3MXXA

Crystal structure of wdr5 mutant (s62a)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
315
Chain Sequence
GGQQMGRGSEFVKPNYALKFTLAGHTKAVSSVKFSPNGEWLAASSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Effect of Asp-His-Ser/Thr-Trp Tetrad on the Thermostability of WD40-Repeat Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
total genus 103
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2010-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3mxxA00
3EU7A 2H68A 4A09A 5B4WA 2O9KA 5H17A 1PBYB 3DXKC 1B9YA 2YNOA 2P9PC 1S4UX 2P9LC 4OZUA 4A2MA 4UI9R 4J84A 4G56B 4JSVC 3EMHA 3DM0A 3I8EA 3GFCA 2P9UC 2XL2A 3OL2A 4LGNA 4BUJC 3UVMA 4GGCA 5AMSA 3PXSD 2IUPA 4ZN4A 5EAPA 2IUQA 2HJBA 2IWFA 1PI6A 1NR0A 2HKMA 4K3ID 3EWEA 5HYNB 3E0CA 2J55H 2B5NA 4PBYA 5IC7A 1N6DA 3J80g 2XL3A 2IURA 4A09B 2UZYB 3N0DA 1FWXA 5C2VB 5TDHB 3C99A 1OMWB 2AGZA 2GC4A 5HE0B 1B9XA 3AH8B 3C75H 4NSXA 3CFSB 4J81A 1R5MA 1U4CA 4A08A 4D0KA 3EG6A 3IJ0A 3JZHA 4KFMB 1PEVA 3IIYA 3SBRA 4QQEA 4ZOXA 4PNKB 3OTTA 4CY2A 2AGWA 1MDAH 4FA1D 5CYKA 1SQ9A 3C5MA 3I7HA 4XYHA 1JMZB 3AL8B 2IWKA 4PBZA 2CN3A 4QRJA 4J0WA 3RFGA 3W15A 3K26A 3PXTD 1TYQC 4GGAA 2I3TA 4ERYA 3NVNA 3OKYA 3RFHA 4ZOZA 3SBPA 4D6VA 3SBQA 3SN6B 2AH0A 5FXYA 4J73A 2BCJB 4PSWB 5FKRA 2H6KA 1Q47A 5EM2A 3UKRC 3CIKB 2GNQA 3HFQA 3PVUB 3VA6A 4GQ1A 4JD2C 4X60B 4FWWA 3FRXA 2XU7A 3V5WB 3MZLA 2OK6A 4I79A 2AGLA 5EMLB 5EARA 2H3XA 4A0AB 2J57G 3BWSA 5CXCB 4YVDA 4GMBA 4A11A 5TF2A 1A0RB 1K8KC 1GG2B 4GM9A 3RN1D 5TEEA 3NVXA 5EAMA 4H5JA 4Z8LA 4ES0A 5GMKn 3UKUC 3SMRA 2PM9A 4AOWA 3JZNA 4CC9A 4CI1A 3UVKA 1SHYB 3EI1A 2OIZA 1QNIA 4JSNC 4FB1D 4L9OA 5CXBA 2PM9B 4CZVA 5IJ8E 2QC5A 2I0RA 2B5LA 1YFQA 3NVQA 4FAVD 4E5ZB 3EI2A 2YNPA 4GQ2P 2P9KC 3EI2B 5I5MA 4E5ZA 4A7JA 2H13A 1K32A 4J78A 3I2NA 5C2WB 5CXBB 4PC0A 3UR4A 4FA5D 3AFCA 3ODTA 2PM7B 3V9FA 1SQJA 2CO0A 2TRCB 3PSLA 3DSMA 3KRWB 3JAMg 3SXTD 3SVWD 4L1QD 4J77A 2CNXA 2P9NC 4FA4D 4J87A 3UVNA 4J0XA 3EI4A 4EWRA 5IT9g 3OKYB 4A0AA 1U2VC 4ZOYA 3JRPA 4ESGA 3SWSD 3MZKA 2YMUA 5FKQA 2J56H 3C9CA 3IJCA 3MKSB 1JMXB 1P22A 3AL8A 3F3PA 5I5JA 3I89A 5CYKB 4PXWA 2G99A 1JOFA 2YNNA 5KDOB 5GXHA 4FHLA 4JT5C 3I7LA 2H6QA 3SCYA 4FA9D 4A08B 1XIPA 3JZGA 3F3GA 1N6EA 1OLZA 1VYHC 2PBIB 1N6FA 4CZXA 5AJAA 1PGUA 3SJLD 5AFU3 3ORVD 2EBSA 3U4YA 3GREA 4CY5A 4ERQA 2P9IC 5GSAA 2YBAA 2B4EA 4JSPC 1GP2B 5H1MA 4CY3A 4TZ4A 3IKOA 5H14A 2G9AA 3SFZA 2H9PA 4H5IA 3IJ1A 2PM6B 4QT8A 4HDJA 3EI3B 4O45A 4IMMA 3OL2B 3RMZD 5EALA 2HJ4A 4ERZA 3DXMC 4L3HD 3PSCB 3DWLC 2OK4A 2CO0C 3JB9L 2P9SC 3JROA 5C9ZB 2Z2OA 4J79A 2CE8A 3KRXB 1L0QA 3I7PA 4BL0A 2H9LA 4CI3A 4XYIA 3EI3A 3BG0A 4GZ8A 1GXRA 3K27A 4GM8A 3EI4B 4O3UB 2XYIA 5TEFA 2IUVA 3OKWA 3FM0A 2CN2A 1RI6A 4FAND 5FKTA 4LG9A 5THAA 3VGZA 4LG8A 4X3EA 3L4OD 5IGOA 5I5IA 4U7AA 3MMYA 3OW8A 5HQGA 3IIWA 4J8GA 4K3JB 4GQBB 1JJUB 2AH1A 4CY1A 2AGXA 3SHFA 4X61B 2HYEA 2GC7A 4E54B 4X63B 4CI8A 5IJ7E 2UZXB 3JPXA 3I8CA 2Q7QA 2YB8B 5A2Qg 3EI1B 3FGBA 5HE1B 4ZOVA 3ZWLB 2W18A 3P4FA 3CFVA 4MK0B 5FA5B 1GOTB 3OKTA 5HE2B 5EMJB 2H9NA 4GM3A 5SXMA 2QXVA 4IA9A 2OVPB 5FKSA 2H47A 4A0BB 4Y5RD 4JSXC 2MTAH 1XKSA 1MG2A 5CXCA 4CI2A 4O1QD 4J8BA 2B5MA 1MG3A 5FQDA 5EMMB 4BH6A 3ULEC 4A0BA 2OJYA 3RLMD 4R7AB 3F3FA 4XEIC 3V7DB 3J81g 4JT6C 3BG1A 4L3GD 3MXXA 1XHMA 5EM2B 5K19A 4GGDA 2HKRA 4J82A 4CZYA 3RN0D 4OWRA 3AL9A 3PVWB 4O9DA 3UVLA 2Z2NA 4QL1A 3I7KA 1ERJA 4PSXB 3A0FA 4AEZA 4E54A 4U1EI 4O3TB 2AQ5A 3SLED 2HESX 3I7NA 4A2LA 1TBGA 3RRMC 4Y7RA 3MKQA 4JXMA 3RSEC 3B7FA 2Z2PA 2I0SA 5EMKB 3VH0A 2CE9A 5JWZA 2H6NA 2H9MA 5IGQA 5FLXg 1NEXB 2AGYA 2H14A 2I0TA 5K1CC 3N0EA 5GXIA 2I3SA 3L4MD 2OVQB 2BBKH 3PXWD 4A11B 2IAAA 5HE3B 3PE7A 2HXCA 3I7OA 2OVRB 4N14A 3UVOA 4J86A
chains in the Genus database with same CATH superfamily
3EU7A 2H68A 4A09A 5B4WA 2O9KA 5H17A 1PBYB 3DXKC 1B9YA 2YNOA 2P9PC 1S4UX 2P9LC 4OZUA 4A2MA 4UI9R 3VI4A 4J84A 4G56B 4JSVC 3EMHA 3DM0A 3I8EA 3GFCA 1VE7A 2P9UC 2XL2A 2EIBA 3ZE1A 3OL2A 4LGNA 4BUJC 4D9SA 3ZDXA 3VI3A 3UVMA 4GGCA 5AMSA 3PXSD 2VZ3A 2IUPA 5FFGA 1VZ2A 3NIDA 4ZN4A 5EAPA 2IUQA 2HJBA 2IWFA 4DNVA 4G55A 1PI6A 1NR0A 2HKMA 1E5TA 3EWEA 4K3ID 5HYNB 3E0CA 2J55H 2B5NA 4PBYA 5IC7A 1N6DA 4O02A 3J80g 2XL3A 2IURA 2HU7A 4A09B 2UZYB 3N0DA 1E8NA 1FWXA 5C2VB 5TDHB 3C99A 1OMWB 2AGZA 2GC4A 3IUNA 5HE0B 1B9XA 2VDNA 2VDOA 3AH8B 3GD1I 3K6SA 3C75H 4NSXA 3CFSB 4J81A 1R5MA 1U4CA 4A08A 4D0KA 3EG6A 2VC2A 3IJ0A 3JZHA 4NC4A 4KFMB 1PEVA 1C9IA 3IIYA 3SBRA 4QQEA 4ZOXA 4PNKB 3O4JA 3OTTA 2AGWA 1QFSA 3ZDZA 1MDAH 4CY2A 4FA1D 1SQ9A 3C5MA 3I7HA 1GOFA 5CYKA 3MVDK 4XYHA 1JMZB 2HU8A 3AL8B 2IWKA 4PBZA 2CN3A 4QRJA 4J0WA 3RFGA 3W15A 4Z7OA 3K26A 3PXTD 2QR5A 2VDMA 1VZ3A 2WQ8A 1TYQC 4GGAA 2EIDA 2I3TA 3DDUA 4ERYA 3NVNA 3T3PA 3OKYA 3RFHA 4ZOZA 3SBPA 4D6VA 4NENA 3SBQA 3SN6B 2AH0A 5FXYA 4J73A 2BCJB 4PSWB 5FKRA 3ZE0A 2H6KA 1Q47A 5EM2A 3UKRC 3CIKB 2GNQA 3HFQA 3PVUB 3VA6A 4GQ1A 3IUMA 2VDPA 4JD2C 4JHPC 4X60B 4FWWA 3EQ9A 3FRXA 2XU7A 3V5WB 3MZLA 4WK4A 2OK6A 4I79A 2AGLA 4BCCA 5EMLB 5EARA 2H3XA 4A0AB 2J57G 3BWSA 5CXCB 1YR2A 4YVDA 3IURA 4GMBA 4A11A 5TF2A 1A0RB 3FCUA 1K8KC 2EICA 1GG2B 4GM9A 4NBMA 4WK0A 3RN1D 5TEEA 1H2WA 3NVXA 4AX4A 5EAMA 5E6UA 4H5JA 4WJKA 4Z8LA 4ES0A 5GMKn 3UKUC 3SMRA 2PM9A 3IULA 4AOWA 3JZNA 4CC9A 4CI1A 3UVKA 1SHYB 3EI1A 2OIZA 1QNIA 4JSNC 4FB1D 3KCIA 4L9OA 5CXBA 2PM9B 4CZVA 5IJ8E 2QC5A 2I0RA 2B5LA 1YFQA 3NVQA 4FAVD 4E5ZB 5M5SA 3EI2A 2YNPA 4GQ2P 2P9KC 3EI2B 5I5MA 1H2YA 4E5ZA 4A7JA 2H13A 1K32A 1L5GA 4J78A 5M5TA 3ZE2A 3I2NA 4RE6A 5C2WB 5CXBB 4PC0A 3UR4A 4FA5D 3AFCA 3ODTA 2PM7B 3V9FA 1SQJA 2CO0A 2TRCB 3PSLA 3DSMA 2VDQA 3KRWB 3O4HA 3JAMg 4DNUA 4NAAA 3SXTD 3SVWD 4L1QD 4J77A 2CNXA 2P9NC 4FA4D 4J87A 3UVNA 4J0XA 4QAMA 3EI4A 4EWRA 1BPOA 5IT9g 3OKYB 3NIFA 4A0AA 2QZPA 1U2VC 4ZOYA 3JRPA 4ESGA 3SWSD 3MZKA 2YMUA 3QHYB 5FKQA 2J56H 3C9CA 3IJCA 3MKSB 1JMXB 1K3IA 1P22A 3AL8A 3F3PA 4L1MA 5I5JA 3I89A 5CYKB 4PXWA 2G99A 1JOFA 2VDKA 2YNNA 5KDOB 3O4IA 5GXHA 4FHLA 4JT5C 2JKXA 2H6QA 3I7LA 3SCYA 1H2XA 4FA9D 4RE5A 4A08B 2XDWA 1XIPA 5C86A 3JZGA 3F3GA 1N6EA 1UTCA 1OLZA 1VYHC 2PBIB 1N6FA 4CZXA 1TYEA 5AJAA 1QFMA 1PGUA 3SJLD 5AFU3 3ORVD 2EBSA 3U4YA 3GREA 4CY5A 4ERQA 2P9IC 5GSAA 3IJEA 2YBAA 2B4EA 4JSPC 1GP2B 5H1MA 4CY3A 1JTDB 4TZ4A 2HU5A 3IKOA 5H14A 2G9AA 4UM9A 3SFZA 2H9PA 4H5IA 3IJ1A 4Z7NA 2PM6B 4QT8A 4HDJA 3EI3B 4O45A 4IMMA 3OL2B 3RMZD 5EALA 2HJ4A 4BP8A 4ERZA 3DXMC 2VDRA 4L3HD 4AMYA 3PSCB 3DWLC 2OK4A 2CO0C 3JB9L 1E8MA 2P9SC 3JROA 5C9ZB 2Z2OA 4J79A 2CE8A 3KRXB 1L0QA 1UOOA 4MMZA 3O4GA 3I7PA 1VE6A 2XZGA 1U8CA 1T2XA 4BL0A 2H9LA 4CI3A 4XYIA 1M1XA 3EI3A 3BG0A 3K27A 1GXRA 4GM8A 4GZ8A 3EI4B 4O3UB 2XYIA 4G1EA 5TEFA 2IUVA 3OKWA 3FM0A 2CN2A 2XE4A 2VZ1A 1RI6A 4FAND 4MMYA 5FKTA 1GOHA 4LG9A 5THAA 3VGZA 3V4PA 4JHNA 4LG8A 4X3EA 3L4OD 5IGOA 5I5IA 1O6FA 1O6GA 3OF7A 2EIEA 5FFOA 1UOQA 4U7AA 3T3MA 3MMYA 3OW8A 5HQGA 4BP9A 1UOPA 3GC3B 3IIWA 4J8GA 4K3JB 4GQBB 3V4VA 1JJUB 2AH1A 4CY1A 2AGXA 5C92A 3SHFA 4X61B 2HYEA 2GC7A 4E54B 4X63B 3FCSA 4AN1A 4CI8A 5IJ7E 2UZXB 3JPXA 3I8CA 2Q7QA 2YB8B 1GOGA 5A2Qg 3EI1B 3FGBA 5HE1B 4ZOVA 3ZWLB 2W18A 3P4FA 3CFVA 4MK0B 4O2WA 5FA5B 1GOTB 3OKTA 5HE2B 5EMJB 5E6SA 2H9NA 4GM3A 5SXMA 2QXVA 4DNWA 4IA9A 2OVPB 5FKSA 2H47A 4A0BB 4Y5RD 4JSXC 2MTAH 1XKSA 1MG2A 5CXCA 4CI2A 4O1QD 4J8BA 2B5MA 3EQ7A 1MG3A 5FQDA 5EMMB 4BH6A 3ULEC 4A0BA 2OJYA 3RLMD 4R7AB 4WK2A 3F3FA 1A12A 3NIGA 4XEIC 4AMZA 1C9LA 4Z7QA 3MUNA 3V7DB 3J81g 4JT6C 4IRZA 3BG1A 4L3GD 3MXXA 1XHMA 4MMXA 5EM2B 5K19A 4GGDA 5HDBA 2HKRA 5M5VA 4J82A 4CZYA 3RN0D 5E6RA 4OWRA 3AL9A 3PVWB 4AN0A 3QI0A 4G1MA 2Z2NA 4O9DA 3UVLA 4QL1A 3I7KA 1ERJA 4PSXB 3A0FA 4AEZA 4E54A 4U1EI 4O3TB 1JV2A 1H2ZA 2AQ5A 3SLED 4BCDA 1I2MB 3IUQA 2HESX 3K71A 3I7NA 4A2LA 1TBGA 5M5UA 3RRMC 4Y7RA 3MKQA 4JXMA 3RSEC 4UM8A 3B7FA 2Z2PA 3IUJA 2I0SA 5EMKB 3VH0A 2CE9A 5JWZA 2H6NA 2H9MA 5M5RA 5IGQA 5FLXg 5M61A 1NEXB 2AGYA 2H14A 2I0TA 2VDLA 3N0EA 5K1CC 5GXIA 2BKLA 2I3SA 3L4MD 3ZDYA 4BCBA 2OVQB 3EQ8A 2BBKH 3IVMA 3PXWD 3K72A 4A11B 2IAAA 5HE3B 3PE7A 2HXCA 3I7OA 2OVRB 4N14A 3MUOA 3UVOA 4J86A
chains in the Genus database with same CATH topology
3EU7A 2H68A 4A09A 5B4WA 2O9KA 5H17A 1PBYB 3DXKC 1B9YA 2YNOA 2P9PC 1S4UX 2P9LC 4OZUA 4A2MA 4UI9R 4J84A 4G56B 4JSVC 3EMHA 3DM0A 3I8EA 3GFCA 2P9UC 2XL2A 3OL2A 4LGNA 4BUJC 3UVMA 4GGCA 5AMSA 3PXSD 2IUPA 4ZN4A 5EAPA 2IUQA 2HJBA 2IWFA 1PI6A 1NR0A 2HKMA 4K3ID 3EWEA 5HYNB 3E0CA 2J55H 2B5NA 4PBYA 5IC7A 1N6DA 3J80g 2XL3A 2IURA 4A09B 2UZYB 3N0DA 1FWXA 5C2VB 5TDHB 3C99A 1OMWB 2AGZA 2GC4A 5HE0B 1B9XA 3AH8B 3C75H 4NSXA 3CFSB 4J81A 1R5MA 1U4CA 4A08A 4D0KA 3EG6A 3IJ0A 3JZHA 4KFMB 1PEVA 3IIYA 3SBRA 4QQEA 4ZOXA 4PNKB 3OTTA 4CY2A 2AGWA 1MDAH 4FA1D 5CYKA 1SQ9A 3C5MA 3I7HA 4XYHA 1JMZB 3AL8B 2IWKA 4PBZA 2CN3A 4QRJA 4J0WA 3RFGA 3W15A 3K26A 3PXTD 1TYQC 4GGAA 2I3TA 4ERYA 3NVNA 3OKYA 3RFHA 4ZOZA 3SBPA 4D6VA 3SBQA 3SN6B 2AH0A 5FXYA 4J73A 2BCJB 4PSWB 5FKRA 2H6KA 1Q47A 5EM2A 3UKRC 3CIKB 2GNQA 3HFQA 3PVUB 3VA6A 4GQ1A 4JD2C 4X60B 4FWWA 3FRXA 2XU7A 3V5WB 3MZLA 2OK6A 4I79A 2AGLA 5EMLB 5EARA 2H3XA 4A0AB 2J57G 3BWSA 5CXCB 4YVDA 4GMBA 4A11A 5TF2A 1A0RB 1K8KC 1GG2B 4GM9A 3RN1D 5TEEA 3NVXA 5EAMA 4H5JA 4Z8LA 4ES0A 5GMKn 3UKUC 3SMRA 2PM9A 4AOWA 3JZNA 4CC9A 4CI1A 3UVKA 1SHYB 3EI1A 2OIZA 1QNIA 4JSNC 4FB1D 4L9OA 5CXBA 2PM9B 4CZVA 5IJ8E 2QC5A 2I0RA 2B5LA 1YFQA 3NVQA 4FAVD 4E5ZB 3EI2A 2YNPA 4GQ2P 2P9KC 3EI2B 5I5MA 4E5ZA 4A7JA 2H13A 1K32A 4J78A 3I2NA 5C2WB 5CXBB 4PC0A 3UR4A 4FA5D 3AFCA 3ODTA 2PM7B 3V9FA 1SQJA 2CO0A 2TRCB 3PSLA 3DSMA 3KRWB 3JAMg 3SXTD 3SVWD 4L1QD 4J77A 2CNXA 2P9NC 4FA4D 4J87A 3UVNA 4J0XA 3EI4A 4EWRA 5IT9g 3OKYB 4A0AA 1U2VC 4ZOYA 3JRPA 4ESGA 3SWSD 3MZKA 2YMUA 5FKQA 2J56H 3C9CA 3IJCA 3MKSB 1JMXB 1P22A 3AL8A 3F3PA 5I5JA 3I89A 5CYKB 4PXWA 2G99A 1JOFA 2YNNA 5KDOB 5GXHA 4FHLA 4JT5C 3I7LA 2H6QA 3SCYA 4FA9D 4A08B 1XIPA 3JZGA 3F3GA 1N6EA 1OLZA 1VYHC 2PBIB 1N6FA 4CZXA 5AJAA 1PGUA 3SJLD 5AFU3 3ORVD 2EBSA 3U4YA 3GREA 4CY5A 4ERQA 2P9IC 5GSAA 2YBAA 2B4EA 4JSPC 1GP2B 5H1MA 4CY3A 4TZ4A 3IKOA 5H14A 2G9AA 3SFZA 2H9PA 4H5IA 3IJ1A 2PM6B 4QT8A 4HDJA 3EI3B 4O45A 4IMMA 3OL2B 3RMZD 5EALA 2HJ4A 4ERZA 3DXMC 4L3HD 3PSCB 3DWLC 2OK4A 2CO0C 3JB9L 2P9SC 3JROA 5C9ZB 2Z2OA 4J79A 2CE8A 3KRXB 1L0QA 3I7PA 4BL0A 2H9LA 4CI3A 4XYIA 3EI3A 3BG0A 4GZ8A 1GXRA 3K27A 4GM8A 3EI4B 4O3UB 2XYIA 5TEFA 2IUVA 3OKWA 3FM0A 2CN2A 1RI6A 4FAND 5FKTA 4LG9A 5THAA 3VGZA 4LG8A 4X3EA 3L4OD 5IGOA 5I5IA 4U7AA 3MMYA 3OW8A 5HQGA 3IIWA 4J8GA 4K3JB 4GQBB 1JJUB 2AH1A 4CY1A 2AGXA 3SHFA 4X61B 2HYEA 2GC7A 4E54B 4X63B 4CI8A 5IJ7E 2UZXB 3JPXA 3I8CA 2Q7QA 2YB8B 5A2Qg 3EI1B 3FGBA 5HE1B 4ZOVA 3ZWLB 2W18A 3P4FA 3CFVA 4MK0B 5FA5B 1GOTB 3OKTA 5HE2B 5EMJB 2H9NA 4GM3A 5SXMA 2QXVA 4IA9A 2OVPB 5FKSA 2H47A 4A0BB 4Y5RD 4JSXC 2MTAH 1XKSA 1MG2A 5CXCA 4CI2A 4O1QD 4J8BA 2B5MA 1MG3A 5FQDA 5EMMB 4BH6A 3ULEC 4A0BA 2OJYA 3RLMD 4R7AB 3F3FA 4XEIC 3V7DB 3J81g 4JT6C 3BG1A 4L3GD 3MXXA 1XHMA 5EM2B 5K19A 4GGDA 2HKRA 4J82A 4CZYA 3RN0D 4OWRA 3AL9A 3PVWB 4O9DA 3UVLA 2Z2NA 4QL1A 3I7KA 1ERJA 4PSXB 3A0FA 4AEZA 4E54A 4U1EI 4O3TB 2AQ5A 3SLED 2HESX 3I7NA 4A2LA 1TBGA 3RRMC 4Y7RA 3MKQA 4JXMA 3RSEC 3B7FA 2Z2PA 2I0SA 5EMKB 3VH0A 2CE9A 5JWZA 2H6NA 2H9MA 5IGQA 5FLXg 1NEXB 2AGYA 2H14A 2I0TA 5K1CC 3N0EA 5GXIA 2I3SA 3L4MD 2OVQB 2BBKH 3PXWD 4A11B 2IAAA 5HE3B 3PE7A 2HXCA 3I7OA 2OVRB 4N14A 3UVOA 4J86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EU7 A;  2H68 A;  4A09 A;  5B4W A;  2O9K A;  5H17 A;  1PBY B;  3DXK C;  1B9Y A;  2YNO A;  2P9P C;  1S4U X;  2P9L C;  4OZU A;  4A2M A;  4UI9 R;  4J84 A;  4G56 B;  4JSV C;  3EMH A;  3DM0 A;  3I8E A;  3GFC A;  2P9U C;  2XL2 A;  3OL2 A;  4LGN A;  4BUJ C;  3UVM A;  4GGC A;  5AMS A;  3PXS D;  2IUP A;  4ZN4 A;  5EAP A;  2IUQ A;  2HJB A;  2IWF A;  1PI6 A;  1NR0 A;  2HKM A;  4K3I D;  3EWE A;  5HYN B;  3E0C A;  2J55 H;  2B5N A;  4PBY A;  5IC7 A;  1N6D A;  3J80 g;  2XL3 A;  2IUR A;  4A09 B;  2UZY B;  3N0D A;  1FWX A;  5C2V B;  5TDH B;  3C99 A;  1OMW B;  2AGZ A;  2GC4 A;  5HE0 B;  1B9X A;  3AH8 B;  3C75 H;  4NSX A;  3CFS B;  4J81 A;  1R5M A;  1U4C A;  4A08 A;  4D0K A;  3EG6 A;  3IJ0 A;  3JZH A;  4KFM B;  1PEV A;  3IIY A;  3SBR A;  4QQE A;  4ZOX A;  4PNK B;  3OTT A;  4CY2 A;  2AGW A;  1MDA H;  4FA1 D;  5CYK A;  1SQ9 A;  3C5M A;  3I7H A;  4XYH A;  1JMZ B;  3AL8 B;  2IWK A;  4PBZ A;  2CN3 A;  4QRJ A;  4J0W A;  3RFG A;  3W15 A;  3K26 A;  3PXT D;  1TYQ C;  4GGA A;  2I3T A;  4ERY A;  3NVN A;  3OKY A;  3RFH A;  4ZOZ A;  3SBP A;  4D6V A;  3SBQ A;  3SN6 B;  2AH0 A;  5FXY A;  4J73 A;  2BCJ B;  4PSW B;  5FKR A;  2H6K A;  1Q47 A;  5EM2 A;  3UKR C;  3CIK B;  2GNQ A;  3HFQ A;  3PVU B;  3VA6 A;  4GQ1 A;  4JD2 C;  4X60 B;  4FWW A;  3FRX A;  2XU7 A;  3V5W B;  3MZL A;  2OK6 A;  4I79 A;  2AGL A;  5EML B;  5EAR A;  2H3X A;  4A0A B;  2J57 G;  3BWS A;  5CXC B;  4YVD A;  4GMB A;  4A11 A;  5TF2 A;  1A0R B;  1K8K C;  1GG2 B;  4GM9 A;  3RN1 D;  5TEE A;  3NVX A;  5EAM A;  4H5J A;  4Z8L A;  4ES0 A;  5GMK n;  3UKU C;  3SMR A;  2PM9 A;  4AOW A;  3JZN A;  4CC9 A;  4CI1 A;  3UVK A;  1SHY B;  3EI1 A;  2OIZ A;  1QNI A;  4JSN C;  4FB1 D;  4L9O A;  5CXB A;  2PM9 B;  4CZV A;  5IJ8 E;  2QC5 A;  2I0R A;  2B5L A;  1YFQ A;  3NVQ A;  4FAV D;  4E5Z B;  3EI2 A;  2YNP A;  4GQ2 P;  2P9K C;  3EI2 B;  5I5M A;  4E5Z A;  4A7J A;  2H13 A;  1K32 A;  4J78 A;  3I2N A;  5C2W B;  5CXB B;  4PC0 A;  3UR4 A;  4FA5 D;  3AFC A;  3ODT A;  2PM7 B;  3V9F A;  1SQJ A;  2CO0 A;  2TRC B;  3PSL A;  3DSM A;  3KRW B;  3JAM g;  3SXT D;  3SVW D;  4L1Q D;  4J77 A;  2CNX A;  2P9N C;  4FA4 D;  4J87 A;  3UVN A;  4J0X A;  3EI4 A;  4EWR A;  5IT9 g;  3OKY B;  4A0A A;  1U2V C;  4ZOY A;  3JRP A;  4ESG A;  3SWS D;  3MZK A;  2YMU A;  5FKQ A;  2J56 H;  3C9C A;  3IJC A;  3MKS B;  1JMX B;  1P22 A;  3AL8 A;  3F3P A;  5I5J A;  3I89 A;  5CYK B;  4PXW A;  2G99 A;  1JOF A;  2YNN A;  5KDO B;  5GXH A;  4FHL A;  4JT5 C;  3I7L A;  2H6Q A;  3SCY A;  4FA9 D;  4A08 B;  1XIP A;  3JZG A;  3F3G A;  1N6E A;  1OLZ A;  1VYH C;  2PBI B;  1N6F A;  4CZX A;  5AJA A;  1PGU A;  3SJL D;  5AFU 3;  3ORV D;  2EBS A;  3U4Y A;  3GRE A;  4CY5 A;  4ERQ A;  2P9I C;  5GSA A;  2YBA A;  2B4E A;  4JSP C;  1GP2 B;  5H1M A;  4CY3 A;  4TZ4 A;  3IKO A;  5H14 A;  2G9A A;  3SFZ A;  2H9P A;  4H5I A;  3IJ1 A;  2PM6 B;  4QT8 A;  4HDJ A;  3EI3 B;  4O45 A;  4IMM A;  3OL2 B;  3RMZ D;  5EAL A;  2HJ4 A;  4ERZ A;  3DXM C;  4L3H D;  3PSC B;  3DWL C;  2OK4 A;  2CO0 C;  3JB9 L;  2P9S C;  3JRO A;  5C9Z B;  2Z2O A;  4J79 A;  2CE8 A;  3KRX B;  1L0Q A;  3I7P A;  4BL0 A;  2H9L A;  4CI3 A;  4XYI A;  3EI3 A;  3BG0 A;  4GZ8 A;  1GXR A;  3K27 A;  4GM8 A;  3EI4 B;  4O3U B;  2XYI A;  5TEF A;  2IUV A;  3OKW A;  3FM0 A;  2CN2 A;  1RI6 A;  4FAN D;  5FKT A;  4LG9 A;  5THA A;  3VGZ A;  4LG8 A;  4X3E A;  3L4O D;  5IGO A;  5I5I A;  4U7A A;  3MMY A;  3OW8 A;  5HQG A;  3IIW A;  4J8G A;  4K3J B;  4GQB B;  1JJU B;  2AH1 A;  4CY1 A;  2AGX A;  3SHF A;  4X61 B;  2HYE A;  2GC7 A;  4E54 B;  4X63 B;  4CI8 A;  5IJ7 E;  2UZX B;  3JPX A;  3I8C A;  2Q7Q A;  2YB8 B;  5A2Q g;  3EI1 B;  3FGB A;  5HE1 B;  4ZOV A;  3ZWL B;  2W18 A;  3P4F A;  3CFV A;  4MK0 B;  5FA5 B;  1GOT B;  3OKT A;  5HE2 B;  5EMJ B;  2H9N A;  4GM3 A;  5SXM A;  2QXV A;  4IA9 A;  2OVP B;  5FKS A;  2H47 A;  4A0B B;  4Y5R D;  4JSX C;  2MTA H;  1XKS A;  1MG2 A;  5CXC A;  4CI2 A;  4O1Q D;  4J8B A;  2B5M A;  1MG3 A;  5FQD A;  5EMM B;  4BH6 A;  3ULE C;  4A0B A;  2OJY A;  3RLM D;  4R7A B;  3F3F A;  4XEI C;  3V7D B;  3J81 g;  4JT6 C;  3BG1 A;  4L3G D;  3MXX A;  1XHM A;  5EM2 B;  5K19 A;  4GGD A;  2HKR A;  4J82 A;  4CZY A;  3RN0 D;  4OWR A;  3AL9 A;  3PVW B;  4O9D A;  3UVL A;  2Z2N A;  4QL1 A;  3I7K A;  1ERJ A;  4PSX B;  3A0F A;  4AEZ A;  4E54 A;  4U1E I;  4O3T B;  2AQ5 A;  3SLE D;  2HES X;  3I7N A;  4A2L A;  1TBG A;  3RRM C;  4Y7R A;  3MKQ A;  4JXM A;  3RSE C;  3B7F A;  2Z2P A;  2I0S A;  5EMK B;  3VH0 A;  2CE9 A;  5JWZ A;  2H6N A;  2H9M A;  5IGQ A;  5FLX g;  1NEX B;  2AGY A;  2H14 A;  2I0T A;  5K1C C;  3N0E A;  5GXI A;  2I3S A;  3L4M D;  2OVQ B;  2BBK H;  3PXW D;  4A11 B;  2IAA A;  5HE3 B;  3PE7 A;  2HXC A;  3I7O A;  2OVR B;  4N14 A;  3UVO A;  4J86 A; 
#chains in the Genus database with same CATH topology
 3EU7 A;  2H68 A;  4A09 A;  5B4W A;  2O9K A;  5H17 A;  1PBY B;  3DXK C;  1B9Y A;  2YNO A;  2P9P C;  1S4U X;  2P9L C;  4OZU A;  4A2M A;  4UI9 R;  3VI4 A;  4J84 A;  4G56 B;  4JSV C;  3EMH A;  3DM0 A;  3I8E A;  3GFC A;  1VE7 A;  2P9U C;  2XL2 A;  2EIB A;  3ZE1 A;  3OL2 A;  4LGN A;  4BUJ C;  4D9S A;  3ZDX A;  3VI3 A;  3UVM A;  4GGC A;  5AMS A;  3PXS D;  2VZ3 A;  2IUP A;  5FFG A;  1VZ2 A;  3NID A;  4ZN4 A;  5EAP A;  2IUQ A;  2HJB A;  2IWF A;  4DNV A;  4G55 A;  1PI6 A;  1NR0 A;  2HKM A;  1E5T A;  3EWE A;  4K3I D;  5HYN B;  3E0C A;  2J55 H;  2B5N A;  4PBY A;  5IC7 A;  1N6D A;  4O02 A;  3J80 g;  2XL3 A;  2IUR A;  2HU7 A;  4A09 B;  2UZY B;  3N0D A;  1E8N A;  1FWX A;  5C2V B;  5TDH B;  3C99 A;  1OMW B;  2AGZ A;  2GC4 A;  3IUN A;  5HE0 B;  1B9X A;  2VDN A;  2VDO A;  3AH8 B;  3GD1 I;  3K6S A;  3C75 H;  4NSX A;  3CFS B;  4J81 A;  1R5M A;  1U4C A;  4A08 A;  4D0K A;  3EG6 A;  2VC2 A;  3IJ0 A;  3JZH A;  4NC4 A;  4KFM B;  1PEV A;  1C9I A;  3IIY A;  3SBR A;  4QQE A;  4ZOX A;  4PNK B;  3O4J A;  3OTT A;  2AGW A;  1QFS A;  3ZDZ A;  1MDA H;  4CY2 A;  4FA1 D;  1SQ9 A;  3C5M A;  3I7H A;  1GOF A;  5CYK A;  3MVD K;  4XYH A;  1JMZ B;  2HU8 A;  3AL8 B;  2IWK A;  4PBZ A;  2CN3 A;  4QRJ A;  4J0W A;  3RFG A;  3W15 A;  4Z7O A;  3K26 A;  3PXT D;  2QR5 A;  2VDM A;  1VZ3 A;  2WQ8 A;  1TYQ C;  4GGA A;  2EID A;  2I3T A;  3DDU A;  4ERY A;  3NVN A;  3T3P A;  3OKY A;  3RFH A;  4ZOZ A;  3SBP A;  4D6V A;  4NEN A;  3SBQ A;  3SN6 B;  2AH0 A;  5FXY A;  4J73 A;  2BCJ B;  4PSW B;  5FKR A;  3ZE0 A;  2H6K A;  1Q47 A;  5EM2 A;  3UKR C;  3CIK B;  2GNQ A;  3HFQ A;  3PVU B;  3VA6 A;  4GQ1 A;  3IUM A;  2VDP A;  4JD2 C;  4JHP C;  4X60 B;  4FWW A;  3EQ9 A;  3FRX A;  2XU7 A;  3V5W B;  3MZL A;  4WK4 A;  2OK6 A;  4I79 A;  2AGL A;  4BCC A;  5EML B;  5EAR A;  2H3X A;  4A0A B;  2J57 G;  3BWS A;  5CXC B;  1YR2 A;  4YVD A;  3IUR A;  4GMB A;  4A11 A;  5TF2 A;  1A0R B;  3FCU A;  1K8K C;  2EIC A;  1GG2 B;  4GM9 A;  4NBM A;  4WK0 A;  3RN1 D;  5TEE A;  1H2W A;  3NVX A;  4AX4 A;  5EAM A;  5E6U A;  4H5J A;  4WJK A;  4Z8L A;  4ES0 A;  5GMK n;  3UKU C;  3SMR A;  2PM9 A;  3IUL A;  4AOW A;  3JZN A;  4CC9 A;  4CI1 A;  3UVK A;  1SHY B;  3EI1 A;  2OIZ A;  1QNI A;  4JSN C;  4FB1 D;  3KCI A;  4L9O A;  5CXB A;  2PM9 B;  4CZV A;  5IJ8 E;  2QC5 A;  2I0R A;  2B5L A;  1YFQ A;  3NVQ A;  4FAV D;  4E5Z B;  5M5S A;  3EI2 A;  2YNP A;  4GQ2 P;  2P9K C;  3EI2 B;  5I5M A;  1H2Y A;  4E5Z A;  4A7J A;  2H13 A;  1K32 A;  1L5G A;  4J78 A;  5M5T A;  3ZE2 A;  3I2N A;  4RE6 A;  5C2W B;  5CXB B;  4PC0 A;  3UR4 A;  4FA5 D;  3AFC A;  3ODT A;  2PM7 B;  3V9F A;  1SQJ A;  2CO0 A;  2TRC B;  3PSL A;  3DSM A;  2VDQ A;  3KRW B;  3O4H A;  3JAM g;  4DNU A;  4NAA A;  3SXT D;  3SVW D;  4L1Q D;  4J77 A;  2CNX A;  2P9N C;  4FA4 D;  4J87 A;  3UVN A;  4J0X A;  4QAM A;  3EI4 A;  4EWR A;  1BPO A;  5IT9 g;  3OKY B;  3NIF A;  4A0A A;  2QZP A;  1U2V C;  4ZOY A;  3JRP A;  4ESG A;  3SWS D;  3MZK A;  2YMU A;  3QHY B;  5FKQ A;  2J56 H;  3C9C A;  3IJC A;  3MKS B;  1JMX B;  1K3I A;  1P22 A;  3AL8 A;  3F3P A;  4L1M A;  5I5J A;  3I89 A;  5CYK B;  4PXW A;  2G99 A;  1JOF A;  2VDK A;  2YNN A;  5KDO B;  3O4I A;  5GXH A;  4FHL A;  4JT5 C;  2JKX A;  2H6Q A;  3I7L A;  3SCY A;  1H2X A;  4FA9 D;  4RE5 A;  4A08 B;  2XDW A;  1XIP A;  5C86 A;  3JZG A;  3F3G A;  1N6E A;  1UTC A;  1OLZ A;  1VYH C;  2PBI B;  1N6F A;  4CZX A;  1TYE A;  5AJA A;  1QFM A;  1PGU A;  3SJL D;  5AFU 3;  3ORV D;  2EBS A;  3U4Y A;  3GRE A;  4CY5 A;  4ERQ A;  2P9I C;  5GSA A;  3IJE A;  2YBA A;  2B4E A;  4JSP C;  1GP2 B;  5H1M A;  4CY3 A;  1JTD B;  4TZ4 A;  2HU5 A;  3IKO A;  5H14 A;  2G9A A;  4UM9 A;  3SFZ A;  2H9P A;  4H5I A;  3IJ1 A;  4Z7N A;  2PM6 B;  4QT8 A;  4HDJ A;  3EI3 B;  4O45 A;  4IMM A;  3OL2 B;  3RMZ D;  5EAL A;  2HJ4 A;  4BP8 A;  4ERZ A;  3DXM C;  2VDR A;  4L3H D;  4AMY A;  3PSC B;  3DWL C;  2OK4 A;  2CO0 C;  3JB9 L;  1E8M A;  2P9S C;  3JRO A;  5C9Z B;  2Z2O A;  4J79 A;  2CE8 A;  3KRX B;  1L0Q A;  1UOO A;  4MMZ A;  3O4G A;  3I7P A;  1VE6 A;  2XZG A;  1U8C A;  1T2X A;  4BL0 A;  2H9L A;  4CI3 A;  4XYI A;  1M1X A;  3EI3 A;  3BG0 A;  3K27 A;  1GXR A;  4GM8 A;  4GZ8 A;  3EI4 B;  4O3U B;  2XYI A;  4G1E A;  5TEF A;  2IUV A;  3OKW A;  3FM0 A;  2CN2 A;  2XE4 A;  2VZ1 A;  1RI6 A;  4FAN D;  4MMY A;  5FKT A;  1GOH A;  4LG9 A;  5THA A;  3VGZ A;  3V4P A;  4JHN A;  4LG8 A;  4X3E A;  3L4O D;  5IGO A;  5I5I A;  1O6F A;  1O6G A;  3OF7 A;  2EIE A;  5FFO A;  1UOQ A;  4U7A A;  3T3M A;  3MMY A;  3OW8 A;  5HQG A;  4BP9 A;  1UOP A;  3GC3 B;  3IIW A;  4J8G A;  4K3J B;  4GQB B;  3V4V A;  1JJU B;  2AH1 A;  4CY1 A;  2AGX A;  5C92 A;  3SHF A;  4X61 B;  2HYE A;  2GC7 A;  4E54 B;  4X63 B;  3FCS A;  4AN1 A;  4CI8 A;  5IJ7 E;  2UZX B;  3JPX A;  3I8C A;  2Q7Q A;  2YB8 B;  1GOG A;  5A2Q g;  3EI1 B;  3FGB A;  5HE1 B;  4ZOV A;  3ZWL B;  2W18 A;  3P4F A;  3CFV A;  4MK0 B;  4O2W A;  5FA5 B;  1GOT B;  3OKT A;  5HE2 B;  5EMJ B;  5E6S A;  2H9N A;  4GM3 A;  5SXM A;  2QXV A;  4DNW A;  4IA9 A;  2OVP B;  5FKS A;  2H47 A;  4A0B B;  4Y5R D;  4JSX C;  2MTA H;  1XKS A;  1MG2 A;  5CXC A;  4CI2 A;  4O1Q D;  4J8B A;  2B5M A;  3EQ7 A;  1MG3 A;  5FQD A;  5EMM B;  4BH6 A;  3ULE C;  4A0B A;  2OJY A;  3RLM D;  4R7A B;  4WK2 A;  3F3F A;  1A12 A;  3NIG A;  4XEI C;  4AMZ A;  1C9L A;  4Z7Q A;  3MUN A;  3V7D B;  3J81 g;  4JT6 C;  4IRZ A;  3BG1 A;  4L3G D;  3MXX A;  1XHM A;  4MMX A;  5EM2 B;  5K19 A;  4GGD A;  5HDB A;  2HKR A;  5M5V A;  4J82 A;  4CZY A;  3RN0 D;  5E6R A;  4OWR A;  3AL9 A;  3PVW B;  4AN0 A;  3QI0 A;  4G1M A;  2Z2N A;  4O9D A;  3UVL A;  4QL1 A;  3I7K A;  1ERJ A;  4PSX B;  3A0F A;  4AEZ A;  4E54 A;  4U1E I;  4O3T B;  1JV2 A;  1H2Z A;  2AQ5 A;  3SLE D;  4BCD A;  1I2M B;  3IUQ A;  2HES X;  3K71 A;  3I7N A;  4A2L A;  1TBG A;  5M5U A;  3RRM C;  4Y7R A;  3MKQ A;  4JXM A;  3RSE C;  4UM8 A;  3B7F A;  2Z2P A;  3IUJ A;  2I0S A;  5EMK B;  3VH0 A;  2CE9 A;  5JWZ A;  2H6N A;  2H9M A;  5M5R A;  5IGQ A;  5FLX g;  5M61 A;  1NEX B;  2AGY A;  2H14 A;  2I0T A;  2VDL A;  3N0E A;  5K1C C;  5GXI A;  2BKL A;  2I3S A;  3L4M D;  3ZDY A;  4BCB A;  2OVQ B;  3EQ8 A;  2BBK H;  3IVM A;  3PXW D;  3K72 A;  4A11 B;  2IAA A;  5HE3 B;  3PE7 A;  2HXC A;  3I7O A;  2OVR B;  4N14 A;  3MUO A;  3UVO A;  4J86 A; 
#chains in the Genus database with same CATH homology
 3EU7 A;  2H68 A;  4A09 A;  5B4W A;  2O9K A;  5H17 A;  1PBY B;  3DXK C;  1B9Y A;  2YNO A;  2P9P C;  1S4U X;  2P9L C;  4OZU A;  4A2M A;  4UI9 R;  4J84 A;  4G56 B;  4JSV C;  3EMH A;  3DM0 A;  3I8E A;  3GFC A;  2P9U C;  2XL2 A;  3OL2 A;  4LGN A;  4BUJ C;  3UVM A;  4GGC A;  5AMS A;  3PXS D;  2IUP A;  4ZN4 A;  5EAP A;  2IUQ A;  2HJB A;  2IWF A;  1PI6 A;  1NR0 A;  2HKM A;  4K3I D;  3EWE A;  5HYN B;  3E0C A;  2J55 H;  2B5N A;  4PBY A;  5IC7 A;  1N6D A;  3J80 g;  2XL3 A;  2IUR A;  4A09 B;  2UZY B;  3N0D A;  1FWX A;  5C2V B;  5TDH B;  3C99 A;  1OMW B;  2AGZ A;  2GC4 A;  5HE0 B;  1B9X A;  3AH8 B;  3C75 H;  4NSX A;  3CFS B;  4J81 A;  1R5M A;  1U4C A;  4A08 A;  4D0K A;  3EG6 A;  3IJ0 A;  3JZH A;  4KFM B;  1PEV A;  3IIY A;  3SBR A;  4QQE A;  4ZOX A;  4PNK B;  3OTT A;  4CY2 A;  2AGW A;  1MDA H;  4FA1 D;  5CYK A;  1SQ9 A;  3C5M A;  3I7H A;  4XYH A;  1JMZ B;  3AL8 B;  2IWK A;  4PBZ A;  2CN3 A;  4QRJ A;  4J0W A;  3RFG A;  3W15 A;  3K26 A;  3PXT D;  1TYQ C;  4GGA A;  2I3T A;  4ERY A;  3NVN A;  3OKY A;  3RFH A;  4ZOZ A;  3SBP A;  4D6V A;  3SBQ A;  3SN6 B;  2AH0 A;  5FXY A;  4J73 A;  2BCJ B;  4PSW B;  5FKR A;  2H6K A;  1Q47 A;  5EM2 A;  3UKR C;  3CIK B;  2GNQ A;  3HFQ A;  3PVU B;  3VA6 A;  4GQ1 A;  4JD2 C;  4X60 B;  4FWW A;  3FRX A;  2XU7 A;  3V5W B;  3MZL A;  2OK6 A;  4I79 A;  2AGL A;  5EML B;  5EAR A;  2H3X A;  4A0A B;  2J57 G;  3BWS A;  5CXC B;  4YVD A;  4GMB A;  4A11 A;  5TF2 A;  1A0R B;  1K8K C;  1GG2 B;  4GM9 A;  3RN1 D;  5TEE A;  3NVX A;  5EAM A;  4H5J A;  4Z8L A;  4ES0 A;  5GMK n;  3UKU C;  3SMR A;  2PM9 A;  4AOW A;  3JZN A;  4CC9 A;  4CI1 A;  3UVK A;  1SHY B;  3EI1 A;  2OIZ A;  1QNI A;  4JSN C;  4FB1 D;  4L9O A;  5CXB A;  2PM9 B;  4CZV A;  5IJ8 E;  2QC5 A;  2I0R A;  2B5L A;  1YFQ A;  3NVQ A;  4FAV D;  4E5Z B;  3EI2 A;  2YNP A;  4GQ2 P;  2P9K C;  3EI2 B;  5I5M A;  4E5Z A;  4A7J A;  2H13 A;  1K32 A;  4J78 A;  3I2N A;  5C2W B;  5CXB B;  4PC0 A;  3UR4 A;  4FA5 D;  3AFC A;  3ODT A;  2PM7 B;  3V9F A;  1SQJ A;  2CO0 A;  2TRC B;  3PSL A;  3DSM A;  3KRW B;  3JAM g;  3SXT D;  3SVW D;  4L1Q D;  4J77 A;  2CNX A;  2P9N C;  4FA4 D;  4J87 A;  3UVN A;  4J0X A;  3EI4 A;  4EWR A;  5IT9 g;  3OKY B;  4A0A A;  1U2V C;  4ZOY A;  3JRP A;  4ESG A;  3SWS D;  3MZK A;  2YMU A;  5FKQ A;  2J56 H;  3C9C A;  3IJC A;  3MKS B;  1JMX B;  1P22 A;  3AL8 A;  3F3P A;  5I5J A;  3I89 A;  5CYK B;  4PXW A;  2G99 A;  1JOF A;  2YNN A;  5KDO B;  5GXH A;  4FHL A;  4JT5 C;  3I7L A;  2H6Q A;  3SCY A;  4FA9 D;  4A08 B;  1XIP A;  3JZG A;  3F3G A;  1N6E A;  1OLZ A;  1VYH C;  2PBI B;  1N6F A;  4CZX A;  5AJA A;  1PGU A;  3SJL D;  5AFU 3;  3ORV D;  2EBS A;  3U4Y A;  3GRE A;  4CY5 A;  4ERQ A;  2P9I C;  5GSA A;  2YBA A;  2B4E A;  4JSP C;  1GP2 B;  5H1M A;  4CY3 A;  4TZ4 A;  3IKO A;  5H14 A;  2G9A A;  3SFZ A;  2H9P A;  4H5I A;  3IJ1 A;  2PM6 B;  4QT8 A;  4HDJ A;  3EI3 B;  4O45 A;  4IMM A;  3OL2 B;  3RMZ D;  5EAL A;  2HJ4 A;  4ERZ A;  3DXM C;  4L3H D;  3PSC B;  3DWL C;  2OK4 A;  2CO0 C;  3JB9 L;  2P9S C;  3JRO A;  5C9Z B;  2Z2O A;  4J79 A;  2CE8 A;  3KRX B;  1L0Q A;  3I7P A;  4BL0 A;  2H9L A;  4CI3 A;  4XYI A;  3EI3 A;  3BG0 A;  4GZ8 A;  1GXR A;  3K27 A;  4GM8 A;  3EI4 B;  4O3U B;  2XYI A;  5TEF A;  2IUV A;  3OKW A;  3FM0 A;  2CN2 A;  1RI6 A;  4FAN D;  5FKT A;  4LG9 A;  5THA A;  3VGZ A;  4LG8 A;  4X3E A;  3L4O D;  5IGO A;  5I5I A;  4U7A A;  3MMY A;  3OW8 A;  5HQG A;  3IIW A;  4J8G A;  4K3J B;  4GQB B;  1JJU B;  2AH1 A;  4CY1 A;  2AGX A;  3SHF A;  4X61 B;  2HYE A;  2GC7 A;  4E54 B;  4X63 B;  4CI8 A;  5IJ7 E;  2UZX B;  3JPX A;  3I8C A;  2Q7Q A;  2YB8 B;  5A2Q g;  3EI1 B;  3FGB A;  5HE1 B;  4ZOV A;  3ZWL B;  2W18 A;  3P4F A;  3CFV A;  4MK0 B;  5FA5 B;  1GOT B;  3OKT A;  5HE2 B;  5EMJ B;  2H9N A;  4GM3 A;  5SXM A;  2QXV A;  4IA9 A;  2OVP B;  5FKS A;  2H47 A;  4A0B B;  4Y5R D;  4JSX C;  2MTA H;  1XKS A;  1MG2 A;  5CXC A;  4CI2 A;  4O1Q D;  4J8B A;  2B5M A;  1MG3 A;  5FQD A;  5EMM B;  4BH6 A;  3ULE C;  4A0B A;  2OJY A;  3RLM D;  4R7A B;  3F3F A;  4XEI C;  3V7D B;  3J81 g;  4JT6 C;  3BG1 A;  4L3G D;  3MXX A;  1XHM A;  5EM2 B;  5K19 A;  4GGD A;  2HKR A;  4J82 A;  4CZY A;  3RN0 D;  4OWR A;  3AL9 A;  3PVW B;  4O9D A;  3UVL A;  2Z2N A;  4QL1 A;  3I7K A;  1ERJ A;  4PSX B;  3A0F A;  4AEZ A;  4E54 A;  4U1E I;  4O3T B;  2AQ5 A;  3SLE D;  2HES X;  3I7N A;  4A2L A;  1TBG A;  3RRM C;  4Y7R A;  3MKQ A;  4JXM A;  3RSE C;  3B7F A;  2Z2P A;  2I0S A;  5EMK B;  3VH0 A;  2CE9 A;  5JWZ A;  2H6N A;  2H9M A;  5IGQ A;  5FLX g;  1NEX B;  2AGY A;  2H14 A;  2I0T A;  5K1C C;  3N0E A;  5GXI A;  2I3S A;  3L4M D;  2OVQ B;  2BBK H;  3PXW D;  4A11 B;  2IAA A;  5HE3 B;  3PE7 A;  2HXC A;  3I7O A;  2OVR B;  4N14 A;  3UVO A;  4J86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...