3MXXA

Crystal structure of wdr5 mutant (s62a)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
315
Chain Sequence
GGQQMGRGSEFVKPNYALKFTLAGHTKAVSSVKFSPNGEWLAASSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
publication title The Effect of Asp-His-Ser/Thr-Trp Tetrad on the Thermostability of WD40-Repeat Proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2010-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3mxxA00
3I7HA 3J80g 2HYEA 4ESGA 2H9LA 4GQBB 3KRXB 4H5IA 3VA6A 2GC4A 3AH8B 2OVRB 4J78A 4LG9A 1XKSA 2UZXB 5I5MA 5FKSA 5CYKB 1OLZA 1B9XA 2O9KA 5FKQA 2CNXA 4ZOXA 1N6FA 2IWFA 3NVXA 4A0AB 3C9CA 1U2VC 3AL8B 4N14A 3JPXA 4A2MA 4O1QD 3UVOA 4JSNC 2AGLA 5TEEA 4J8BA 2OIZA 3EI1B 2HXCA 4A09B 1JMXB 3IKOA 2P9NC 2CO0A 1NR0A 4LG8A 2XL3A 1P22A 5K19A 2IUPA 4KFMB 4XEIC 4X61B 4PC0A 5EMLB 4GGCA 5HQGA 3W15A 4ZOYA 2P9SC 5EMJB 3RFGA 4O9DA 4A7JA 4J73A 3KRWB 4IMMA 2H9PA 3ODTA 2I0SA 5FXYA 5EMKB 4GM9A 2J56H 4ZOZA 5EAMA 5FKTA 2XYIA 1JMZB 5H17A 2OVPB 4ZN4A 1JJUB 4JSVC 4U1EI 4ES0A 3I7NA 4ERZA 2W18A 4CC9A 2H6QA 4L3GD 5IGQA 3OTTA 4FA9D 2GNQA 2IWKA 5IT9g 4J82A 5EM2A 3I7PA 4CI1A 3UKUC 4JSXC 3CFSB 4Y5RD 4CZVA 3UVNA 4L1QD 4FWWA 4PBZA 2PM7B 2B5LA 2HJ4A 5HE2B 2I3SA 5C2VB 1FWXA 3V7DB 1TBGA 2PBIB 1MG2A 3OL2A 3ORVD 4OWRA 2H68A 2YB8B 4J0WA 4GZ8A 3SHFA 2IAAA 2P9IC 5C9ZB 4LGNA 4U7AA 1MG3A 1N6DA 3V5WB 2I0RA 3PVWB 3IJ0A 3JRPA 2H13A 5EMMB 2CN3A 4EWRA 5I5IA 4A0AA 4X63B 3EI3A 4HDJA 3AL8A 2PM9B 2BCJB 4PSXB 5AJAA 3I8CA 3U4YA 3EI4A 1K8KC 1SQJA 3EI1A 3B7FA 4A09A 5FKRA 1GG2B 4CZYA 3EWEA 4GM8A 2HKMA 4MK0B 3SFZA 4BH6A 3EI3B 3VGZA 2CN2A 3SVWD 2HESX 5GMKn 5IJ7E 2IUVA 5HE1B 3MZLA 2I0TA 3FRXA 4J79A 4J77A 1S4UX 1XHMA 3EI4B 2H9MA 2OJYA 4JT6C 4ERYA 3UVKA 2P9UC 2H3XA 4FAVD 2YMUA 5CXCB 2G9AA 4JSPC 3DXMC 5K1CC 3C75H 3JB9L 3MXXA 3HFQA 1B9YA 3SBRA 3DSMA 3F3PA 4XYHA 3I8EA 3JAMg 5AFU3 1RI6A 4OZUA 4NSXA 3AFCA 2P9KC 3OKWA 5FQDA 4CZXA 1R5MA 3PXTD 4QT8A 2H9NA 2TRCB 3MKSB 4GGDA 4H5JA 1Q47A 4CI3A 3IJ1A 4PSWB 2XL2A 2MTAH 2AQ5A 5SXMA 3I89A 5B4WA 2B5MA 3CIKB 4J84A 2IURA 4A11B 4GGAA 2YBAA 3N0DA 4FA4D 3OKYB 3SWSD 1L0QA 2AH1A 3F3GA 4FB1D 4A0BA 1A0RB 2CE8A 3PE7A 4FHLA 4E5ZA 4CY5A 2Q7QA 4A08B 5I5JA 4IA9A 2Z2NA 3GFCA 4ZOVA 2CO0C 4K3JB 4A2LA 3JZHA 4D0KA 5EAPA 5IC7A 3FGBA 1SHYB 3F3FA 5FA5B 2PM9A 4QL1A 5IJ8E 4A0BB 3UKRC 1XIPA 4CI8A 4E5ZB 5EARA 2AGWA 2OK4A 3P4FA 4FA5D 4QQEA 1ERJA 3SLED 3SCYA 2BBKH 4CY3A 5KDOB 5GSAA 2J55H 3EI2A 3ZWLB 3N0EA 3K27A 2B5NA 3RN0D 3SN6B 2OVQB 3J81g 3EU7A 5THAA 1PI6A 4CY1A 3I7OA 3JZNA 5EALA 3RRMC 5JWZA 1NEXB 5C2WB 3SMRA 2HKRA 3IJCA 3SBQA 3ULEC 5CXCA 2CE9A 3SJLD 3EI2B 2P9PC 3L4MD 4FA1D 3EMHA 3IIWA 4Y7RA 1U4CA 3AL9A 1PEVA 3JROA 3NVNA 3EG6A 5TDHB 3SXTD 2EBSA 1PGUA 1TYQC 3I7LA 4J81A 3PXWD 4JD2C 3SBPA 4XYIA 5CXBA 4AOWA 3PVUB 4L9OA 3DM0A 4J8GA 1JOFA 4J86A 5FLXg 3UVLA 3I2NA 2G99A 4R7AB 4ERQA 1SQ9A 2J57G 3MMYA 3CFVA 4D6VA 1GP2B 4PXWA 4E54A 4A11A 3MZKA 4K3ID 5GXIA 3OKYA 2H14A 4UI9R 4GQ1A 4JXMA 5GXHA 4X60B 1N6EA 2OK6A 2YNPA 3NVQA 4J0XA 3JZGA 4X3EA 5CXBB 3VH0A 4YVDA 4A08A 3L4OD 2P9LC 3RN1D 3GREA 2H47A 3PXSD 4Z8LA 3IIYA 4CI2A 4GQ2P 3C99A 5TF2A 4E54B 2Z2PA 3RMZD 5TEFA 1MDAH 4PBYA 4GMBA 3PSLA 2H6KA 2AGXA 3DXKC 2IUQA 4PNKB 2GC7A 4TZ4A 2HJBA 4GM3A 3MKQA 1PBYB 1OMWB 3DWLC 3FM0A 3E0CA 5H1MA 1GOTB 2YNNA 1QNIA 3UVMA 3RSEC 3OW8A 3BWSA 3RLMD 2H6NA 2YNOA 4QRJA 4O3UB 4G56B 3BG1A 1YFQA 4AEZA 2QC5A 5H14A 5AMSA 2I3TA 5HE3B 2PM6B 2UZYB 3UR4A 4I79A 4J87A 1GXRA 2Z2OA 3V9FA 4FAND 5EM2B 5HYNB 4BL0A 4O45A 3C5MA 2AGZA 2AGYA 5A2Qg 3RFHA 4L3HD 4CY2A 1K32A 1VYHC 5CYKA 3A0FA 2XU7A 4O3TB 5HE0B 2AH0A 4BUJC 3OKTA 3BG0A 3PSCB 2B4EA 5IGOA 3K26A 3OL2B 4JT5C 2QXVA 3I7KA
chains in the Genus database with same CATH superfamily
3I7HA 3J80g 2HYEA 4ESGA 2H9LA 4GQBB 3KRXB 4H5IA 3VA6A 2GC4A 3AH8B 2OVRB 4J78A 3K71A 4LG9A 1XKSA 2UZXB 3EQ7A 5I5MA 5FKSA 5CYKB 1OLZA 1B9XA 2O9KA 3QI0A 2CNXA 5FKQA 4ZOXA 2EICA 1N6FA 2IWFA 3NVXA 4NBMA 5E6SA 4A0AB 3C9CA 1U2VC 3AL8B 4N14A 3JPXA 4A2MA 4O1QD 3UVOA 4JSNC 1JV2A 2AGLA 5TEEA 4J8BA 2OIZA 4BCCA 3EI1B 2HXCA 4A09B 1JMXB 3IKOA 2P9NC 2CO0A 1NR0A 2XE4A 2XL3A 4LG8A 1P22A 3MVDK 1UOPA 5K19A 2IUPA 4Z7QA 4KFMB 4XEIC 4X61B 4PC0A 5EMLB 1U8CA 4GGCA 5HQGA 3W15A 4ZOYA 2P9SC 5EMJB 3RFGA 4O9DA 2QR5A 4A7JA 4J73A 3KRWB 4IMMA 2H9PA 3ODTA 3GC3B 2I0SA 4G55A 4IRZA 5FXYA 5EMKB 3IUQA 4GM9A 2J56H 4RE5A 4ZOZA 5EAMA 5FKTA 2XYIA 1JMZB 5H17A 2OVPB 4L1MA 4ZN4A 1JJUB 1H2XA 4JSVC 4U1EI 4ES0A 3I7NA 4ERZA 2W18A 4CC9A 2H6QA 4L3GD 5IGQA 3OTTA 4FA9D 2GNQA 2IWKA 4MMYA 5IT9g 4J82A 5EM2A 3I7PA 1UOQA 4CI1A 4DNVA 3UKUC 4JSXC 3T3MA 3CFSB 4Y5RD 4AN0A 3UVNA 4CZVA 4L1QD 2VDNA 4FWWA 4PBZA 2PM7B 3IJEA 2B5LA 2VDQA 2HJ4A 5HE2B 2I3SA 3O4JA 5C2VB 1FWXA 3V7DB 1TBGA 2PBIB 1MG2A 2VC2A 3OL2A 3ORVD 4OWRA 2H68A 2YB8B 4D9SA 3FCSA 4J0WA 4GZ8A 3SHFA 5E6RA 2IAAA 2VZ3A 2P9IC 5C9ZB 2VDMA 4LGNA 4U7AA 1MG3A 1N6DA 3V5WB 2JKXA 2I0RA 3PVWB 3IJ0A 3JRPA 2H13A 5EMMB 2VDLA 3NIGA 4AN1A 2CN3A 4NC4A 5M5TA 4EWRA 5I5IA 4A0AA 4X63B 3EI3A 4HDJA 4JHNA 1E8MA 3AL8A 2PM9B 2BCJB 4PSXB 5AJAA 3I8CA 3O4HA 3U4YA 1O6FA 3EI4A 1K8KC 3ZDZA 1SQJA 3EI1A 3ZE0A 3B7FA 4A09A 3VI3A 3ZE2A 5FKRA 1GG2B 4CZYA 3EWEA 4GM8A 2HKMA 4MK0B 3SFZA 4BH6A 3EI3B 3VGZA 2CN2A 3SVWD 2HESX 5GMKn 3IUNA 5IJ7E 3QHYB 2IUVA 5E6UA 2EIDA 5HE1B 3MZLA 2I0TA 3FRXA 4J79A 4J77A 1S4UX 1XHMA 3EI4B 2H9MA 2OJYA 4JT6C 4ERYA 3UVKA 2P9UC 2H3XA 4FAVD 2YMUA 4RE6A 5CXCB 2G9AA 4JSPC 3DXMC 5M61A 5K1CC 5C92A 1M1XA 3C75H 3JB9L 5M5SA 4Z7OA 3MXXA 3HFQA 1B9YA 3SBRA 3DSMA 3F3PA 4XYHA 4DNWA 3I8EA 3JAMg 5AFU3 1RI6A 4OZUA 4NSXA 3AFCA 2P9KC 3OKWA 2VDRA 5FQDA 4CZXA 1R5MA 3PXTD 3SBPA 4QT8A 2H9NA 2TRCB 3MKSB 4GGDA 4H5JA 4MMZA 1Q47A 4CI3A 3IJ1A 4PSWB 2XL2A 2MTAH 1UOOA 2AQ5A 5SXMA 3I89A 5B4WA 1QFSA 2B5MA 5M5VA 1L5GA 3CIKB 1GOFA 4J84A 2IURA 3T3PA 4A11B 4GGAA 2YBAA 3N0DA 4FA4D 3OKYB 3SWSD 4WK0A 1L0QA 2AH1A 3F3GA 4FB1D 4A0BA 1A0RB 2CE8A 3PE7A 4FHLA 4E5ZA 4CY5A 2Q7QA 4A08B 5I5JA 1I2MB 3ZDXA 4IA9A 2Z2NA 3GFCA 4ZOVA 2CO0C 4K3JB 4A2LA 3JZHA 2WQ8A 4D0KA 5EAPA 3IVMA 2XDWA 5IC7A 3IUJA 3FGBA 1SHYB 3K72A 3F3FA 5FA5B 4Z7NA 2PM9A 4QL1A 5IJ8E 3GD1I 4A0BB 3UKRC 1XIPA 4CI8A 4E5ZB 5EARA 2AGWA 2OK4A 3P4FA 4FA5D 4QQEA 3DDUA 1C9LA 1C9IA 1ERJA 2BBKH 3SCYA 3SLED 4CY3A 5KDOB 2VDPA 5GSAA 2J55H 1T2XA 1VZ3A 4QAMA 3IUMA 3EI2A 3ZWLB 3N0EA 3K27A 2B5NA 3RN0D 3SN6B 1VE6A 2OVQB 3J81g 3EU7A 3EQ8A 2HU5A 4AMYA 5THAA 1PI6A 4CY1A 3OF7A 3I7OA 3JZNA 5EALA 3RRMC 5JWZA 4UM9A 1K3IA 1NEXB 5C2WB 3SMRA 2HKRA 3IJCA 3MUOA 2HU8A 3SBQA 3ULEC 2EIBA 5CXCA 5FFGA 2CE9A 3SJLD 2HU7A 3EI2B 2P9PC 3KCIA 3L4MD 4JHPC 4FA1D 3EMHA 3IIWA 2EIEA 2XZGA 4Y7RA 2BKLA 1U4CA 1O6GA 3AL9A 1PEVA 4BCDA 3IURA 3JROA 3NVNA 1E8NA 3EG6A 3EQ9A 4UM8A 4BCBA 4BP8A 5TDHB 5C86A 3SXTD 2EBSA 1PGUA 1TYQC 3I7LA 3O4GA 3PXWD 4G1MA 4J81A 4JD2C 4XYIA 5CXBA 1H2WA 4AOWA 3PVUB 4L9OA 3DM0A 4J8GA 1JOFA 4J86A 5FLXg 3UVLA 3I2NA 4WK2A 2G99A 2VZ1A 4DNUA 4R7AB 2VDOA 4ERQA 1SQ9A 2J57G 3MMYA 3CFVA 4D6VA 1GP2B 4PXWA 5FFOA 4E54A 4A11A 3FCUA 2QZPA 3MZKA 4K3ID 5GXIA 3OKYA 5HDBA 2H14A 4UI9R 1QFMA 4GQ1A 4JXMA 5GXHA 4X60B 1N6EA 2OK6A 2YNPA 3NVQA 4J0XA 3JZGA 1A12A 4X3EA 5CXBB 3VH0A 4YVDA 4A08A 3L4OD 2P9LC 3RN1D 3GREA 2H47A 3PXSD 4Z8LA 4NAAA 1GOGA 3IIYA 4CI2A 3V4PA 4GQ2P 3C99A 5TF2A 4E54B 3V4VA 2Z2PA 4MMXA 5M5UA 3RMZD 5TEFA 1MDAH 1JTDB 4PBYA 4GMBA 3ZE1A 3PSLA 2H6KA 1GOHA 2AGXA 3DXKC 2IUQA 4PNKB 2GC7A 4TZ4A 2HJBA 4GM3A 3MKQA 1PBYB 1VZ2A 1H2YA 1TYEA 3IULA 1OMWB 3DWLC 3FM0A 3E0CA 5H1MA 4AX4A 1GOTB 3NIFA 4AMZA 2YNNA 1BPOA 1QNIA 3UVMA 1H2ZA 3RSEC 3OW8A 3BWSA 3RLMD 4G1EA 4O2WA 2H6NA 2YNOA 4QRJA 1YR2A 4O3UB 4G56B 3BG1A 1YFQA 4AEZA 1E5TA 2QC5A 1VE7A 5H14A 5AMSA 2I3TA 5HE3B 2PM6B 2UZYB 3UR4A 3MUNA 4I79A 4J87A 3NIDA 1GXRA 2VDKA 5M5RA 4NENA 2Z2OA 3V9FA 4FAND 5EM2B 3O4IA 5HYNB 4BL0A 4O45A 3C5MA 3K6SA 2AGZA 2AGYA 5A2Qg 3RFHA 4L3HD 4CY2A 1K32A 4BP9A 3VI4A 4WJKA 1VYHC 5CYKA 3A0FA 3ZDYA 2XU7A 1UTCA 4O3TB 5HE0B 2AH0A 4BUJC 4O02A 3OKTA 4WK4A 3BG0A 3PSCB 2B4EA 5IGOA 3K26A 3OL2B 4JT5C 2QXVA 3I7KA
chains in the Genus database with same CATH topology
3I7HA 3J80g 2HYEA 4ESGA 2H9LA 4GQBB 3KRXB 4H5IA 3VA6A 2GC4A 3AH8B 2OVRB 4J78A 4LG9A 1XKSA 2UZXB 5I5MA 5FKSA 5CYKB 1OLZA 1B9XA 2O9KA 5FKQA 2CNXA 4ZOXA 1N6FA 2IWFA 3NVXA 4A0AB 3C9CA 1U2VC 3AL8B 4N14A 3JPXA 4A2MA 4O1QD 3UVOA 4JSNC 2AGLA 5TEEA 4J8BA 2OIZA 3EI1B 2HXCA 4A09B 1JMXB 3IKOA 2P9NC 2CO0A 1NR0A 4LG8A 2XL3A 1P22A 5K19A 2IUPA 4KFMB 4XEIC 4X61B 4PC0A 5EMLB 4GGCA 5HQGA 3W15A 4ZOYA 2P9SC 5EMJB 3RFGA 4O9DA 4A7JA 4J73A 3KRWB 4IMMA 2H9PA 3ODTA 2I0SA 5FXYA 5EMKB 4GM9A 2J56H 4ZOZA 5EAMA 5FKTA 2XYIA 1JMZB 5H17A 2OVPB 4ZN4A 1JJUB 4JSVC 4U1EI 4ES0A 3I7NA 4ERZA 2W18A 4CC9A 2H6QA 4L3GD 5IGQA 3OTTA 4FA9D 2GNQA 2IWKA 5IT9g 4J82A 5EM2A 3I7PA 4CI1A 3UKUC 4JSXC 3CFSB 4Y5RD 4CZVA 3UVNA 4L1QD 4FWWA 4PBZA 2PM7B 2B5LA 2HJ4A 5HE2B 2I3SA 5C2VB 1FWXA 3V7DB 1TBGA 2PBIB 1MG2A 3OL2A 3ORVD 4OWRA 2H68A 2YB8B 4J0WA 4GZ8A 3SHFA 2IAAA 2P9IC 5C9ZB 4LGNA 4U7AA 1MG3A 1N6DA 3V5WB 2I0RA 3PVWB 3IJ0A 3JRPA 2H13A 5EMMB 2CN3A 4EWRA 5I5IA 4A0AA 4X63B 3EI3A 4HDJA 3AL8A 2PM9B 2BCJB 4PSXB 5AJAA 3I8CA 3U4YA 3EI4A 1K8KC 1SQJA 3EI1A 3B7FA 4A09A 5FKRA 1GG2B 4CZYA 3EWEA 4GM8A 2HKMA 4MK0B 3SFZA 4BH6A 3EI3B 3VGZA 2CN2A 3SVWD 2HESX 5GMKn 5IJ7E 2IUVA 5HE1B 3MZLA 2I0TA 3FRXA 4J79A 4J77A 1S4UX 1XHMA 3EI4B 2H9MA 2OJYA 4JT6C 4ERYA 3UVKA 2P9UC 2H3XA 4FAVD 2YMUA 5CXCB 2G9AA 4JSPC 3DXMC 5K1CC 3C75H 3JB9L 3MXXA 3HFQA 1B9YA 3SBRA 3DSMA 3F3PA 4XYHA 3I8EA 3JAMg 5AFU3 1RI6A 4OZUA 4NSXA 3AFCA 2P9KC 3OKWA 5FQDA 4CZXA 1R5MA 3PXTD 4QT8A 2H9NA 2TRCB 3MKSB 4GGDA 4H5JA 1Q47A 4CI3A 3IJ1A 4PSWB 2XL2A 2MTAH 2AQ5A 5SXMA 3I89A 5B4WA 2B5MA 3CIKB 4J84A 2IURA 4A11B 4GGAA 2YBAA 3N0DA 4FA4D 3OKYB 3SWSD 1L0QA 2AH1A 3F3GA 4FB1D 4A0BA 1A0RB 2CE8A 3PE7A 4FHLA 4E5ZA 4CY5A 2Q7QA 4A08B 5I5JA 4IA9A 2Z2NA 3GFCA 4ZOVA 2CO0C 4K3JB 4A2LA 3JZHA 4D0KA 5EAPA 5IC7A 3FGBA 1SHYB 3F3FA 5FA5B 2PM9A 4QL1A 5IJ8E 4A0BB 3UKRC 1XIPA 4CI8A 4E5ZB 5EARA 2AGWA 2OK4A 3P4FA 4FA5D 4QQEA 1ERJA 3SLED 3SCYA 2BBKH 4CY3A 5KDOB 5GSAA 2J55H 3EI2A 3ZWLB 3N0EA 3K27A 2B5NA 3RN0D 3SN6B 2OVQB 3J81g 3EU7A 5THAA 1PI6A 4CY1A 3I7OA 3JZNA 5EALA 3RRMC 5JWZA 1NEXB 5C2WB 3SMRA 2HKRA 3IJCA 3SBQA 3ULEC 5CXCA 2CE9A 3SJLD 3EI2B 2P9PC 3L4MD 4FA1D 3EMHA 3IIWA 4Y7RA 1U4CA 3AL9A 1PEVA 3JROA 3NVNA 3EG6A 5TDHB 3SXTD 2EBSA 1PGUA 1TYQC 3I7LA 4J81A 3PXWD 4JD2C 3SBPA 4XYIA 5CXBA 4AOWA 3PVUB 4L9OA 3DM0A 4J8GA 1JOFA 4J86A 5FLXg 3UVLA 3I2NA 2G99A 4R7AB 4ERQA 1SQ9A 2J57G 3MMYA 3CFVA 4D6VA 1GP2B 4PXWA 4E54A 4A11A 3MZKA 4K3ID 5GXIA 3OKYA 2H14A 4UI9R 4GQ1A 4JXMA 5GXHA 4X60B 1N6EA 2OK6A 2YNPA 3NVQA 4J0XA 3JZGA 4X3EA 5CXBB 3VH0A 4YVDA 4A08A 3L4OD 2P9LC 3RN1D 3GREA 2H47A 3PXSD 4Z8LA 3IIYA 4CI2A 4GQ2P 3C99A 5TF2A 4E54B 2Z2PA 3RMZD 5TEFA 1MDAH 4PBYA 4GMBA 3PSLA 2H6KA 2AGXA 3DXKC 2IUQA 4PNKB 2GC7A 4TZ4A 2HJBA 4GM3A 3MKQA 1PBYB 1OMWB 3DWLC 3FM0A 3E0CA 5H1MA 1GOTB 2YNNA 1QNIA 3UVMA 3RSEC 3OW8A 3BWSA 3RLMD 2H6NA 2YNOA 4QRJA 4O3UB 4G56B 3BG1A 1YFQA 4AEZA 2QC5A 5H14A 5AMSA 2I3TA 5HE3B 2PM6B 2UZYB 3UR4A 4I79A 4J87A 1GXRA 2Z2OA 3V9FA 4FAND 5EM2B 5HYNB 4BL0A 4O45A 3C5MA 2AGZA 2AGYA 5A2Qg 3RFHA 4L3HD 4CY2A 1K32A 1VYHC 5CYKA 3A0FA 2XU7A 4O3TB 5HE0B 2AH0A 4BUJC 3OKTA 3BG0A 3PSCB 2B4EA 5IGOA 3K26A 3OL2B 4JT5C 2QXVA 3I7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7H A;  3J80 g;  2HYE A;  4ESG A;  2H9L A;  4GQB B;  3KRX B;  4H5I A;  3VA6 A;  2GC4 A;  3AH8 B;  2OVR B;  4J78 A;  4LG9 A;  1XKS A;  2UZX B;  5I5M A;  5FKS A;  5CYK B;  1OLZ A;  1B9X A;  2O9K A;  5FKQ A;  2CNX A;  4ZOX A;  1N6F A;  2IWF A;  3NVX A;  4A0A B;  3C9C A;  1U2V C;  3AL8 B;  4N14 A;  3JPX A;  4A2M A;  4O1Q D;  3UVO A;  4JSN C;  2AGL A;  5TEE A;  4J8B A;  2OIZ A;  3EI1 B;  2HXC A;  4A09 B;  1JMX B;  3IKO A;  2P9N C;  2CO0 A;  1NR0 A;  4LG8 A;  2XL3 A;  1P22 A;  5K19 A;  2IUP A;  4KFM B;  4XEI C;  4X61 B;  4PC0 A;  5EML B;  4GGC A;  5HQG A;  3W15 A;  4ZOY A;  2P9S C;  5EMJ B;  3RFG A;  4O9D A;  4A7J A;  4J73 A;  3KRW B;  4IMM A;  2H9P A;  3ODT A;  2I0S A;  5FXY A;  5EMK B;  4GM9 A;  2J56 H;  4ZOZ A;  5EAM A;  5FKT A;  2XYI A;  1JMZ B;  5H17 A;  2OVP B;  4ZN4 A;  1JJU B;  4JSV C;  4U1E I;  4ES0 A;  3I7N A;  4ERZ A;  2W18 A;  4CC9 A;  2H6Q A;  4L3G D;  5IGQ A;  3OTT A;  4FA9 D;  2GNQ A;  2IWK A;  5IT9 g;  4J82 A;  5EM2 A;  3I7P A;  4CI1 A;  3UKU C;  4JSX C;  3CFS B;  4Y5R D;  4CZV A;  3UVN A;  4L1Q D;  4FWW A;  4PBZ A;  2PM7 B;  2B5L A;  2HJ4 A;  5HE2 B;  2I3S A;  5C2V B;  1FWX A;  3V7D B;  1TBG A;  2PBI B;  1MG2 A;  3OL2 A;  3ORV D;  4OWR A;  2H68 A;  2YB8 B;  4J0W A;  4GZ8 A;  3SHF A;  2IAA A;  2P9I C;  5C9Z B;  4LGN A;  4U7A A;  1MG3 A;  1N6D A;  3V5W B;  2I0R A;  3PVW B;  3IJ0 A;  3JRP A;  2H13 A;  5EMM B;  2CN3 A;  4EWR A;  5I5I A;  4A0A A;  4X63 B;  3EI3 A;  4HDJ A;  3AL8 A;  2PM9 B;  2BCJ B;  4PSX B;  5AJA A;  3I8C A;  3U4Y A;  3EI4 A;  1K8K C;  1SQJ A;  3EI1 A;  3B7F A;  4A09 A;  5FKR A;  1GG2 B;  4CZY A;  3EWE A;  4GM8 A;  2HKM A;  4MK0 B;  3SFZ A;  4BH6 A;  3EI3 B;  3VGZ A;  2CN2 A;  3SVW D;  2HES X;  5GMK n;  5IJ7 E;  2IUV A;  5HE1 B;  3MZL A;  2I0T A;  3FRX A;  4J79 A;  4J77 A;  1S4U X;  1XHM A;  3EI4 B;  2H9M A;  2OJY A;  4JT6 C;  4ERY A;  3UVK A;  2P9U C;  2H3X A;  4FAV D;  2YMU A;  5CXC B;  2G9A A;  4JSP C;  3DXM C;  5K1C C;  3C75 H;  3JB9 L;  3MXX A;  3HFQ A;  1B9Y A;  3SBR A;  3DSM A;  3F3P A;  4XYH A;  3I8E A;  3JAM g;  5AFU 3;  1RI6 A;  4OZU A;  4NSX A;  3AFC A;  2P9K C;  3OKW A;  5FQD A;  4CZX A;  1R5M A;  3PXT D;  4QT8 A;  2H9N A;  2TRC B;  3MKS B;  4GGD A;  4H5J A;  1Q47 A;  4CI3 A;  3IJ1 A;  4PSW B;  2XL2 A;  2MTA H;  2AQ5 A;  5SXM A;  3I89 A;  5B4W A;  2B5M A;  3CIK B;  4J84 A;  2IUR A;  4A11 B;  4GGA A;  2YBA A;  3N0D A;  4FA4 D;  3OKY B;  3SWS D;  1L0Q A;  2AH1 A;  3F3G A;  4FB1 D;  4A0B A;  1A0R B;  2CE8 A;  3PE7 A;  4FHL A;  4E5Z A;  4CY5 A;  2Q7Q A;  4A08 B;  5I5J A;  4IA9 A;  2Z2N A;  3GFC A;  4ZOV A;  2CO0 C;  4K3J B;  4A2L A;  3JZH A;  4D0K A;  5EAP A;  5IC7 A;  3FGB A;  1SHY B;  3F3F A;  5FA5 B;  2PM9 A;  4QL1 A;  5IJ8 E;  4A0B B;  3UKR C;  1XIP A;  4CI8 A;  4E5Z B;  5EAR A;  2AGW A;  2OK4 A;  3P4F A;  4FA5 D;  4QQE A;  1ERJ A;  3SLE D;  3SCY A;  2BBK H;  4CY3 A;  5KDO B;  5GSA A;  2J55 H;  3EI2 A;  3ZWL B;  3N0E A;  3K27 A;  2B5N A;  3RN0 D;  3SN6 B;  2OVQ B;  3J81 g;  3EU7 A;  5THA A;  1PI6 A;  4CY1 A;  3I7O A;  3JZN A;  5EAL A;  3RRM C;  5JWZ A;  1NEX B;  5C2W B;  3SMR A;  2HKR A;  3IJC A;  3SBQ A;  3ULE C;  5CXC A;  2CE9 A;  3SJL D;  3EI2 B;  2P9P C;  3L4M D;  4FA1 D;  3EMH A;  3IIW A;  4Y7R A;  1U4C A;  3AL9 A;  1PEV A;  3JRO A;  3NVN A;  3EG6 A;  5TDH B;  3SXT D;  2EBS A;  1PGU A;  1TYQ C;  3I7L A;  4J81 A;  3PXW D;  4JD2 C;  3SBP A;  4XYI A;  5CXB A;  4AOW A;  3PVU B;  4L9O A;  3DM0 A;  4J8G A;  1JOF A;  4J86 A;  5FLX g;  3UVL A;  3I2N A;  2G99 A;  4R7A B;  4ERQ A;  1SQ9 A;  2J57 G;  3MMY A;  3CFV A;  4D6V A;  1GP2 B;  4PXW A;  4E54 A;  4A11 A;  3MZK A;  4K3I D;  5GXI A;  3OKY A;  2H14 A;  4UI9 R;  4GQ1 A;  4JXM A;  5GXH A;  4X60 B;  1N6E A;  2OK6 A;  2YNP A;  3NVQ A;  4J0X A;  3JZG A;  4X3E A;  5CXB B;  3VH0 A;  4YVD A;  4A08 A;  3L4O D;  2P9L C;  3RN1 D;  3GRE A;  2H47 A;  3PXS D;  4Z8L A;  3IIY A;  4CI2 A;  4GQ2 P;  3C99 A;  5TF2 A;  4E54 B;  2Z2P A;  3RMZ D;  5TEF A;  1MDA H;  4PBY A;  4GMB A;  3PSL A;  2H6K A;  2AGX A;  3DXK C;  2IUQ A;  4PNK B;  2GC7 A;  4TZ4 A;  2HJB A;  4GM3 A;  3MKQ A;  1PBY B;  1OMW B;  3DWL C;  3FM0 A;  3E0C A;  5H1M A;  1GOT B;  2YNN A;  1QNI A;  3UVM A;  3RSE C;  3OW8 A;  3BWS A;  3RLM D;  2H6N A;  2YNO A;  4QRJ A;  4O3U B;  4G56 B;  3BG1 A;  1YFQ A;  4AEZ A;  2QC5 A;  5H14 A;  5AMS A;  2I3T A;  5HE3 B;  2PM6 B;  2UZY B;  3UR4 A;  4I79 A;  4J87 A;  1GXR A;  2Z2O A;  3V9F A;  4FAN D;  5EM2 B;  5HYN B;  4BL0 A;  4O45 A;  3C5M A;  2AGZ A;  2AGY A;  5A2Q g;  3RFH A;  4L3H D;  4CY2 A;  1K32 A;  1VYH C;  5CYK A;  3A0F A;  2XU7 A;  4O3T B;  5HE0 B;  2AH0 A;  4BUJ C;  3OKT A;  3BG0 A;  3PSC B;  2B4E A;  5IGO A;  3K26 A;  3OL2 B;  4JT5 C;  2QXV A;  3I7K A; 
#chains in the Genus database with same CATH topology
 3I7H A;  3J80 g;  2HYE A;  4ESG A;  2H9L A;  4GQB B;  3KRX B;  4H5I A;  3VA6 A;  2GC4 A;  3AH8 B;  2OVR B;  4J78 A;  3K71 A;  4LG9 A;  1XKS A;  2UZX B;  3EQ7 A;  5I5M A;  5FKS A;  5CYK B;  1OLZ A;  1B9X A;  2O9K A;  3QI0 A;  2CNX A;  5FKQ A;  4ZOX A;  2EIC A;  1N6F A;  2IWF A;  3NVX A;  4NBM A;  5E6S A;  4A0A B;  3C9C A;  1U2V C;  3AL8 B;  4N14 A;  3JPX A;  4A2M A;  4O1Q D;  3UVO A;  4JSN C;  1JV2 A;  2AGL A;  5TEE A;  4J8B A;  2OIZ A;  4BCC A;  3EI1 B;  2HXC A;  4A09 B;  1JMX B;  3IKO A;  2P9N C;  2CO0 A;  1NR0 A;  2XE4 A;  2XL3 A;  4LG8 A;  1P22 A;  3MVD K;  1UOP A;  5K19 A;  2IUP A;  4Z7Q A;  4KFM B;  4XEI C;  4X61 B;  4PC0 A;  5EML B;  1U8C A;  4GGC A;  5HQG A;  3W15 A;  4ZOY A;  2P9S C;  5EMJ B;  3RFG A;  4O9D A;  2QR5 A;  4A7J A;  4J73 A;  3KRW B;  4IMM A;  2H9P A;  3ODT A;  3GC3 B;  2I0S A;  4G55 A;  4IRZ A;  5FXY A;  5EMK B;  3IUQ A;  4GM9 A;  2J56 H;  4RE5 A;  4ZOZ A;  5EAM A;  5FKT A;  2XYI A;  1JMZ B;  5H17 A;  2OVP B;  4L1M A;  4ZN4 A;  1JJU B;  1H2X A;  4JSV C;  4U1E I;  4ES0 A;  3I7N A;  4ERZ A;  2W18 A;  4CC9 A;  2H6Q A;  4L3G D;  5IGQ A;  3OTT A;  4FA9 D;  2GNQ A;  2IWK A;  4MMY A;  5IT9 g;  4J82 A;  5EM2 A;  3I7P A;  1UOQ A;  4CI1 A;  4DNV A;  3UKU C;  4JSX C;  3T3M A;  3CFS B;  4Y5R D;  4AN0 A;  3UVN A;  4CZV A;  4L1Q D;  2VDN A;  4FWW A;  4PBZ A;  2PM7 B;  3IJE A;  2B5L A;  2VDQ A;  2HJ4 A;  5HE2 B;  2I3S A;  3O4J A;  5C2V B;  1FWX A;  3V7D B;  1TBG A;  2PBI B;  1MG2 A;  2VC2 A;  3OL2 A;  3ORV D;  4OWR A;  2H68 A;  2YB8 B;  4D9S A;  3FCS A;  4J0W A;  4GZ8 A;  3SHF A;  5E6R A;  2IAA A;  2VZ3 A;  2P9I C;  5C9Z B;  2VDM A;  4LGN A;  4U7A A;  1MG3 A;  1N6D A;  3V5W B;  2JKX A;  2I0R A;  3PVW B;  3IJ0 A;  3JRP A;  2H13 A;  5EMM B;  2VDL A;  3NIG A;  4AN1 A;  2CN3 A;  4NC4 A;  5M5T A;  4EWR A;  5I5I A;  4A0A A;  4X63 B;  3EI3 A;  4HDJ A;  4JHN A;  1E8M A;  3AL8 A;  2PM9 B;  2BCJ B;  4PSX B;  5AJA A;  3I8C A;  3O4H A;  3U4Y A;  1O6F A;  3EI4 A;  1K8K C;  3ZDZ A;  1SQJ A;  3EI1 A;  3ZE0 A;  3B7F A;  4A09 A;  3VI3 A;  3ZE2 A;  5FKR A;  1GG2 B;  4CZY A;  3EWE A;  4GM8 A;  2HKM A;  4MK0 B;  3SFZ A;  4BH6 A;  3EI3 B;  3VGZ A;  2CN2 A;  3SVW D;  2HES X;  5GMK n;  3IUN A;  5IJ7 E;  3QHY B;  2IUV A;  5E6U A;  2EID A;  5HE1 B;  3MZL A;  2I0T A;  3FRX A;  4J79 A;  4J77 A;  1S4U X;  1XHM A;  3EI4 B;  2H9M A;  2OJY A;  4JT6 C;  4ERY A;  3UVK A;  2P9U C;  2H3X A;  4FAV D;  2YMU A;  4RE6 A;  5CXC B;  2G9A A;  4JSP C;  3DXM C;  5M61 A;  5K1C C;  5C92 A;  1M1X A;  3C75 H;  3JB9 L;  5M5S A;  4Z7O A;  3MXX A;  3HFQ A;  1B9Y A;  3SBR A;  3DSM A;  3F3P A;  4XYH A;  4DNW A;  3I8E A;  3JAM g;  5AFU 3;  1RI6 A;  4OZU A;  4NSX A;  3AFC A;  2P9K C;  3OKW A;  2VDR A;  5FQD A;  4CZX A;  1R5M A;  3PXT D;  3SBP A;  4QT8 A;  2H9N A;  2TRC B;  3MKS B;  4GGD A;  4H5J A;  4MMZ A;  1Q47 A;  4CI3 A;  3IJ1 A;  4PSW B;  2XL2 A;  2MTA H;  1UOO A;  2AQ5 A;  5SXM A;  3I89 A;  5B4W A;  1QFS A;  2B5M A;  5M5V A;  1L5G A;  3CIK B;  1GOF A;  4J84 A;  2IUR A;  3T3P A;  4A11 B;  4GGA A;  2YBA A;  3N0D A;  4FA4 D;  3OKY B;  3SWS D;  4WK0 A;  1L0Q A;  2AH1 A;  3F3G A;  4FB1 D;  4A0B A;  1A0R B;  2CE8 A;  3PE7 A;  4FHL A;  4E5Z A;  4CY5 A;  2Q7Q A;  4A08 B;  5I5J A;  1I2M B;  3ZDX A;  4IA9 A;  2Z2N A;  3GFC A;  4ZOV A;  2CO0 C;  4K3J B;  4A2L A;  3JZH A;  2WQ8 A;  4D0K A;  5EAP A;  3IVM A;  2XDW A;  5IC7 A;  3IUJ A;  3FGB A;  1SHY B;  3K72 A;  3F3F A;  5FA5 B;  4Z7N A;  2PM9 A;  4QL1 A;  5IJ8 E;  3GD1 I;  4A0B B;  3UKR C;  1XIP A;  4CI8 A;  4E5Z B;  5EAR A;  2AGW A;  2OK4 A;  3P4F A;  4FA5 D;  4QQE A;  3DDU A;  1C9L A;  1C9I A;  1ERJ A;  2BBK H;  3SCY A;  3SLE D;  4CY3 A;  5KDO B;  2VDP A;  5GSA A;  2J55 H;  1T2X A;  1VZ3 A;  4QAM A;  3IUM A;  3EI2 A;  3ZWL B;  3N0E A;  3K27 A;  2B5N A;  3RN0 D;  3SN6 B;  1VE6 A;  2OVQ B;  3J81 g;  3EU7 A;  3EQ8 A;  2HU5 A;  4AMY A;  5THA A;  1PI6 A;  4CY1 A;  3OF7 A;  3I7O A;  3JZN A;  5EAL A;  3RRM C;  5JWZ A;  4UM9 A;  1K3I A;  1NEX B;  5C2W B;  3SMR A;  2HKR A;  3IJC A;  3MUO A;  2HU8 A;  3SBQ A;  3ULE C;  2EIB A;  5CXC A;  5FFG A;  2CE9 A;  3SJL D;  2HU7 A;  3EI2 B;  2P9P C;  3KCI A;  3L4M D;  4JHP C;  4FA1 D;  3EMH A;  3IIW A;  2EIE A;  2XZG A;  4Y7R A;  2BKL A;  1U4C A;  1O6G A;  3AL9 A;  1PEV A;  4BCD A;  3IUR A;  3JRO A;  3NVN A;  1E8N A;  3EG6 A;  3EQ9 A;  4UM8 A;  4BCB A;  4BP8 A;  5TDH B;  5C86 A;  3SXT D;  2EBS A;  1PGU A;  1TYQ C;  3I7L A;  3O4G A;  3PXW D;  4G1M A;  4J81 A;  4JD2 C;  4XYI A;  5CXB A;  1H2W A;  4AOW A;  3PVU B;  4L9O A;  3DM0 A;  4J8G A;  1JOF A;  4J86 A;  5FLX g;  3UVL A;  3I2N A;  4WK2 A;  2G99 A;  2VZ1 A;  4DNU A;  4R7A B;  2VDO A;  4ERQ A;  1SQ9 A;  2J57 G;  3MMY A;  3CFV A;  4D6V A;  1GP2 B;  4PXW A;  5FFO A;  4E54 A;  4A11 A;  3FCU A;  2QZP A;  3MZK A;  4K3I D;  5GXI A;  3OKY A;  5HDB A;  2H14 A;  4UI9 R;  1QFM A;  4GQ1 A;  4JXM A;  5GXH A;  4X60 B;  1N6E A;  2OK6 A;  2YNP A;  3NVQ A;  4J0X A;  3JZG A;  1A12 A;  4X3E A;  5CXB B;  3VH0 A;  4YVD A;  4A08 A;  3L4O D;  2P9L C;  3RN1 D;  3GRE A;  2H47 A;  3PXS D;  4Z8L A;  4NAA A;  1GOG A;  3IIY A;  4CI2 A;  3V4P A;  4GQ2 P;  3C99 A;  5TF2 A;  4E54 B;  3V4V A;  2Z2P A;  4MMX A;  5M5U A;  3RMZ D;  5TEF A;  1MDA H;  1JTD B;  4PBY A;  4GMB A;  3ZE1 A;  3PSL A;  2H6K A;  1GOH A;  2AGX A;  3DXK C;  2IUQ A;  4PNK B;  2GC7 A;  4TZ4 A;  2HJB A;  4GM3 A;  3MKQ A;  1PBY B;  1VZ2 A;  1H2Y A;  1TYE A;  3IUL A;  1OMW B;  3DWL C;  3FM0 A;  3E0C A;  5H1M A;  4AX4 A;  1GOT B;  3NIF A;  4AMZ A;  2YNN A;  1BPO A;  1QNI A;  3UVM A;  1H2Z A;  3RSE C;  3OW8 A;  3BWS A;  3RLM D;  4G1E A;  4O2W A;  2H6N A;  2YNO A;  4QRJ A;  1YR2 A;  4O3U B;  4G56 B;  3BG1 A;  1YFQ A;  4AEZ A;  1E5T A;  2QC5 A;  1VE7 A;  5H14 A;  5AMS A;  2I3T A;  5HE3 B;  2PM6 B;  2UZY B;  3UR4 A;  3MUN A;  4I79 A;  4J87 A;  3NID A;  1GXR A;  2VDK A;  5M5R A;  4NEN A;  2Z2O A;  3V9F A;  4FAN D;  5EM2 B;  3O4I A;  5HYN B;  4BL0 A;  4O45 A;  3C5M A;  3K6S A;  2AGZ A;  2AGY A;  5A2Q g;  3RFH A;  4L3H D;  4CY2 A;  1K32 A;  4BP9 A;  3VI4 A;  4WJK A;  1VYH C;  5CYK A;  3A0F A;  3ZDY A;  2XU7 A;  1UTC A;  4O3T B;  5HE0 B;  2AH0 A;  4BUJ C;  4O02 A;  3OKT A;  4WK4 A;  3BG0 A;  3PSC B;  2B4E A;  5IGO A;  3K26 A;  3OL2 B;  4JT5 C;  2QXV A;  3I7K A; 
#chains in the Genus database with same CATH homology
 3I7H A;  3J80 g;  2HYE A;  4ESG A;  2H9L A;  4GQB B;  3KRX B;  4H5I A;  3VA6 A;  2GC4 A;  3AH8 B;  2OVR B;  4J78 A;  4LG9 A;  1XKS A;  2UZX B;  5I5M A;  5FKS A;  5CYK B;  1OLZ A;  1B9X A;  2O9K A;  5FKQ A;  2CNX A;  4ZOX A;  1N6F A;  2IWF A;  3NVX A;  4A0A B;  3C9C A;  1U2V C;  3AL8 B;  4N14 A;  3JPX A;  4A2M A;  4O1Q D;  3UVO A;  4JSN C;  2AGL A;  5TEE A;  4J8B A;  2OIZ A;  3EI1 B;  2HXC A;  4A09 B;  1JMX B;  3IKO A;  2P9N C;  2CO0 A;  1NR0 A;  4LG8 A;  2XL3 A;  1P22 A;  5K19 A;  2IUP A;  4KFM B;  4XEI C;  4X61 B;  4PC0 A;  5EML B;  4GGC A;  5HQG A;  3W15 A;  4ZOY A;  2P9S C;  5EMJ B;  3RFG A;  4O9D A;  4A7J A;  4J73 A;  3KRW B;  4IMM A;  2H9P A;  3ODT A;  2I0S A;  5FXY A;  5EMK B;  4GM9 A;  2J56 H;  4ZOZ A;  5EAM A;  5FKT A;  2XYI A;  1JMZ B;  5H17 A;  2OVP B;  4ZN4 A;  1JJU B;  4JSV C;  4U1E I;  4ES0 A;  3I7N A;  4ERZ A;  2W18 A;  4CC9 A;  2H6Q A;  4L3G D;  5IGQ A;  3OTT A;  4FA9 D;  2GNQ A;  2IWK A;  5IT9 g;  4J82 A;  5EM2 A;  3I7P A;  4CI1 A;  3UKU C;  4JSX C;  3CFS B;  4Y5R D;  4CZV A;  3UVN A;  4L1Q D;  4FWW A;  4PBZ A;  2PM7 B;  2B5L A;  2HJ4 A;  5HE2 B;  2I3S A;  5C2V B;  1FWX A;  3V7D B;  1TBG A;  2PBI B;  1MG2 A;  3OL2 A;  3ORV D;  4OWR A;  2H68 A;  2YB8 B;  4J0W A;  4GZ8 A;  3SHF A;  2IAA A;  2P9I C;  5C9Z B;  4LGN A;  4U7A A;  1MG3 A;  1N6D A;  3V5W B;  2I0R A;  3PVW B;  3IJ0 A;  3JRP A;  2H13 A;  5EMM B;  2CN3 A;  4EWR A;  5I5I A;  4A0A A;  4X63 B;  3EI3 A;  4HDJ A;  3AL8 A;  2PM9 B;  2BCJ B;  4PSX B;  5AJA A;  3I8C A;  3U4Y A;  3EI4 A;  1K8K C;  1SQJ A;  3EI1 A;  3B7F A;  4A09 A;  5FKR A;  1GG2 B;  4CZY A;  3EWE A;  4GM8 A;  2HKM A;  4MK0 B;  3SFZ A;  4BH6 A;  3EI3 B;  3VGZ A;  2CN2 A;  3SVW D;  2HES X;  5GMK n;  5IJ7 E;  2IUV A;  5HE1 B;  3MZL A;  2I0T A;  3FRX A;  4J79 A;  4J77 A;  1S4U X;  1XHM A;  3EI4 B;  2H9M A;  2OJY A;  4JT6 C;  4ERY A;  3UVK A;  2P9U C;  2H3X A;  4FAV D;  2YMU A;  5CXC B;  2G9A A;  4JSP C;  3DXM C;  5K1C C;  3C75 H;  3JB9 L;  3MXX A;  3HFQ A;  1B9Y A;  3SBR A;  3DSM A;  3F3P A;  4XYH A;  3I8E A;  3JAM g;  5AFU 3;  1RI6 A;  4OZU A;  4NSX A;  3AFC A;  2P9K C;  3OKW A;  5FQD A;  4CZX A;  1R5M A;  3PXT D;  4QT8 A;  2H9N A;  2TRC B;  3MKS B;  4GGD A;  4H5J A;  1Q47 A;  4CI3 A;  3IJ1 A;  4PSW B;  2XL2 A;  2MTA H;  2AQ5 A;  5SXM A;  3I89 A;  5B4W A;  2B5M A;  3CIK B;  4J84 A;  2IUR A;  4A11 B;  4GGA A;  2YBA A;  3N0D A;  4FA4 D;  3OKY B;  3SWS D;  1L0Q A;  2AH1 A;  3F3G A;  4FB1 D;  4A0B A;  1A0R B;  2CE8 A;  3PE7 A;  4FHL A;  4E5Z A;  4CY5 A;  2Q7Q A;  4A08 B;  5I5J A;  4IA9 A;  2Z2N A;  3GFC A;  4ZOV A;  2CO0 C;  4K3J B;  4A2L A;  3JZH A;  4D0K A;  5EAP A;  5IC7 A;  3FGB A;  1SHY B;  3F3F A;  5FA5 B;  2PM9 A;  4QL1 A;  5IJ8 E;  4A0B B;  3UKR C;  1XIP A;  4CI8 A;  4E5Z B;  5EAR A;  2AGW A;  2OK4 A;  3P4F A;  4FA5 D;  4QQE A;  1ERJ A;  3SLE D;  3SCY A;  2BBK H;  4CY3 A;  5KDO B;  5GSA A;  2J55 H;  3EI2 A;  3ZWL B;  3N0E A;  3K27 A;  2B5N A;  3RN0 D;  3SN6 B;  2OVQ B;  3J81 g;  3EU7 A;  5THA A;  1PI6 A;  4CY1 A;  3I7O A;  3JZN A;  5EAL A;  3RRM C;  5JWZ A;  1NEX B;  5C2W B;  3SMR A;  2HKR A;  3IJC A;  3SBQ A;  3ULE C;  5CXC A;  2CE9 A;  3SJL D;  3EI2 B;  2P9P C;  3L4M D;  4FA1 D;  3EMH A;  3IIW A;  4Y7R A;  1U4C A;  3AL9 A;  1PEV A;  3JRO A;  3NVN A;  3EG6 A;  5TDH B;  3SXT D;  2EBS A;  1PGU A;  1TYQ C;  3I7L A;  4J81 A;  3PXW D;  4JD2 C;  3SBP A;  4XYI A;  5CXB A;  4AOW A;  3PVU B;  4L9O A;  3DM0 A;  4J8G A;  1JOF A;  4J86 A;  5FLX g;  3UVL A;  3I2N A;  2G99 A;  4R7A B;  4ERQ A;  1SQ9 A;  2J57 G;  3MMY A;  3CFV A;  4D6V A;  1GP2 B;  4PXW A;  4E54 A;  4A11 A;  3MZK A;  4K3I D;  5GXI A;  3OKY A;  2H14 A;  4UI9 R;  4GQ1 A;  4JXM A;  5GXH A;  4X60 B;  1N6E A;  2OK6 A;  2YNP A;  3NVQ A;  4J0X A;  3JZG A;  4X3E A;  5CXB B;  3VH0 A;  4YVD A;  4A08 A;  3L4O D;  2P9L C;  3RN1 D;  3GRE A;  2H47 A;  3PXS D;  4Z8L A;  3IIY A;  4CI2 A;  4GQ2 P;  3C99 A;  5TF2 A;  4E54 B;  2Z2P A;  3RMZ D;  5TEF A;  1MDA H;  4PBY A;  4GMB A;  3PSL A;  2H6K A;  2AGX A;  3DXK C;  2IUQ A;  4PNK B;  2GC7 A;  4TZ4 A;  2HJB A;  4GM3 A;  3MKQ A;  1PBY B;  1OMW B;  3DWL C;  3FM0 A;  3E0C A;  5H1M A;  1GOT B;  2YNN A;  1QNI A;  3UVM A;  3RSE C;  3OW8 A;  3BWS A;  3RLM D;  2H6N A;  2YNO A;  4QRJ A;  4O3U B;  4G56 B;  3BG1 A;  1YFQ A;  4AEZ A;  2QC5 A;  5H14 A;  5AMS A;  2I3T A;  5HE3 B;  2PM6 B;  2UZY B;  3UR4 A;  4I79 A;  4J87 A;  1GXR A;  2Z2O A;  3V9F A;  4FAN D;  5EM2 B;  5HYN B;  4BL0 A;  4O45 A;  3C5M A;  2AGZ A;  2AGY A;  5A2Q g;  3RFH A;  4L3H D;  4CY2 A;  1K32 A;  1VYH C;  5CYK A;  3A0F A;  2XU7 A;  4O3T B;  5HE0 B;  2AH0 A;  4BUJ C;  3OKT A;  3BG0 A;  3PSC B;  2B4E A;  5IGO A;  3K26 A;  3OL2 B;  4JT5 C;  2QXV A;  3I7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...