3MXXA

Crystal structure of wdr5 mutant (s62a)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
315
Chain Sequence
b'GGQQMGRGSEFVKPNYALKFTLAGHTKAVSSVKFSPNGEWLAASSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title The Effect of Asp-His-Ser/Thr-Trp Tetrad on the Thermostability of WD40-Repeat Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 103
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2010-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3mxxA00
5EALA 2OVPB 1FWXA 1NR0A 1SQJA 1GP2B 4LGNA 5CXBB 3PXTD 2BBKH 4FA5D 4KFMB 3MKQA 4CY2A 4PSWB 4GGCA 1PGUA 1GXRA 2CE9A 2I3SA 2B5NA 4JT5C 2Z2NA 3K26A 2OK6A 4AOWA 5H14A 2YMUA 2QC5A 4CI8A 1N6FA 3SMRA 4JT6C 3KRWB 5HE3B 3N0DA 3SJLD 5C2WB 1QNIA 5SXMA 4ERZA 1N6EA 2OVQB 4PBYA 5FKTA 3EI4A 5EM2A 3F3GA 2AGYA 2H9PA 5HE2B 4CI1A 2CO0C 4A11A 4FHLA 1S4UX 3RFGA 3SHFA 4L3HD 4A0AB 2Q7QA 2QXVA 4PBZA 4ZOYA 3JAMg 1U4CA 4CI2A 2AGXA 1ERJA 4J82A 5EM2B 4J73A 4ZOZA 2IUVA 3RN0D 4JSVC 2P9KC 2H9MA 5IJ8E 3OL2A 1VYHC 3PSCB 2H3XA 4A11B 3FRXA 3C5MA 2Z2OA 2IURA 2AGLA 3A0FA 4GGDA 2CNXA 3SBQA 3VH0A 4CZYA 2H6QA 1OMWB 3UKUC 4GZ8A 5FKQA 4XEIC 5TEEA 4JSXC 3AL8A 5GXHA 2J55H 4J84A 2HJ4A 3AH8B 4X61B 3RN1D 3I7NA 4XYIA 2EBSA 4YVDA 5K19A 4A08A 4X60B 4O45A 3GFCA 4A2MA 3FGBA 3EMHA 4OWRA 2HKRA 5B4WA 3V7DB 4J77A 3DSMA 5EMMB 4PNKB 3VGZA 2IUQA 3UVLA 2H9LA 3JZHA 2YBAA 5EAMA 2YNPA 3SWSD 4FWWA 3IIYA 5AFU3 3C9CA 1B9XA 2CE8A 3W15A 3NVXA 2AH0A 1N6DA 3F3FA 3MMYA 1B9YA 2YNNA 4CY3A 5C9ZB 4IA9A 4NSXA 1U2VC 3RMZD 3UVOA 1K32A 4H5IA 5FA5B 2OJYA 2H13A 1MG3A 5TDHB 3DWLC 3UR4A 4H5JA 4BL0A 5FKSA 3I7KA 4R7AB 3DM0A 4A7JA 5I5JA 2UZYB 4J78A 2XL3A 1JMZB 1SHYB 1GG2B 3KRXB 2G9AA 2YNOA 2P9NC 3E0CA 2I3TA 2PBIB 4FB1D 3RSEC 5IGOA 4X3EA 2O9KA 2IWFA 2PM6B 4O1QD 4O9DA 3NVNA 3OKYA 2BCJB 2P9SC 3JPXA 2PM7B 2B4EA 3I7HA 5CYKA 3P4FA 3EI4B 3RFHA 4MK0B 1MG2A 4CY5A 3B7FA 3DXMC 4JSNC 4J8GA 2CN2A 1L0QA 3CFSB 5CXCA 3EI1A 1JJUB 4X63B 3OKYB 4QRJA 3NVQA 5CYKB 4J79A 5FKRA 4J0WA 1MDAH 4J8BA 3SBRA 3I8CA 3JRPA 4GQ2P 2IUPA 2P9IC 4A09A 2B5LA 2PM9A 3OL2B 5IT9g 2HXCA 4BH6A 4U1EI 2OVRB 3V9FA 3U4YA 3EI1B 5IGQA 3JB9L 3MZKA 3I8EA 4JXMA 1R5MA 3CIKB 3DXKC 5I5MA 4LG8A 2J56H 4J81A 4XYHA 1P22A 2H68A 5HE1B 4QQEA 4GQBB 3AFCA 5KDOB 5TF2A 3FM0A 4ZN4A 3SFZA 3C75H 4K3ID 4FA9D 5C2VB 1XKSA 3IKOA 1PBYB 3AL8B 3GREA 5AMSA 3ULEC 3JZNA 4HDJA 2YB8B 5HQGA 2H9NA 3IIWA 3SCYA 4N14A 4L1QD 4A08B 2XU7A 1PI6A 5EAPA 4PC0A 4GM8A 3RRMC 1JOFA 1K8KC 2GC4A 2P9PC 2P9UC 3CFVA 4A0BA 4OZUA 4ES0A 5IJ7E 4O3UB 4Y7RA 3I7PA 2CN3A 4PXWA 3UVMA 4O3TB 4E5ZA 4JSPC 2AGWA 3C99A 3VA6A 3PE7A 4JD2C 1NEXB 5CXBA 3BG1A 4CZVA 4GQ1A 4GMBA 3PXWD 4ESGA 1YFQA 1XHMA 3HFQA 4UI9R 5H17A 3IJCA 4E5ZB 3I2NA 3OKWA 3UVNA 4ERQA 5FXYA 3PVUB 4ZOXA 5EMKB 3UVKA 1JMXB 4G56B 5K1CC 2GC7A 2OK4A 3ODTA 4CY1A 3ZWLB 2Z2PA 5GXIA 2I0RA 3JROA 3OKTA 5GSAA 1OLZA 1SQ9A 3JZGA 4AEZA 5HE0B 5EMJB 2GNQA 2XL2A 4IMMA 4A0AA 3IJ0A 3PVWB 4L3GD 3J81g 3OW8A 3L4MD 4U7AA 2H14A 5IC7A 3SN6B 5H1MA 2UZXB 5EARA 2B5MA 3BWSA 4J86A 3EI2A 1A0RB 3SLED 2H6NA 4FA4D 4QT8A 2I0TA 2H47A 4GM3A 3RLMD 3MZLA 4L9OA 3I7LA 2P9LC 5CXCB 4ERYA 2IWKA 2XYIA 3IJ1A 3ORVD 3PXSD 3EI2B 3OTTA 1GOTB 2CO0A 3V5WB 3SVWD 5A2Qg 1RI6A 4EWRA 2HJBA 5FQDA 4A09B 4FA1D 2HESX 2PM9B 5I5IA 4Y5RD 3EWEA 3L4OD 4FAND 4J0XA 3UKRC 5TEFA 2OIZA 4Z8LA 5EMLB 2G99A 4D0KA 1XIPA 5FLXg 3SBPA 4D6VA 2AH1A 4GM9A 2TRCB 2MTAH 1Q47A 3EU7A 2IAAA 4E54A 4GGAA 2W18A 3EI3A 3N0EA 5AJAA 4J87A 3F3PA 4PSXB 4CZXA 4FAVD 5THAA 4I79A 2H6KA 2AQ5A 4A2LA 5GMKn 4ZOVA 4BUJC 2HKMA 5JWZA 3K27A 5HYNB 1TYQC 3PSLA 2AGZA 2J57G 3BG0A 3MKSB 4E54B 2I0SA 2HYEA 3EI3B 3I89A 4TZ4A 3SXTD 1TBGA 3I7OA 3MXXA 4CC9A 4CI3A 1PEVA 4K3JB 4LG9A 4A0BB 3EG6A 3J80g 3AL9A 4QL1A
chains in the Genus database with same CATH superfamily
3MUNA 2VC2A 3ZE1A 5EALA 4DNVA 2OVPB 2VDNA 2QR5A 1FWXA 3IJEA 1NR0A 1SQJA 1GP2B 4LGNA 5CXBB 3PXTD 2BBKH 5C86A 1TYEA 4MMXA 3ZDZA 4KFMB 3MKQA 4CY2A 4FA5D 4PSWB 3ZE0A 1QFMA 2JKXA 1PGUA 4GGCA 3ZDXA 1GXRA 2CE9A 2I3SA 3NIGA 2B5NA 4JT5C 2Z2NA 4AN0A 3K26A 2OK6A 4G1MA 4AOWA 5H14A 2YMUA 2QC5A 1JTDB 4CI8A 1N6FA 1L5GA 3SMRA 4JT6C 3VI3A 3KRWB 5HE3B 3N0DA 3O4GA 3SJLD 5C2WB 1QNIA 4NBMA 5SXMA 4ERZA 4BCBA 2VDOA 3IVMA 1N6EA 2OVQB 4PBYA 5FKTA 3EI4A 4AN1A 5EM2A 1I2MB 3FCUA 3F3GA 2AGYA 2H9PA 5HE2B 4CI1A 2CO0C 1GOGA 4WK2A 4A11A 4FHLA 1S4UX 3RFGA 3SHFA 4L3HD 4A0AB 5M5RA 2Q7QA 2QXVA 4PBZA 4ZOYA 3JAMg 1U4CA 5M5VA 4WK0A 2AGXA 1ERJA 4CI2A 4J82A 5EM2B 4J73A 4ZOZA 4IRZA 3V4PA 2IUVA 3NIFA 3RN0D 2P9KC 2H9MA 4JSVC 5IJ8E 3OL2A 1VYHC 3PSCB 2H3XA 4A11B 3FRXA 3C5MA 3O4HA 2Z2OA 3EQ9A 2IURA 5M61A 2AGLA 3A0FA 4GGDA 2CNXA 3SBQA 4QAMA 3VH0A 2XDWA 4CZYA 4AMZA 2H6QA 1OMWB 3UKUC 4NC4A 3K71A 4GZ8A 5FKQA 4XEIC 2XZGA 5TEEA 1O6FA 4JSXC 1C9LA 3AL8A 3T3PA 5GXHA 2J55H 4J84A 2HJ4A 3AH8B 4X61B 3RN1D 3I7NA 4XYIA 2EBSA 4YVDA 5K19A 4A08A 4X60B 2HU5A 3GFCA 4O45A 4A2MA 3FGBA 3EMHA 4OWRA 2HKRA 4Z7OA 5B4WA 3V7DB 4J77A 3DSMA 5EMMB 4PNKB 3VGZA 2IUQA 3UVLA 2H9LA 3JZHA 2YBAA 5EAMA 2YNPA 3SWSD 4FWWA 2HU7A 3IIYA 3KCIA 5AFU3 3O4IA 3C9CA 1B9XA 4BCCA 2CE8A 1UOQA 3W15A 3NVXA 2AH0A 1N6DA 3F3FA 3MMYA 1B9YA 2YNNA 4CY3A 4O2WA 3MUOA 5C9ZB 4L1MA 1H2WA 4IA9A 4NSXA 2VDQA 1U2VC 3RMZD 3UVOA 1UOPA 1K32A 4H5IA 5FA5B 2OJYA 2H13A 1MG3A 5TDHB 3DWLC 1H2XA 2HU8A 3UR4A 4H5JA 4BL0A 5M5TA 5FKSA 3I7KA 4R7AB 1E5TA 3DM0A 4A7JA 5I5JA 1E8NA 2UZYB 4J78A 2XL3A 1JMZB 1SHYB 5E6RA 3FCSA 1GG2B 3KRXB 2G9AA 2YNOA 4Z7QA 2P9NC 3E0CA 2I3TA 2PBIB 4FB1D 3RSEC 5IGOA 4X3EA 4BP9A 4JHNA 2O9KA 2IWFA 2PM6B 4O1QD 4O9DA 3NVNA 4RE6A 3OKYA 2BCJB 4WJKA 2P9SC 3JPXA 4AX4A 2PM7B 2B4EA 3I7HA 5CYKA 3P4FA 3EI4B 3RFHA 4MK0B 1GOHA 2EICA 1MG2A 4CY5A 3B7FA 3DXMC 4JSNC 5M5UA 2QZPA 4J8GA 2CN2A 1L0QA 3CFSB 5CXCA 3EI1A 4AMYA 1JJUB 1O6GA 3OKYB 4X63B 4QRJA 3NVQA 5CYKB 3VI4A 4J79A 5FKRA 4J0WA 1MDAH 4J8BA 3SBRA 2WQ8A 1E8MA 3I8CA 3JRPA 4GQ2P 2IUPA 2P9IC 4A09A 2B5LA 2PM9A 2EIDA 3OL2B 5IT9g 2HXCA 4D9SA 4DNUA 4BH6A 4U1EI 2OVRB 3V9FA 3U4YA 3EI1B 5IGQA 3MVDK 3JB9L 3MZKA 3I8EA 3K72A 4DNWA 4JXMA 1R5MA 3CIKB 3DXKC 5I5MA 1VZ3A 4LG8A 2J56H 4J81A 4MMZA 3IURA 4XYHA 1P22A 2H68A 5HE1B 4QQEA 4GQBB 3AFCA 4NENA 5KDOB 5TF2A 3FM0A 1M1XA 4ZN4A 3SFZA 3C75H 4K3ID 4FA9D 5C2VB 1XKSA 3IKOA 1PBYB 2VZ3A 3AL8B 3GREA 5AMSA 3ULEC 3JZNA 4WK4A 4HDJA 2YB8B 5HQGA 2H9NA 3IIWA 3QI0A 3SCYA 5FFGA 4N14A 4L1QD 3OF7A 4A08B 2XU7A 1PI6A 5EAPA 4PC0A 4GM8A 3RRMC 1JOFA 2VDRA 1K8KC 2GC4A 2P9PC 2P9UC 3CFVA 2XE4A 4OZUA 4A0BA 4ES0A 5IJ7E 4O3UB 4Y7RA 3I7PA 5HDBA 5FFOA 2CN3A 4PXWA 3UVMA 3IUMA 3EQ7A 4O3TB 2VZ1A 3GD1I 2VDMA 1BPOA 4E5ZA 3NIDA 4JSPC 2AGWA 2EIEA 3C99A 3VA6A 3PE7A 3IULA 4JD2C 1NEXB 5CXBA 4BCDA 3BG1A 4CZVA 3ZDYA 4GQ1A 4GMBA 3PXWD 4ESGA 1YFQA 1XHMA 3HFQA 3K6SA 4UI9R 5H17A 3IJCA 4E5ZB 3QHYB 3I2NA 3OKWA 3UVNA 4ERQA 5FXYA 3PVUB 4ZOXA 5EMKB 3UVKA 1JMXB 4G56B 5K1CC 2GC7A 4RE5A 3O4JA 2OK4A 3ODTA 4CY1A 3ZWLB 2VDPA 2Z2PA 1YR2A 5GXIA 2I0RA 3JROA 3OKTA 5GSAA 3IUJA 3IUQA 1OLZA 1H2ZA 1SQ9A 2BKLA 3JZGA 4UM9A 4AEZA 5HE0B 5EMJB 2GNQA 2XL2A 4IMMA 4A0AA 3IJ0A 3PVWB 4L3GD 3J81g 3OW8A 3V4VA 3L4MD 4Z7NA 4U7AA 2H14A 5IC7A 3SN6B 5H1MA 2UZXB 3IUNA 5EARA 2B5MA 5C92A 3BWSA 4J86A 3EI2A 1A0RB 4MMYA 3SLED 2H6NA 4FA4D 4QT8A 2I0TA 2H47A 4GM3A 4O02A 3RLMD 1C9IA 1U8CA 4JHPC 3MZLA 4L9OA 3I7LA 2P9LC 5CXCB 4ERYA 2IWKA 2XYIA 3IJ1A 2VDLA 3ORVD 3PXSD 3EI2B 3OTTA 1GOTB 2CO0A 5M5SA 3V5WB 3SVWD 5A2Qg 1RI6A 2EIBA 4BP8A 4EWRA 2HJBA 4NAAA 5FQDA 4A09B 4FA1D 2HESX 2PM9B 5I5IA 4Y5RD 3EWEA 1JV2A 3L4OD 4FAND 4J0XA 1UTCA 3UKRC 5TEFA 2OIZA 4Z8LA 5EMLB 2G99A 4D0KA 4G55A 1XIPA 4UM8A 3T3MA 5FLXg 3SBPA 4G1EA 3GC3B 3EQ8A 4D6VA 2AH1A 4GM9A 2TRCB 3ZE2A 2MTAH 1Q47A 3EU7A 2IAAA 4E54A 4GGAA 2W18A 3EI3A 3N0EA 5AJAA 4J87A 3F3PA 4PSXB 1K3IA 4CZXA 4FAVD 5THAA 2VDKA 4I79A 2H6KA 2AQ5A 1VZ2A 4A2LA 3DDUA 5GMKn 4ZOVA 4BUJC 2HKMA 5JWZA 3K27A 5HYNB 1TYQC 3PSLA 1GOFA 2AGZA 2J57G 3BG0A 1A12A 3MKSB 5E6UA 4E54B 2I0SA 2HYEA 1H2YA 3EI3B 3I89A 4TZ4A 3SXTD 1TBGA 3I7OA 3MXXA 4CC9A 5E6SA 4CI3A 1PEVA 4K3JB 4LG9A 4A0BB 1QFSA 1UOOA 1VE7A 3EG6A 1VE6A 3J80g 3AL9A 1T2XA 4QL1A
chains in the Genus database with same CATH topology
5EALA 2OVPB 1FWXA 1NR0A 1SQJA 1GP2B 4LGNA 5CXBB 3PXTD 2BBKH 4FA5D 4KFMB 3MKQA 4CY2A 4PSWB 4GGCA 1PGUA 1GXRA 2CE9A 2I3SA 2B5NA 4JT5C 2Z2NA 3K26A 2OK6A 4AOWA 5H14A 2YMUA 2QC5A 4CI8A 1N6FA 3SMRA 4JT6C 3KRWB 5HE3B 3N0DA 3SJLD 5C2WB 1QNIA 5SXMA 4ERZA 1N6EA 2OVQB 4PBYA 5FKTA 3EI4A 5EM2A 3F3GA 2AGYA 2H9PA 5HE2B 4CI1A 2CO0C 4A11A 4FHLA 1S4UX 3RFGA 3SHFA 4L3HD 4A0AB 2Q7QA 2QXVA 4PBZA 4ZOYA 3JAMg 1U4CA 4CI2A 2AGXA 1ERJA 4J82A 5EM2B 4J73A 4ZOZA 2IUVA 3RN0D 4JSVC 2P9KC 2H9MA 5IJ8E 3OL2A 1VYHC 3PSCB 2H3XA 4A11B 3FRXA 3C5MA 2Z2OA 2IURA 2AGLA 3A0FA 4GGDA 2CNXA 3SBQA 3VH0A 4CZYA 2H6QA 1OMWB 3UKUC 4GZ8A 5FKQA 4XEIC 5TEEA 4JSXC 3AL8A 5GXHA 2J55H 4J84A 2HJ4A 3AH8B 4X61B 3RN1D 3I7NA 4XYIA 2EBSA 4YVDA 5K19A 4A08A 4X60B 4O45A 3GFCA 4A2MA 3FGBA 3EMHA 4OWRA 2HKRA 5B4WA 3V7DB 4J77A 3DSMA 5EMMB 4PNKB 3VGZA 2IUQA 3UVLA 2H9LA 3JZHA 2YBAA 5EAMA 2YNPA 3SWSD 4FWWA 3IIYA 5AFU3 3C9CA 1B9XA 2CE8A 3W15A 3NVXA 2AH0A 1N6DA 3F3FA 3MMYA 1B9YA 2YNNA 4CY3A 5C9ZB 4IA9A 4NSXA 1U2VC 3RMZD 3UVOA 1K32A 4H5IA 5FA5B 2OJYA 2H13A 1MG3A 5TDHB 3DWLC 3UR4A 4H5JA 4BL0A 5FKSA 3I7KA 4R7AB 3DM0A 4A7JA 5I5JA 2UZYB 4J78A 2XL3A 1JMZB 1SHYB 1GG2B 3KRXB 2G9AA 2YNOA 2P9NC 3E0CA 2I3TA 2PBIB 4FB1D 3RSEC 5IGOA 4X3EA 2O9KA 2IWFA 2PM6B 4O1QD 4O9DA 3NVNA 3OKYA 2BCJB 2P9SC 3JPXA 2PM7B 2B4EA 3I7HA 5CYKA 3P4FA 3EI4B 3RFHA 4MK0B 1MG2A 4CY5A 3B7FA 3DXMC 4JSNC 4J8GA 2CN2A 1L0QA 3CFSB 5CXCA 3EI1A 1JJUB 4X63B 3OKYB 4QRJA 3NVQA 5CYKB 4J79A 5FKRA 4J0WA 1MDAH 4J8BA 3SBRA 3I8CA 3JRPA 4GQ2P 2IUPA 2P9IC 4A09A 2B5LA 2PM9A 3OL2B 5IT9g 2HXCA 4BH6A 4U1EI 2OVRB 3V9FA 3U4YA 3EI1B 5IGQA 3JB9L 3MZKA 3I8EA 4JXMA 1R5MA 3CIKB 3DXKC 5I5MA 4LG8A 2J56H 4J81A 4XYHA 1P22A 2H68A 5HE1B 4QQEA 4GQBB 3AFCA 5KDOB 5TF2A 3FM0A 4ZN4A 3SFZA 3C75H 4K3ID 4FA9D 5C2VB 1XKSA 3IKOA 1PBYB 3AL8B 3GREA 5AMSA 3ULEC 3JZNA 4HDJA 2YB8B 5HQGA 2H9NA 3IIWA 3SCYA 4N14A 4L1QD 4A08B 2XU7A 1PI6A 5EAPA 4PC0A 4GM8A 3RRMC 1JOFA 1K8KC 2GC4A 2P9PC 2P9UC 3CFVA 4A0BA 4OZUA 4ES0A 5IJ7E 4O3UB 4Y7RA 3I7PA 2CN3A 4PXWA 3UVMA 4O3TB 4E5ZA 4JSPC 2AGWA 3C99A 3VA6A 3PE7A 4JD2C 1NEXB 5CXBA 3BG1A 4CZVA 4GQ1A 4GMBA 3PXWD 4ESGA 1YFQA 1XHMA 3HFQA 4UI9R 5H17A 3IJCA 4E5ZB 3I2NA 3OKWA 3UVNA 4ERQA 5FXYA 3PVUB 4ZOXA 5EMKB 3UVKA 1JMXB 4G56B 5K1CC 2GC7A 2OK4A 3ODTA 4CY1A 3ZWLB 2Z2PA 5GXIA 2I0RA 3JROA 3OKTA 5GSAA 1OLZA 1SQ9A 3JZGA 4AEZA 5HE0B 5EMJB 2GNQA 2XL2A 4IMMA 4A0AA 3IJ0A 3PVWB 4L3GD 3J81g 3OW8A 3L4MD 4U7AA 2H14A 5IC7A 3SN6B 5H1MA 2UZXB 5EARA 2B5MA 3BWSA 4J86A 3EI2A 1A0RB 3SLED 2H6NA 4FA4D 4QT8A 2I0TA 2H47A 4GM3A 3RLMD 3MZLA 4L9OA 3I7LA 2P9LC 5CXCB 4ERYA 2IWKA 2XYIA 3IJ1A 3ORVD 3PXSD 3EI2B 3OTTA 1GOTB 2CO0A 3V5WB 3SVWD 5A2Qg 1RI6A 4EWRA 2HJBA 5FQDA 4A09B 4FA1D 2HESX 2PM9B 5I5IA 4Y5RD 3EWEA 3L4OD 4FAND 4J0XA 3UKRC 5TEFA 2OIZA 4Z8LA 5EMLB 2G99A 4D0KA 1XIPA 5FLXg 3SBPA 4D6VA 2AH1A 4GM9A 2TRCB 2MTAH 1Q47A 3EU7A 2IAAA 4E54A 4GGAA 2W18A 3EI3A 3N0EA 5AJAA 4J87A 3F3PA 4PSXB 4CZXA 4FAVD 5THAA 4I79A 2H6KA 2AQ5A 4A2LA 5GMKn 4ZOVA 4BUJC 2HKMA 5JWZA 3K27A 5HYNB 1TYQC 3PSLA 2AGZA 2J57G 3BG0A 3MKSB 4E54B 2I0SA 2HYEA 3EI3B 3I89A 4TZ4A 3SXTD 1TBGA 3I7OA 3MXXA 4CC9A 4CI3A 1PEVA 4K3JB 4LG9A 4A0BB 3EG6A 3J80g 3AL9A 4QL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EAL A;  2OVP B;  1FWX A;  1NR0 A;  1SQJ A;  1GP2 B;  4LGN A;  5CXB B;  3PXT D;  2BBK H;  4FA5 D;  4KFM B;  3MKQ A;  4CY2 A;  4PSW B;  4GGC A;  1PGU A;  1GXR A;  2CE9 A;  2I3S A;  2B5N A;  4JT5 C;  2Z2N A;  3K26 A;  2OK6 A;  4AOW A;  5H14 A;  2YMU A;  2QC5 A;  4CI8 A;  1N6F A;  3SMR A;  4JT6 C;  3KRW B;  5HE3 B;  3N0D A;  3SJL D;  5C2W B;  1QNI A;  5SXM A;  4ERZ A;  1N6E A;  2OVQ B;  4PBY A;  5FKT A;  3EI4 A;  5EM2 A;  3F3G A;  2AGY A;  2H9P A;  5HE2 B;  4CI1 A;  2CO0 C;  4A11 A;  4FHL A;  1S4U X;  3RFG A;  3SHF A;  4L3H D;  4A0A B;  2Q7Q A;  2QXV A;  4PBZ A;  4ZOY A;  3JAM g;  1U4C A;  4CI2 A;  2AGX A;  1ERJ A;  4J82 A;  5EM2 B;  4J73 A;  4ZOZ A;  2IUV A;  3RN0 D;  4JSV C;  2P9K C;  2H9M A;  5IJ8 E;  3OL2 A;  1VYH C;  3PSC B;  2H3X A;  4A11 B;  3FRX A;  3C5M A;  2Z2O A;  2IUR A;  2AGL A;  3A0F A;  4GGD A;  2CNX A;  3SBQ A;  3VH0 A;  4CZY A;  2H6Q A;  1OMW B;  3UKU C;  4GZ8 A;  5FKQ A;  4XEI C;  5TEE A;  4JSX C;  3AL8 A;  5GXH A;  2J55 H;  4J84 A;  2HJ4 A;  3AH8 B;  4X61 B;  3RN1 D;  3I7N A;  4XYI A;  2EBS A;  4YVD A;  5K19 A;  4A08 A;  4X60 B;  4O45 A;  3GFC A;  4A2M A;  3FGB A;  3EMH A;  4OWR A;  2HKR A;  5B4W A;  3V7D B;  4J77 A;  3DSM A;  5EMM B;  4PNK B;  3VGZ A;  2IUQ A;  3UVL A;  2H9L A;  3JZH A;  2YBA A;  5EAM A;  2YNP A;  3SWS D;  4FWW A;  3IIY A;  5AFU 3;  3C9C A;  1B9X A;  2CE8 A;  3W15 A;  3NVX A;  2AH0 A;  1N6D A;  3F3F A;  3MMY A;  1B9Y A;  2YNN A;  4CY3 A;  5C9Z B;  4IA9 A;  4NSX A;  1U2V C;  3RMZ D;  3UVO A;  1K32 A;  4H5I A;  5FA5 B;  2OJY A;  2H13 A;  1MG3 A;  5TDH B;  3DWL C;  3UR4 A;  4H5J A;  4BL0 A;  5FKS A;  3I7K A;  4R7A B;  3DM0 A;  4A7J A;  5I5J A;  2UZY B;  4J78 A;  2XL3 A;  1JMZ B;  1SHY B;  1GG2 B;  3KRX B;  2G9A A;  2YNO A;  2P9N C;  3E0C A;  2I3T A;  2PBI B;  4FB1 D;  3RSE C;  5IGO A;  4X3E A;  2O9K A;  2IWF A;  2PM6 B;  4O1Q D;  4O9D A;  3NVN A;  3OKY A;  2BCJ B;  2P9S C;  3JPX A;  2PM7 B;  2B4E A;  3I7H A;  5CYK A;  3P4F A;  3EI4 B;  3RFH A;  4MK0 B;  1MG2 A;  4CY5 A;  3B7F A;  3DXM C;  4JSN C;  4J8G A;  2CN2 A;  1L0Q A;  3CFS B;  5CXC A;  3EI1 A;  1JJU B;  4X63 B;  3OKY B;  4QRJ A;  3NVQ A;  5CYK B;  4J79 A;  5FKR A;  4J0W A;  1MDA H;  4J8B A;  3SBR A;  3I8C A;  3JRP A;  4GQ2 P;  2IUP A;  2P9I C;  4A09 A;  2B5L A;  2PM9 A;  3OL2 B;  5IT9 g;  2HXC A;  4BH6 A;  4U1E I;  2OVR B;  3V9F A;  3U4Y A;  3EI1 B;  5IGQ A;  3JB9 L;  3MZK A;  3I8E A;  4JXM A;  1R5M A;  3CIK B;  3DXK C;  5I5M A;  4LG8 A;  2J56 H;  4J81 A;  4XYH A;  1P22 A;  2H68 A;  5HE1 B;  4QQE A;  4GQB B;  3AFC A;  5KDO B;  5TF2 A;  3FM0 A;  4ZN4 A;  3SFZ A;  3C75 H;  4K3I D;  4FA9 D;  5C2V B;  1XKS A;  3IKO A;  1PBY B;  3AL8 B;  3GRE A;  5AMS A;  3ULE C;  3JZN A;  4HDJ A;  2YB8 B;  5HQG A;  2H9N A;  3IIW A;  3SCY A;  4N14 A;  4L1Q D;  4A08 B;  2XU7 A;  1PI6 A;  5EAP A;  4PC0 A;  4GM8 A;  3RRM C;  1JOF A;  1K8K C;  2GC4 A;  2P9P C;  2P9U C;  3CFV A;  4A0B A;  4OZU A;  4ES0 A;  5IJ7 E;  4O3U B;  4Y7R A;  3I7P A;  2CN3 A;  4PXW A;  3UVM A;  4O3T B;  4E5Z A;  4JSP C;  2AGW A;  3C99 A;  3VA6 A;  3PE7 A;  4JD2 C;  1NEX B;  5CXB A;  3BG1 A;  4CZV A;  4GQ1 A;  4GMB A;  3PXW D;  4ESG A;  1YFQ A;  1XHM A;  3HFQ A;  4UI9 R;  5H17 A;  3IJC A;  4E5Z B;  3I2N A;  3OKW A;  3UVN A;  4ERQ A;  5FXY A;  3PVU B;  4ZOX A;  5EMK B;  3UVK A;  1JMX B;  4G56 B;  5K1C C;  2GC7 A;  2OK4 A;  3ODT A;  4CY1 A;  3ZWL B;  2Z2P A;  5GXI A;  2I0R A;  3JRO A;  3OKT A;  5GSA A;  1OLZ A;  1SQ9 A;  3JZG A;  4AEZ A;  5HE0 B;  5EMJ B;  2GNQ A;  2XL2 A;  4IMM A;  4A0A A;  3IJ0 A;  3PVW B;  4L3G D;  3J81 g;  3OW8 A;  3L4M D;  4U7A A;  2H14 A;  5IC7 A;  3SN6 B;  5H1M A;  2UZX B;  5EAR A;  2B5M A;  3BWS A;  4J86 A;  3EI2 A;  1A0R B;  3SLE D;  2H6N A;  4FA4 D;  4QT8 A;  2I0T A;  2H47 A;  4GM3 A;  3RLM D;  3MZL A;  4L9O A;  3I7L A;  2P9L C;  5CXC B;  4ERY A;  2IWK A;  2XYI A;  3IJ1 A;  3ORV D;  3PXS D;  3EI2 B;  3OTT A;  1GOT B;  2CO0 A;  3V5W B;  3SVW D;  5A2Q g;  1RI6 A;  4EWR A;  2HJB A;  5FQD A;  4A09 B;  4FA1 D;  2HES X;  2PM9 B;  5I5I A;  4Y5R D;  3EWE A;  3L4O D;  4FAN D;  4J0X A;  3UKR C;  5TEF A;  2OIZ A;  4Z8L A;  5EML B;  2G99 A;  4D0K A;  1XIP A;  5FLX g;  3SBP A;  4D6V A;  2AH1 A;  4GM9 A;  2TRC B;  2MTA H;  1Q47 A;  3EU7 A;  2IAA A;  4E54 A;  4GGA A;  2W18 A;  3EI3 A;  3N0E A;  5AJA A;  4J87 A;  3F3P A;  4PSX B;  4CZX A;  4FAV D;  5THA A;  4I79 A;  2H6K A;  2AQ5 A;  4A2L A;  5GMK n;  4ZOV A;  4BUJ C;  2HKM A;  5JWZ A;  3K27 A;  5HYN B;  1TYQ C;  3PSL A;  2AGZ A;  2J57 G;  3BG0 A;  3MKS B;  4E54 B;  2I0S A;  2HYE A;  3EI3 B;  3I89 A;  4TZ4 A;  3SXT D;  1TBG A;  3I7O A;  3MXX A;  4CC9 A;  4CI3 A;  1PEV A;  4K3J B;  4LG9 A;  4A0B B;  3EG6 A;  3J80 g;  3AL9 A;  4QL1 A; 
#chains in the Genus database with same CATH topology
 3MUN A;  2VC2 A;  3ZE1 A;  5EAL A;  4DNV A;  2OVP B;  2VDN A;  2QR5 A;  1FWX A;  3IJE A;  1NR0 A;  1SQJ A;  1GP2 B;  4LGN A;  5CXB B;  3PXT D;  2BBK H;  5C86 A;  1TYE A;  4MMX A;  3ZDZ A;  4KFM B;  3MKQ A;  4CY2 A;  4FA5 D;  4PSW B;  3ZE0 A;  1QFM A;  2JKX A;  1PGU A;  4GGC A;  3ZDX A;  1GXR A;  2CE9 A;  2I3S A;  3NIG A;  2B5N A;  4JT5 C;  2Z2N A;  4AN0 A;  3K26 A;  2OK6 A;  4G1M A;  4AOW A;  5H14 A;  2YMU A;  2QC5 A;  1JTD B;  4CI8 A;  1N6F A;  1L5G A;  3SMR A;  4JT6 C;  3VI3 A;  3KRW B;  5HE3 B;  3N0D A;  3O4G A;  3SJL D;  5C2W B;  1QNI A;  4NBM A;  5SXM A;  4ERZ A;  4BCB A;  2VDO A;  3IVM A;  1N6E A;  2OVQ B;  4PBY A;  5FKT A;  3EI4 A;  4AN1 A;  5EM2 A;  1I2M B;  3FCU A;  3F3G A;  2AGY A;  2H9P A;  5HE2 B;  4CI1 A;  2CO0 C;  1GOG A;  4WK2 A;  4A11 A;  4FHL A;  1S4U X;  3RFG A;  3SHF A;  4L3H D;  4A0A B;  5M5R A;  2Q7Q A;  2QXV A;  4PBZ A;  4ZOY A;  3JAM g;  1U4C A;  5M5V A;  4WK0 A;  2AGX A;  1ERJ A;  4CI2 A;  4J82 A;  5EM2 B;  4J73 A;  4ZOZ A;  4IRZ A;  3V4P A;  2IUV A;  3NIF A;  3RN0 D;  2P9K C;  2H9M A;  4JSV C;  5IJ8 E;  3OL2 A;  1VYH C;  3PSC B;  2H3X A;  4A11 B;  3FRX A;  3C5M A;  3O4H A;  2Z2O A;  3EQ9 A;  2IUR A;  5M61 A;  2AGL A;  3A0F A;  4GGD A;  2CNX A;  3SBQ A;  4QAM A;  3VH0 A;  2XDW A;  4CZY A;  4AMZ A;  2H6Q A;  1OMW B;  3UKU C;  4NC4 A;  3K71 A;  4GZ8 A;  5FKQ A;  4XEI C;  2XZG A;  5TEE A;  1O6F A;  4JSX C;  1C9L A;  3AL8 A;  3T3P A;  5GXH A;  2J55 H;  4J84 A;  2HJ4 A;  3AH8 B;  4X61 B;  3RN1 D;  3I7N A;  4XYI A;  2EBS A;  4YVD A;  5K19 A;  4A08 A;  4X60 B;  2HU5 A;  3GFC A;  4O45 A;  4A2M A;  3FGB A;  3EMH A;  4OWR A;  2HKR A;  4Z7O A;  5B4W A;  3V7D B;  4J77 A;  3DSM A;  5EMM B;  4PNK B;  3VGZ A;  2IUQ A;  3UVL A;  2H9L A;  3JZH A;  2YBA A;  5EAM A;  2YNP A;  3SWS D;  4FWW A;  2HU7 A;  3IIY A;  3KCI A;  5AFU 3;  3O4I A;  3C9C A;  1B9X A;  4BCC A;  2CE8 A;  1UOQ A;  3W15 A;  3NVX A;  2AH0 A;  1N6D A;  3F3F A;  3MMY A;  1B9Y A;  2YNN A;  4CY3 A;  4O2W A;  3MUO A;  5C9Z B;  4L1M A;  1H2W A;  4IA9 A;  4NSX A;  2VDQ A;  1U2V C;  3RMZ D;  3UVO A;  1UOP A;  1K32 A;  4H5I A;  5FA5 B;  2OJY A;  2H13 A;  1MG3 A;  5TDH B;  3DWL C;  1H2X A;  2HU8 A;  3UR4 A;  4H5J A;  4BL0 A;  5M5T A;  5FKS A;  3I7K A;  4R7A B;  1E5T A;  3DM0 A;  4A7J A;  5I5J A;  1E8N A;  2UZY B;  4J78 A;  2XL3 A;  1JMZ B;  1SHY B;  5E6R A;  3FCS A;  1GG2 B;  3KRX B;  2G9A A;  2YNO A;  4Z7Q A;  2P9N C;  3E0C A;  2I3T A;  2PBI B;  4FB1 D;  3RSE C;  5IGO A;  4X3E A;  4BP9 A;  4JHN A;  2O9K A;  2IWF A;  2PM6 B;  4O1Q D;  4O9D A;  3NVN A;  4RE6 A;  3OKY A;  2BCJ B;  4WJK A;  2P9S C;  3JPX A;  4AX4 A;  2PM7 B;  2B4E A;  3I7H A;  5CYK A;  3P4F A;  3EI4 B;  3RFH A;  4MK0 B;  1GOH A;  2EIC A;  1MG2 A;  4CY5 A;  3B7F A;  3DXM C;  4JSN C;  5M5U A;  2QZP A;  4J8G A;  2CN2 A;  1L0Q A;  3CFS B;  5CXC A;  3EI1 A;  4AMY A;  1JJU B;  1O6G A;  3OKY B;  4X63 B;  4QRJ A;  3NVQ A;  5CYK B;  3VI4 A;  4J79 A;  5FKR A;  4J0W A;  1MDA H;  4J8B A;  3SBR A;  2WQ8 A;  1E8M A;  3I8C A;  3JRP A;  4GQ2 P;  2IUP A;  2P9I C;  4A09 A;  2B5L A;  2PM9 A;  2EID A;  3OL2 B;  5IT9 g;  2HXC A;  4D9S A;  4DNU A;  4BH6 A;  4U1E I;  2OVR B;  3V9F A;  3U4Y A;  3EI1 B;  5IGQ A;  3MVD K;  3JB9 L;  3MZK A;  3I8E A;  3K72 A;  4DNW A;  4JXM A;  1R5M A;  3CIK B;  3DXK C;  5I5M A;  1VZ3 A;  4LG8 A;  2J56 H;  4J81 A;  4MMZ A;  3IUR A;  4XYH A;  1P22 A;  2H68 A;  5HE1 B;  4QQE A;  4GQB B;  3AFC A;  4NEN A;  5KDO B;  5TF2 A;  3FM0 A;  1M1X A;  4ZN4 A;  3SFZ A;  3C75 H;  4K3I D;  4FA9 D;  5C2V B;  1XKS A;  3IKO A;  1PBY B;  2VZ3 A;  3AL8 B;  3GRE A;  5AMS A;  3ULE C;  3JZN A;  4WK4 A;  4HDJ A;  2YB8 B;  5HQG A;  2H9N A;  3IIW A;  3QI0 A;  3SCY A;  5FFG A;  4N14 A;  4L1Q D;  3OF7 A;  4A08 B;  2XU7 A;  1PI6 A;  5EAP A;  4PC0 A;  4GM8 A;  3RRM C;  1JOF A;  2VDR A;  1K8K C;  2GC4 A;  2P9P C;  2P9U C;  3CFV A;  2XE4 A;  4OZU A;  4A0B A;  4ES0 A;  5IJ7 E;  4O3U B;  4Y7R A;  3I7P A;  5HDB A;  5FFO A;  2CN3 A;  4PXW A;  3UVM A;  3IUM A;  3EQ7 A;  4O3T B;  2VZ1 A;  3GD1 I;  2VDM A;  1BPO A;  4E5Z A;  3NID A;  4JSP C;  2AGW A;  2EIE A;  3C99 A;  3VA6 A;  3PE7 A;  3IUL A;  4JD2 C;  1NEX B;  5CXB A;  4BCD A;  3BG1 A;  4CZV A;  3ZDY A;  4GQ1 A;  4GMB A;  3PXW D;  4ESG A;  1YFQ A;  1XHM A;  3HFQ A;  3K6S A;  4UI9 R;  5H17 A;  3IJC A;  4E5Z B;  3QHY B;  3I2N A;  3OKW A;  3UVN A;  4ERQ A;  5FXY A;  3PVU B;  4ZOX A;  5EMK B;  3UVK A;  1JMX B;  4G56 B;  5K1C C;  2GC7 A;  4RE5 A;  3O4J A;  2OK4 A;  3ODT A;  4CY1 A;  3ZWL B;  2VDP A;  2Z2P A;  1YR2 A;  5GXI A;  2I0R A;  3JRO A;  3OKT A;  5GSA A;  3IUJ A;  3IUQ A;  1OLZ A;  1H2Z A;  1SQ9 A;  2BKL A;  3JZG A;  4UM9 A;  4AEZ A;  5HE0 B;  5EMJ B;  2GNQ A;  2XL2 A;  4IMM A;  4A0A A;  3IJ0 A;  3PVW B;  4L3G D;  3J81 g;  3OW8 A;  3V4V A;  3L4M D;  4Z7N A;  4U7A A;  2H14 A;  5IC7 A;  3SN6 B;  5H1M A;  2UZX B;  3IUN A;  5EAR A;  2B5M A;  5C92 A;  3BWS A;  4J86 A;  3EI2 A;  1A0R B;  4MMY A;  3SLE D;  2H6N A;  4FA4 D;  4QT8 A;  2I0T A;  2H47 A;  4GM3 A;  4O02 A;  3RLM D;  1C9I A;  1U8C A;  4JHP C;  3MZL A;  4L9O A;  3I7L A;  2P9L C;  5CXC B;  4ERY A;  2IWK A;  2XYI A;  3IJ1 A;  2VDL A;  3ORV D;  3PXS D;  3EI2 B;  3OTT A;  1GOT B;  2CO0 A;  5M5S A;  3V5W B;  3SVW D;  5A2Q g;  1RI6 A;  2EIB A;  4BP8 A;  4EWR A;  2HJB A;  4NAA A;  5FQD A;  4A09 B;  4FA1 D;  2HES X;  2PM9 B;  5I5I A;  4Y5R D;  3EWE A;  1JV2 A;  3L4O D;  4FAN D;  4J0X A;  1UTC A;  3UKR C;  5TEF A;  2OIZ A;  4Z8L A;  5EML B;  2G99 A;  4D0K A;  4G55 A;  1XIP A;  4UM8 A;  3T3M A;  5FLX g;  3SBP A;  4G1E A;  3GC3 B;  3EQ8 A;  4D6V A;  2AH1 A;  4GM9 A;  2TRC B;  3ZE2 A;  2MTA H;  1Q47 A;  3EU7 A;  2IAA A;  4E54 A;  4GGA A;  2W18 A;  3EI3 A;  3N0E A;  5AJA A;  4J87 A;  3F3P A;  4PSX B;  1K3I A;  4CZX A;  4FAV D;  5THA A;  2VDK A;  4I79 A;  2H6K A;  2AQ5 A;  1VZ2 A;  4A2L A;  3DDU A;  5GMK n;  4ZOV A;  4BUJ C;  2HKM A;  5JWZ A;  3K27 A;  5HYN B;  1TYQ C;  3PSL A;  1GOF A;  2AGZ A;  2J57 G;  3BG0 A;  1A12 A;  3MKS B;  5E6U A;  4E54 B;  2I0S A;  2HYE A;  1H2Y A;  3EI3 B;  3I89 A;  4TZ4 A;  3SXT D;  1TBG A;  3I7O A;  3MXX A;  4CC9 A;  5E6S A;  4CI3 A;  1PEV A;  4K3J B;  4LG9 A;  4A0B B;  1QFS A;  1UOO A;  1VE7 A;  3EG6 A;  1VE6 A;  3J80 g;  3AL9 A;  1T2X A;  4QL1 A; 
#chains in the Genus database with same CATH homology
 5EAL A;  2OVP B;  1FWX A;  1NR0 A;  1SQJ A;  1GP2 B;  4LGN A;  5CXB B;  3PXT D;  2BBK H;  4FA5 D;  4KFM B;  3MKQ A;  4CY2 A;  4PSW B;  4GGC A;  1PGU A;  1GXR A;  2CE9 A;  2I3S A;  2B5N A;  4JT5 C;  2Z2N A;  3K26 A;  2OK6 A;  4AOW A;  5H14 A;  2YMU A;  2QC5 A;  4CI8 A;  1N6F A;  3SMR A;  4JT6 C;  3KRW B;  5HE3 B;  3N0D A;  3SJL D;  5C2W B;  1QNI A;  5SXM A;  4ERZ A;  1N6E A;  2OVQ B;  4PBY A;  5FKT A;  3EI4 A;  5EM2 A;  3F3G A;  2AGY A;  2H9P A;  5HE2 B;  4CI1 A;  2CO0 C;  4A11 A;  4FHL A;  1S4U X;  3RFG A;  3SHF A;  4L3H D;  4A0A B;  2Q7Q A;  2QXV A;  4PBZ A;  4ZOY A;  3JAM g;  1U4C A;  4CI2 A;  2AGX A;  1ERJ A;  4J82 A;  5EM2 B;  4J73 A;  4ZOZ A;  2IUV A;  3RN0 D;  4JSV C;  2P9K C;  2H9M A;  5IJ8 E;  3OL2 A;  1VYH C;  3PSC B;  2H3X A;  4A11 B;  3FRX A;  3C5M A;  2Z2O A;  2IUR A;  2AGL A;  3A0F A;  4GGD A;  2CNX A;  3SBQ A;  3VH0 A;  4CZY A;  2H6Q A;  1OMW B;  3UKU C;  4GZ8 A;  5FKQ A;  4XEI C;  5TEE A;  4JSX C;  3AL8 A;  5GXH A;  2J55 H;  4J84 A;  2HJ4 A;  3AH8 B;  4X61 B;  3RN1 D;  3I7N A;  4XYI A;  2EBS A;  4YVD A;  5K19 A;  4A08 A;  4X60 B;  4O45 A;  3GFC A;  4A2M A;  3FGB A;  3EMH A;  4OWR A;  2HKR A;  5B4W A;  3V7D B;  4J77 A;  3DSM A;  5EMM B;  4PNK B;  3VGZ A;  2IUQ A;  3UVL A;  2H9L A;  3JZH A;  2YBA A;  5EAM A;  2YNP A;  3SWS D;  4FWW A;  3IIY A;  5AFU 3;  3C9C A;  1B9X A;  2CE8 A;  3W15 A;  3NVX A;  2AH0 A;  1N6D A;  3F3F A;  3MMY A;  1B9Y A;  2YNN A;  4CY3 A;  5C9Z B;  4IA9 A;  4NSX A;  1U2V C;  3RMZ D;  3UVO A;  1K32 A;  4H5I A;  5FA5 B;  2OJY A;  2H13 A;  1MG3 A;  5TDH B;  3DWL C;  3UR4 A;  4H5J A;  4BL0 A;  5FKS A;  3I7K A;  4R7A B;  3DM0 A;  4A7J A;  5I5J A;  2UZY B;  4J78 A;  2XL3 A;  1JMZ B;  1SHY B;  1GG2 B;  3KRX B;  2G9A A;  2YNO A;  2P9N C;  3E0C A;  2I3T A;  2PBI B;  4FB1 D;  3RSE C;  5IGO A;  4X3E A;  2O9K A;  2IWF A;  2PM6 B;  4O1Q D;  4O9D A;  3NVN A;  3OKY A;  2BCJ B;  2P9S C;  3JPX A;  2PM7 B;  2B4E A;  3I7H A;  5CYK A;  3P4F A;  3EI4 B;  3RFH A;  4MK0 B;  1MG2 A;  4CY5 A;  3B7F A;  3DXM C;  4JSN C;  4J8G A;  2CN2 A;  1L0Q A;  3CFS B;  5CXC A;  3EI1 A;  1JJU B;  4X63 B;  3OKY B;  4QRJ A;  3NVQ A;  5CYK B;  4J79 A;  5FKR A;  4J0W A;  1MDA H;  4J8B A;  3SBR A;  3I8C A;  3JRP A;  4GQ2 P;  2IUP A;  2P9I C;  4A09 A;  2B5L A;  2PM9 A;  3OL2 B;  5IT9 g;  2HXC A;  4BH6 A;  4U1E I;  2OVR B;  3V9F A;  3U4Y A;  3EI1 B;  5IGQ A;  3JB9 L;  3MZK A;  3I8E A;  4JXM A;  1R5M A;  3CIK B;  3DXK C;  5I5M A;  4LG8 A;  2J56 H;  4J81 A;  4XYH A;  1P22 A;  2H68 A;  5HE1 B;  4QQE A;  4GQB B;  3AFC A;  5KDO B;  5TF2 A;  3FM0 A;  4ZN4 A;  3SFZ A;  3C75 H;  4K3I D;  4FA9 D;  5C2V B;  1XKS A;  3IKO A;  1PBY B;  3AL8 B;  3GRE A;  5AMS A;  3ULE C;  3JZN A;  4HDJ A;  2YB8 B;  5HQG A;  2H9N A;  3IIW A;  3SCY A;  4N14 A;  4L1Q D;  4A08 B;  2XU7 A;  1PI6 A;  5EAP A;  4PC0 A;  4GM8 A;  3RRM C;  1JOF A;  1K8K C;  2GC4 A;  2P9P C;  2P9U C;  3CFV A;  4A0B A;  4OZU A;  4ES0 A;  5IJ7 E;  4O3U B;  4Y7R A;  3I7P A;  2CN3 A;  4PXW A;  3UVM A;  4O3T B;  4E5Z A;  4JSP C;  2AGW A;  3C99 A;  3VA6 A;  3PE7 A;  4JD2 C;  1NEX B;  5CXB A;  3BG1 A;  4CZV A;  4GQ1 A;  4GMB A;  3PXW D;  4ESG A;  1YFQ A;  1XHM A;  3HFQ A;  4UI9 R;  5H17 A;  3IJC A;  4E5Z B;  3I2N A;  3OKW A;  3UVN A;  4ERQ A;  5FXY A;  3PVU B;  4ZOX A;  5EMK B;  3UVK A;  1JMX B;  4G56 B;  5K1C C;  2GC7 A;  2OK4 A;  3ODT A;  4CY1 A;  3ZWL B;  2Z2P A;  5GXI A;  2I0R A;  3JRO A;  3OKT A;  5GSA A;  1OLZ A;  1SQ9 A;  3JZG A;  4AEZ A;  5HE0 B;  5EMJ B;  2GNQ A;  2XL2 A;  4IMM A;  4A0A A;  3IJ0 A;  3PVW B;  4L3G D;  3J81 g;  3OW8 A;  3L4M D;  4U7A A;  2H14 A;  5IC7 A;  3SN6 B;  5H1M A;  2UZX B;  5EAR A;  2B5M A;  3BWS A;  4J86 A;  3EI2 A;  1A0R B;  3SLE D;  2H6N A;  4FA4 D;  4QT8 A;  2I0T A;  2H47 A;  4GM3 A;  3RLM D;  3MZL A;  4L9O A;  3I7L A;  2P9L C;  5CXC B;  4ERY A;  2IWK A;  2XYI A;  3IJ1 A;  3ORV D;  3PXS D;  3EI2 B;  3OTT A;  1GOT B;  2CO0 A;  3V5W B;  3SVW D;  5A2Q g;  1RI6 A;  4EWR A;  2HJB A;  5FQD A;  4A09 B;  4FA1 D;  2HES X;  2PM9 B;  5I5I A;  4Y5R D;  3EWE A;  3L4O D;  4FAN D;  4J0X A;  3UKR C;  5TEF A;  2OIZ A;  4Z8L A;  5EML B;  2G99 A;  4D0K A;  1XIP A;  5FLX g;  3SBP A;  4D6V A;  2AH1 A;  4GM9 A;  2TRC B;  2MTA H;  1Q47 A;  3EU7 A;  2IAA A;  4E54 A;  4GGA A;  2W18 A;  3EI3 A;  3N0E A;  5AJA A;  4J87 A;  3F3P A;  4PSX B;  4CZX A;  4FAV D;  5THA A;  4I79 A;  2H6K A;  2AQ5 A;  4A2L A;  5GMK n;  4ZOV A;  4BUJ C;  2HKM A;  5JWZ A;  3K27 A;  5HYN B;  1TYQ C;  3PSL A;  2AGZ A;  2J57 G;  3BG0 A;  3MKS B;  4E54 B;  2I0S A;  2HYE A;  3EI3 B;  3I89 A;  4TZ4 A;  3SXT D;  1TBG A;  3I7O A;  3MXX A;  4CC9 A;  4CI3 A;  1PEV A;  4K3J B;  4LG9 A;  4A0B B;  3EG6 A;  3J80 g;  3AL9 A;  4QL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...