q D;  4A11 B;  3J80 g;  3AL8 A;  2QXV A;  5AMS A;  1ERJ A;  3RSE C;  4FA9 D;  3CIK B;  3JZN A;  4A0B B;  2I0S A;  5I5I A;  1GOT B;  4FAV D;  5IGQ A;  2GNQ A;  4UI9 R;  3FM0 A;  3RMZ D;  3L4O D;  2BBK H;  3IIY A;  1R5M A;  3K26 A;  1P22 A;  4LGN A;  2YBA A;  4ERQ A;  5C9Z B;  2CNX A;  4O3T B;  2UZY B;  3MXX A;  3P4F A;  4PNK B;  3AL8 B;  5FA5 B;  5HE2 B;  4FAN D;  4ERZ A;  3OW8 A;  4GGA A;  5TDH B;  3SFZ A;  2AGY A; 
#chains in the Genus database with same CATH topology
 3EI3 A;  2JKX A;  1B9X A;  4X61 B;  2AGL A;  5A2Q g;  1C9L A;  2I3T A;  4G56 B;  2J57 G;  3ULE C;  1U8C A;  2YNP A;  3PXT D;  4RE6 A;  4A2M A;  3UVO A;  3T3P A;  2UZX B;  4GM8 A;  2QZP A;  1MG2 A;  5E6R A;  1QNI A;  4MMZ A;  1TBG A;  4J82 A;  4N14 A;  5CXB A;  3SBP A;  3UKU C;  4AMY A;  4R7A B;  4XEI C;  2OVQ B;  4Y5R D;  2CN3 A;  4G1E A;  1S4U X;  3C5M A;  5EAP A;  4ZOY A;  4H5I A;  2Z2N A;  3K27 A;  4ESG A;  2AQ5 A;  3IVM A;  3QI0 A;  3SHF A;  1OMW B;  3V4V A;  3OF7 A;  2P9U C;  2H14 A;  4IRZ A;  2G99 A;  3EI3 B;  3GD1 I;  3DXM C;  4JSP C;  4L3G D;  5EMM B;  3JRP A;  4J0W A;  4U7A A;  4H5J A;  4ERY A;  3PVW B;  1JOF A;  3V5W B;  3PSL A;  3PXW D;  4WJK A;  2B4E A;  3SLE D;  1H2W A;  3V4P A;  2HES X;  4EWR A;  5TF2 A;  5HQG A;  3DSM A;  3U4Y A;  2EIE A;  1XIP A;  1NEX B;  4JT6 C;  4IMM A;  3JZG A;  1XKS A;  4J8G A;  1K3I A;  4JXM A;  5CXB B;  3BG0 A;  4RE5 A;  5C86 A;  4J87 A;  3I8E A;  5AJA A;  1GOH A;  4NEN A;  5H14 A;  4FB1 D;  3ZDY A;  5EML B;  4JSX C;  4J78 A;  3ZDZ A;  4A0A A;  2YB8 B;  1A0R B;  4GM3 A;  5FKS A;  4BCC A;  3RN1 D;  2P9K C;  5CYK A;  4MMY A;  3IJ1 A;  3PSC B;  4G55 A;  4CY5 A;  3NID A;  3MZL A;  1YFQ A;  4L9O A;  4GZ8 A;  2Q7Q A;  2QR5 A;  3ORV D;  3MVD K;  3EG6 A;  3DM0 A;  4GQ2 P;  4BL0 A;  5FLX g;  1C9I A;  2HU8 A;  4DNW A;  4FWW A;  2O9K A;  5THA A;  2CO0 A;  4UM9 A;  3GRE A;  3IKO A;  2B5M A;  2PBI B;  3NVN A;  4JHN A;  5IJ7 E;  3SCY A;  5FFG A;  5AFU 3;  5TEE A;  3IUN A;  2B5N A;  3EQ9 A;  3OKW A;  2QC5 A;  3ODT A;  3KCI A;  5E6S A;  2HU5 A;  1U2V C;  2EIB A;  4K3J B;  4BP8 A;  4A0A B;  2H6Q A;  4D0K A;  3VH0 A;  2PM9 A;  4CZY A;  5CYK B;  4CI1 A;  4U1E I;  4PBY A;  5FQD A;  2GC4 A;  2B5L A;  3FGB A;  3ZWL B;  2VZ3 A;  4AOW A;  5M5S A;  4A09 A;  3NIF A;  2VDL A;  3JZH A;  1JV2 A;  4IA9 A;  2VDK A;  5GXI A;  2P9I C;  3F3P A;  2H68 A;  3B7F A;  2XDW A;  4J79 A;  4JT5 C;  3SXT D;  3IUR A;  3IJE A;  3PVU B;  2OK6 A;  5GMK n;  1VE7 A;  4E54 A;  4JSN C;  3VGZ A;  3GFC A;  2PM6 B;  2PM9 B;  4OWR A;  3C75 H;  3CFS B;  4XYI A;  4KFM B;  1SQJ A;  5FKR A;  2BKL A;  3MUN A;  1GP2 B;  4FA4 D;  3RN0 D;  4A09 B;  2XYI A;  4Z7N A;  3JAM g;  1SHY B;  4D6V A;  1Q47 A;  2IAA A;  3QHY B;  3RFH A;  3PXS D;  1OLZ A;  3MKQ A;  3IIW A;  3OL2 A;  3PE7 A;  4Z8L A;  3EI1 A;  5SXM A;  4O9D A;  3K72 A;  5C2V B;  3I7N A;  3RRM C;  3OKT A;  2OJY A;  4DNV A;  3I7K A;  3N0E A;  4E54 B;  3SJL D;  3N0D A;  3VA6 A;  4J77 A;  1GXR A;  4A2L A;  2VZ1 A;  2CN2 A;  1N6F A;  3I89 A;  1VZ3 A;  2CE8 A;  2AGX A;  5EM2 A;  5IT9 g;  4QAM A;  4BP9 A;  5FFO A;  2VC2 A;  3OKY A;  5EMJ B;  1MDA H;  4DNU A;  2XL3 A;  4FA5 D;  2AGW A;  1PI6 A;  4CC9 A;  2IUR A;  3EU7 A;  4O2W A;  5HE0 B;  2YMU A;  4CZV A;  3UVL A;  3C9C A;  4CZX A;  3OL2 B;  3EI1 B;  3EI2 A;  2J55 H;  3K71 A;  3FCU A;  1GOG A;  2GC7 A;  2P9N C;  5HYN B;  2TRC B;  1FWX A;  4NSX A;  4UM8 A;  1GG2 B;  1VZ2 A;  5HE3 B;  1L5G A;  5EMK B;  1PGU A;  2EBS A;  2HKR A;  5IJ8 E;  1A12 A;  1SQ9 A;  5IGO A;  3T3M A;  4J86 A;  3SMR A;  4CY2 A;  1K8K C;  4BCB A;  4TZ4 A;  1UOP A;  3W15 A;  2I0T A;  2XL2 A;  2Z2P A;  2MTA H;  1O6F A;  4GQB B;  2P9L C;  3O4J A;  3JB9 L;  5EM2 B;  5I5M A;  2HXC A;  3OKY B;  1VE6 A;  1VYH C;  3KRX B;  3IJ0 A;  5M5R A;  3SWS D;  4X3E A;  5H1M A;  1PBY B;  2H3X A;  1BPO A;  4PBZ A;  5B4W A;  3EMH A;  2IUQ A;  3AL9 A;  3EI4 A;  3I2N A;  2OVP B;  2P9P C;  3SBQ A;  1N6E A;  2VDN A;  2I0R A;  3EI2 B;  3I7H A;  3I7P A;  1JTD B;  3O4I A;  4QL1 A;  5EAM A;  3SVW D;  4O45 A;  2H9M A;  1H2Y A;  3VI4 A;  4O3U B;  1T2X A;  3F3G A;  2YNN A;  4L1M A;  1JMZ B;  3I7L A;  3NVX A;  2H9P A;  2IWF A;  4MK0 B;  4Y7R A;  1TYQ C;  5CXC A;  5H17 A;  2H6K A;  1E8M A;  4ZOV A;  1PEV A;  3UVM A;  3I7O A;  5KDO B;  4I79 A;  5TEF A;  4JHP C;  2HYE A;  4A7J A;  4L1Q D;  4GGC A;  4BH6 A;  3UVN A;  2YNO A;  4ES0 A;  1UOQ A;  3RLM D;  3IUQ A;  3AFC A;  3ZE0 A;  4J0X A;  3RFG A;  2BCJ B;  1MG3 A;  4J81 A;  5JWZ A;  4AX4 A;  2H13 A;  4O02 A;  4NAA A;  3EI4 B;  2XE4 A;  4K3I D;  4AN1 A;  4OZU A;  2EIC A;  1H2X A;  4J73 A;  4BCD A;  4PC0 A;  2HJ4 A;  1NR0 A;  4FA1 D;  2Z2O A;  2VDQ A;  4HDJ A;  2VDR A;  3BG1 A;  5GXH A;  3DDU A;  4PSX B;  4LG9 A;  4XYH A;  2WQ8 A;  5HE1 B;  3BWS A;  3EWE A;  1JJU B;  1K32 A;  4QT8 A;  4PXW A;  4WK2 A;  3KRW B;  2VDM A;  3VI3 A;  4CY3 A;  2AGZ A;  4J84 A;  3IJC A;  5CXC B;  5C92 A;  4A08 A;  5E6U A;  4GQ1 A;  4BUJ C;  2I3S A;  4GM9 A;  4Z7Q A;  1N6D A;  5I5J A;  3NIG A;  3F3F A;  3O4H A;  3K6S A;  5M5V A;  4QRJ A;  3MZK A;  4NC4 A;  4ZOZ A;  3FCS A;  4G1M A;  4WK4 A;  5FKT A;  3NVQ A;  3E0C A;  3DXK C;  2HU7 A;  3MUO A;  2CE9 A;  2XU7 A;  2HKM A;  2G9A A;  2XZG A;  2J56 H;  4AEZ A;  5K1C C;  4GGD A;  3JPX A;  4J8B A;  2OVR B;  2OK4 A;  3EQ8 A;  2AH1 A;  1UOO A;  4PSW B;  1M1X A;  3V9F A;  4A08 B;  1QFS A;  1L0Q A;  4E5Z A;  4LG8 A;  3UR4 A;  4CI8 A;  1RI6 A;  2CO0 C;  1XHM A;  5M61 A;  4ZN4 A;  4CY1 A;  3SN6 B;  2OIZ A;  2H6N A;  3UVK A;  4CI3 A;  3HFQ A;  5K19 A;  3GC3 B;  2IUP A;  2PM7 B;  4X63 B;  3L4M D;  4QQE A;  3ZE1 A;  3V7D B;  4JSV C;  2AH0 A;  3MMY A;  4A11 A;  5M5U A;  1U4C A;  3A0F A;  1GOF A;  4X60 B;  3IUL A;  4Z7O A;  3JRO A;  3DWL C;  3OTT A;  4A0B A;  4L3H D;  4WK0 A;  4D9S A;  4CI2 A;  5HDB A;  3IUJ A;  2IWK A;  5EAR A;  5C2W B;  3I8C A;  3MKS B;  1JMX B;  2H47 A;  3ZDX A;  4ZOX A;  5FXY A;  4E5Z B;  3C99 A;  3J81 g;  4JD2 C;  2P9S C;  1TYE A;  2W18 A;  5GSA A;  2IUV A;  4GMB A;  3SBR A;  1YR2 A;  3FRX A;  3AH8 B;  3IUM A;  4MMX A;  3ZE2 A;  2H9N A;  5EAL A;  5FKQ A;  2H9L A;  1QFM A;  2HJB A;  4FHL A;  4YVD A;  3CFV A;  5IC7 A;  3UKR C;  1B9Y A;  4O1Q D;  1O6G A;  4A11 B;  3AL8 A;  3J80 g;  2QXV A;  5AMS A;  1ERJ A;  3RSE C;  4FA9 D;  3CIK B;  3JZN A;  2VDO A;  4A0B B;  2I0S A;  2VDP A;  5I5I A;  1GOT B;  4FAV D;  5IGQ A;  2GNQ A;  4UI9 R;  1UTC A;  3FM0 A;  3RMZ D;  1H2Z A;  3L4O D;  4NBM A;  2BBK H;  3IIY A;  1R5M A;  3K26 A;  1P22 A;  4LGN A;  4AN0 A;  2YBA A;  4ERQ A;  3EQ7 A;  5C9Z B;  1E8N A;  2CNX A;  4O3T B;  1E5T A;  3MXX A;  2EID A;  2UZY B;  3P4F A;  4PNK B;  3AL8 B;  5FA5 B;  5HE2 B;  4AMZ A;  4FAN D;  5M5T A;  4ERZ A;  3OW8 A;  4GGA A;  5TDH B;  3O4G A;  3SFZ A;  1I2M B;  2AGY A; 
#chains in the Genus database with same CATH homology
 3EI3 A;  1B9X A;  4X61 B;  2AGL A;  5A2Q g;  2I3T A;  4G56 B;  2J57 G;  3ULE C;  2YNP A;  3PXT D;  4A2M A;  3UVO A;  2UZX B;  4GM8 A;  1MG2 A;  1QNI A;  1TBG A;  4J82 A;  4N14 A;  5CXB A;  3SBP A;  3UKU C;  4R7A B;  4XEI C;  2OVQ B;  4Y5R D;  2CN3 A;  1S4U X;  3C5M A;  5EAP A;  4ZOY A;  4H5I A;  2Z2N A;  3K27 A;  4ESG A;  2AQ5 A;  3SHF A;  1OMW B;  2P9U C;  2H14 A;  2G99 A;  3EI3 B;  3DXM C;  4JSP C;  4L3G D;  5EMM B;  3JRP A;  4J0W A;  4U7A A;  4H5J A;  4ERY A;  3PVW B;  1JOF A;  3V5W B;  3PSL A;  3PXW D;  2B4E A;  3SLE D;  2HES X;  4EWR A;  5TF2 A;  5HQG A;  3DSM A;  3U4Y A;  1XIP A;  1NEX B;  4JT6 C;  4IMM A;  3JZG A;  1XKS A;  4J8G A;  5CXB B;  4JXM A;  3BG0 A;  4J87 A;  3I8E A;  5AJA A;  4FB1 D;  5H14 A;  5EML B;  4JSX C;  4J78 A;  4A0A A;  2YB8 B;  1A0R B;  4GM3 A;  5FKS A;  3RN1 D;  2P9K C;  5CYK A;  3IJ1 A;  3PSC B;  4CY5 A;  3MZL A;  1YFQ A;  4L9O A;  4GZ8 A;  2Q7Q A;  3ORV D;  3EG6 A;  3DM0 A;  4GQ2 P;  4BL0 A;  5FLX g;  4FWW A;  2O9K A;  5THA A;  2CO0 A;  3GRE A;  3IKO A;  2B5M A;  2PBI B;  3NVN A;  5IJ7 E;  3SCY A;  5AFU 3;  5TEE A;  2B5N A;  3OKW A;  2QC5 A;  3ODT A;  1U2V C;  4K3J B;  4A0A B;  2H6Q A;  4D0K A;  3VH0 A;  2PM9 A;  4CZY A;  5CYK B;  4CI1 A;  4U1E I;  4PBY A;  5FQD A;  2GC4 A;  2B5L A;  3FGB A;  3ZWL B;  4AOW A;  4A09 A;  3JZH A;  4IA9 A;  5GXI A;  2P9I C;  3F3P A;  2H68 A;  3B7F A;  4J79 A;  4JT5 C;  3SXT D;  3PVU B;  2OK6 A;  5GMK n;  4E54 A;  4JSN C;  3VGZ A;  3GFC A;  2PM6 B;  2PM9 B;  4OWR A;  3C75 H;  3CFS B;  4XYI A;  4KFM B;  1SQJ A;  5FKR A;  1GP2 B;  4FA4 D;  3RN0 D;  4A09 B;  2XYI A;  3JAM g;  1SHY B;  4D6V A;  1Q47 A;  2IAA A;  3RFH A;  3PXS D;  1OLZ A;  3MKQ A;  3IIW A;  3OL2 A;  3PE7 A;  4Z8L A;  3EI1 A;  5SXM A;  4O9D A;  5C2V B;  3I7N A;  3RRM C;  3OKT A;  2OJY A;  3I7K A;  3N0E A;  4E54 B;  3SJL D;  3N0D A;  3VA6 A;  4J77 A;  1GXR A;  4A2L A;  2CN2 A;  1N6F A;  3I89 A;  2CE8 A;  2AGX A;  5EM2 A;  5IT9 g;  3OKY A;  5EMJ B;  1MDA H;  2XL3 A;  4FA5 D;  2AGW A;  1PI6 A;  4CC9 A;  2IUR A;  3EU7 A;  5HE0 B;  2YMU A;  4CZV A;  3UVL A;  3C9C A;  4CZX A;  3OL2 B;  3EI1 B;  3EI2 A;  2J55 H;  2GC7 A;  2P9N C;  5HYN B;  2TRC B;  1FWX A;  4NSX A;  1GG2 B;  5HE3 B;  5EMK B;  1PGU A;  2EBS A;  2HKR A;  5IJ8 E;  1SQ9 A;  5IGO A;  4J86 A;  3SMR A;  4CY2 A;  1K8K C;  4TZ4 A;  3W15 A;  2I0T A;  2XL2 A;  2Z2P A;  2MTA H;  4GQB B;  2P9L C;  3JB9 L;  5EM2 B;  5I5M A;  2HXC A;  3OKY B;  1VYH C;  3KRX B;  3IJ0 A;  3SWS D;  4X3E A;  5H1M A;  1PBY B;  2H3X A;  4PBZ A;  5B4W A;  3EMH A;  2IUQ A;  3AL9 A;  3EI4 A;  3I2N A;  2OVP B;  2P9P C;  3SBQ A;  1N6E A;  2I0R A;  3EI2 B;  3I7H A;  3I7P A;  4QL1 A;  5EAM A;  3SVW D;  4O45 A;  2H9M A;  4O3U B;  3F3G A;  2YNN A;  1JMZ B;  3I7L A;  3NVX A;  2H9P A;  2IWF A;  4MK0 B;  4Y7R A;  1TYQ C;  5CXC A;  5H17 A;  2H6K A;  4ZOV A;  1PEV A;  3UVM A;  3I7O A;  5KDO B;  4I79 A;  5TEF A;  2HYE A;  4A7J A;  4L1Q D;  4GGC A;  4BH6 A;  3UVN A;  2YNO A;  4ES0 A;  3RLM D;  3AFC A;  4J0X A;  3RFG A;  2BCJ B;  1MG3 A;  4J81 A;  5JWZ A;  2H13 A;  3EI4 B;  4K3I D;  4OZU A;  4J73 A;  4PC0 A;  2HJ4 A;  1NR0 A;  4FA1 D;  2Z2O A;  4HDJ A;  5GXH A;  3BG1 A;  4PSX B;  4LG9 A;  4XYH A;  5HE1 B;  3BWS A;  3EWE A;  1JJU B;  1K32 A;  4QT8 A;  4PXW A;  3KRW B;  4CY3 A;  2AGZ A;  4J84 A;  3IJC A;  5CXC B;  4A08 A;  4GQ1 A;  4BUJ C;  2I3S A;  4GM9 A;  1N6D A;  5I5J A;  3F3F A;  4QRJ A;  3MZK A;  4ZOZ A;  5FKT A;  3NVQ A;  3E0C A;  3DXK C;  2CE9 A;  2XU7 A;  2HKM A;  2G9A A;  4AEZ A;  2J56 H;  5K1C C;  4GGD A;  3JPX A;  4J8B A;  2OVR B;  2OK4 A;  2AH1 A;  4PSW B;  4A08 B;  3V9F A;  1L0Q A;  4E5Z A;  4LG8 A;  3UR4 A;  4CI8 A;  1RI6 A;  2CO0 C;  1XHM A;  4ZN4 A;  4CY1 A;  3SN6 B;  2OIZ A;  2H6N A;  3UVK A;  4CI3 A;  3HFQ A;  5K19 A;  2IUP A;  2PM7 B;  4X63 B;  3L4M D;  4QQE A;  3V7D B;  4JSV C;  2AH0 A;  3MMY A;  4A11 A;  1U4C A;  3A0F A;  4X60 B;  3JRO A;  3DWL C;  3OTT A;  4A0B A;  4L3H D;  4CI2 A;  2IWK A;  5EAR A;  5C2W B;  3I8C A;  3MKS B;  1JMX B;  2H47 A;  4ZOX A;  5FXY A;  4E5Z B;  3C99 A;  3J81 g;  4JD2 C;  2P9S C;  2W18 A;  5GSA A;  2IUV A;  4GMB A;  3SBR A;  3FRX A;  3AH8 B;  2H9N A;  5EAL A;  5FKQ A;  2H9L A;  4FHL A;  2HJB A;  4YVD A;  3CFV A;  5IC7 A;  3UKR C;  1B9Y A;  4O1Q D;  4A11 B;  3J80 g;  3AL8 A;  2QXV A;  5AMS A;  1ERJ A;  3RSE C;  4FA9 D;  3CIK B;  3JZN A;  4A0B B;  2I0S A;  5I5I A;  1GOT B;  4FAV D;  5IGQ A;  2GNQ A;  4UI9 R;  3FM0 A;  3RMZ D;  3L4O D;  2BBK H;  3IIY A;  1R5M A;  3K26 A;  1P22 A;  4LGN A;  2YBA A;  4ERQ A;  5C9Z B;  2CNX A;  4O3T B;  2UZY B;  3MXX A;  3P4F A;  4PNK B;  3AL8 B;  5FA5 B;  5HE2 B;  4FAN D;  4ERZ A;  3OW8 A;  4GGA A;  5TDH B;  3SFZ A;  2AGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...