3MXXA

Crystal structure of wdr5 mutant (s62a)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
315
Chain Sequence
GGQQMGRGSEFVKPNYALKFTLAGHTKAVSSVKFSPNGEWLAASSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title The Effect of Asp-His-Ser/Thr-Trp Tetrad on the Thermostability of WD40-Repeat Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 103
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2010-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3mxxA00
1GOTB 2XU7A 4GQBB 1K32A 5EMKB 4ES0A 2XYIA 2P9UC 5IGQA 2H9LA 1XIPA 3U4YA 3DM0A 2Z2PA 3EWEA 5EMLB 3C9CA 5H17A 4J0WA 1NR0A 4H5JA 1PBYB 3PVWB 3W15A 4J82A 3PXTD 1JMZB 5H1MA 3JZGA 3FRXA 1FWXA 2P9NC 5EM2A 2PM7B 4L1QD 4CC9A 3AL8A 4J86A 3I7HA 3SVWD 4GMBA 3I8EA 2CO0C 5HQGA 2GC7A 2P9SC 3DWLC 3IJ1A 1QNIA 3PE7A 4J73A 2B5MA 2TRCB 3EU7A 4GM3A 3VA6A 2PBIB 2OVQB 4BL0A 3I7KA 2MTAH 2XL2A 3EI1B 5CXBB 4L3HD 5K1CC 4JSXC 5K19A 2UZYB 3UVMA 2CN2A 3ULEC 4K3ID 2Z2OA 3I7OA 4GZ8A 1VYHC 3I7LA 4OZUA 5IJ7E 4A0BB 4GM8A 2OIZA 4J8GA 3UKUC 2B5LA 4J81A 3MKSB 3CFVA 4Y5RD 4JSVC 1GP2B 2IWKA 4FA5D 3MZKA 4H5IA 4FHLA 4U1EI 2H9PA 5JWZA 2YB8B 3RRMC 3AH8B 2YNOA 3E0CA 4J77A 5SXMA 3SJLD 4O45A 1MDAH 4O3TB 4ZOZA 5EM2B 5CXCA 2H68A 3AL8B 3UR4A 4L3GD 3GFCA 4PSWB 1ERJA 5KDOB 4K3JB 1N6FA 2I3SA 3C5MA 3RLMD 1N6EA 3IIWA 3SBRA 2AH1A 3L4OD 4XEIC 3B7FA 5EARA 1RI6A 2H9MA 5I5IA 3P4FA 2I0TA 3CFSB 3VGZA 5HE2B 4R7AB 2H6NA 2P9LC 3PVUB 4Y7RA 3ODTA 3OL2A 4FWWA 1U2VC 1P22A 4QT8A 3K26A 4A08A 2CE9A 5IC7A 3RSEC 3I8CA 1NEXB 4GGCA 4IMMA 5AFU3 3JAMg 3MZLA 3KRWB 2H3XA 4X60B 2GC4A 3DXMC 4LG8A 3SBQA 4J78A 4A09A 1SQJA 3J81g 2I3TA 3J80g 4QL1A 4J79A 2HKRA 4ESGA 3FGBA 3IKOA 3UVNA 2H14A 3IJ0A 4JSPC 5FKTA 2H9NA 4CZYA 5TEFA 2OVPB 4FAVD 2YMUA 5GXIA 5CXCB 4BH6A 5GXHA 4FA1D 4FAND 3FM0A 2IURA 4TZ4A 4J0XA 4PBZA 1R5MA 1S4UX 4FA4D 3BG0A 2EBSA 3EI4A 2YNNA 4JSNC 4A7JA 3KRXB 1TYQC 3JZHA 4CZXA 1JOFA 1SHYB 2AGXA 3MKQA 4CI8A 4E54A 5TEEA 4U7AA 4LGNA 3SMRA 2IUVA 5H14A 5HE1B 5AMSA 2AQ5A 5TDHB 5C9ZB 2H47A 3RFGA 3OL2B 4A08B 3SFZA 5TF2A 4BUJC 4A11A 1OMWB 1U4CA 5CYKA 5FKSA 2CN3A 3PSLA 5B4WA 4ZOYA 3PSCB 4D0KA 2G99A 2UZXB 2CE8A 3IIYA 2BCJB 3SXTD 4A09B 4OWRA 1L0QA 2IUPA 4PSXB 4Z8LA 4ERZA 2GNQA 1PEVA 4X61B 3MXXA 4E5ZA 2HJBA 2J55H 3OKYA 2AGLA 1PI6A 3I7PA 3RFHA 3V5WB 3I7NA 4CI2A 5IJ8E 5FLXg 2H6QA 2HJ4A 4PXWA 2CNXA 4MK0B 4FA9D 3F3FA 5FA5B 3BG1A 3RMZD 3ORVD 3UKRC 3HFQA 2J57G 4JD2C 5EALA 5FQDA 3EI4B 2G9AA 3PXWD 3C75H 4JT6C 2I0RA 1MG3A 4AOWA 4E54B 4ZOXA 4J8BA 5EMMB 4ERQA 3F3GA 4D6VA 4GGDA 3I2NA 4ERYA 2YNPA 2HYEA 3NVQA 3EG6A 1B9XA 3JZNA 4A11B 3JB9L 5CYKB 3ZWLB 4I79A 2W18A 1GG2B 3EI3A 3NVNA 3OKTA 4GQ2P 3IJCA 5AJAA 4AEZA 4A0AA 2XL3A 5HYNB 4GQ1A 5EMJB 3N0DA 4L9OA 3UVKA 3MMYA 4QRJA 3K27A 2YBAA 3AFCA 2B5NA 3EMHA 3JPXA 5HE0B 2I0SA 2AGWA 5IGOA 3SBPA 2OK6A 2PM9A 4PBYA 4E5ZB 2J56H 3OKYB 2OJYA 3OW8A 5FKQA 4KFMB 5C2WB 4NSXA 5GMKn 4ZN4A 5FXYA 4CY2A 1A0RB 1YFQA 3V9FA 2PM6B 4GGAA 4J87A 2HXCA 4O1QD 2CO0A 4PC0A 3OTTA 2IWFA 1TBGA 3DSMA 3EI2A 3VH0A 3JROA 4UI9R 2AH0A 4A2LA 5EAMA 3SWSD 2OVRB 1Q47A 1XHMA 2QC5A 2H13A 4ZOVA 3V7DB 3RN1D 2Z2NA 4GM9A 3JRPA 3RN0D 3SHFA 2OK4A 4X3EA 5A2Qg 4N14A 1OLZA 3EI3B 3N0EA 4A2MA 2HESX 4XYHA 1K8KC 5I5MA 2B4EA 4CY1A 4O3UB 2AGYA 4EWRA 4A0AB 1B9YA 3CIKB 2AGZA 4CY5A 3SLED 3I89A 2IUQA 5I5JA 1JMXB 4CY3A 2BBKH 3PXSD 2HKMA 3OKWA 5HE3B 2P9KC 2PM9B 3UVLA 2QXVA 4CI1A 2IAAA 1JJUB 3C99A 3BWSA 1XKSA 2P9PC 4X63B 3GREA 4PNKB 3DXKC 4IA9A 4JXMA 4XYIA 4FB1D 3AL9A 5THAA 1PGUA 5EAPA 2P9IC 1N6DA 2Q7QA 4HDJA 4LG9A 2H6KA 4G56B 4JT5C 3EI1A 3L4MD 5CXBA 4QQEA 5FKRA 5IT9g 5GSAA 4CZVA 3EI2B 3NVXA 3A0FA 1SQ9A 3SCYA 3F3PA 4A0BA 2O9KA 4CI3A 3SN6B 4O9DA 5C2VB 4J84A 3UVOA 1GXRA 1MG2A 4YVDA
chains in the Genus database with same CATH superfamily
1GOTB 2XU7A 4GQBB 1K32A 3MVDK 5EMKB 4ES0A 2XYIA 4MMYA 2EIBA 1C9LA 2P9UC 4MMZA 5IGQA 2H9LA 1XIPA 1GOFA 3U4YA 3DM0A 3IUJA 1H2XA 1TYEA 2Z2PA 3EWEA 5EMLB 3C9CA 5H17A 4J0WA 1NR0A 4H5JA 1PBYB 3PVWB 3W15A 4J82A 3PXTD 1JMZB 5H1MA 3JZGA 3FRXA 1FWXA 1UOPA 2P9NC 3GC3B 5EM2A 2PM7B 4L1QD 4CC9A 1A12A 3AL8A 4J86A 3I7HA 3T3MA 3SVWD 4GMBA 3I8EA 2CO0C 5HQGA 2GC7A 2P9SC 3DWLC 3IJ1A 3V4VA 5C86A 1QNIA 3PE7A 4AN0A 4J73A 4MMXA 2B5MA 2TRCB 3EU7A 4GM3A 3VA6A 2PBIB 2VZ3A 2OVQB 4BL0A 3I7KA 2MTAH 2XL2A 3EI1B 5CXBB 4L3HD 5K1CC 2QR5A 4JSXC 4AN1A 5K19A 2UZYB 3UVMA 2CN2A 1QFSA 3ULEC 4K3ID 2Z2OA 1I2MB 3I7OA 4GZ8A 1VYHC 3I7LA 4OZUA 5IJ7E 1UTCA 4A0BB 4GM8A 1E5TA 2OIZA 4J8GA 4AMYA 3UKUC 2B5LA 4J81A 3MKSB 3EQ7A 1YR2A 2VDPA 3CFVA 4Y5RD 2EICA 4JSVC 1GP2B 2IWKA 5FFOA 3MZKA 1JTDB 4H5IA 4FHLA 4FA5D 4U1EI 2H9PA 5JWZA 2YB8B 3IUNA 3RRMC 3AH8B 2YNOA 3E0CA 4J77A 5SXMA 3SJLD 4O45A 1MDAH 4O3TB 3K71A 5M5RA 4RE5A 4ZOZA 5EM2B 5CXCA 2H68A 3AL8B 3IJEA 3UR4A 4L3GD 3GFCA 3IUMA 1VE6A 4PSWB 1ERJA 5KDOB 4K3JB 1N6FA 2I3SA 3C5MA 3RLMD 1N6EA 4O02A 3IIWA 3SBRA 2AH1A 3L4OD 4XEIC 3B7FA 5EARA 1RI6A 2H9MA 5I5IA 3P4FA 2I0TA 1H2YA 3CFSB 3VGZA 3VI4A 5HE2B 4R7AB 2H6NA 2P9LC 3EQ8A 1UOQA 3PVUB 4Y7RA 4D9SA 3ODTA 3OL2A 4FWWA 1U2VC 1P22A 4QT8A 3V4PA 3K26A 4A08A 2CE9A 5IC7A 4WK4A 1VZ3A 3RSEC 3I8CA 1NEXB 3ZDXA 4GGCA 4IMMA 3VI3A 3K72A 1L5GA 5AFU3 3JAMg 3MZLA 3KRWB 2H3XA 4X60B 3O4GA 2GC4A 3DXMC 4G1MA 4LG8A 4UM8A 3SBQA 4J78A 4A09A 1SQJA 3J81g 2I3TA 3J80g 4BP8A 4QL1A 4J79A 2HKRA 4ESGA 5FFGA 3FGBA 3IKOA 3UVNA 2H14A 3IJ0A 4IRZA 4JSPC 5FKTA 2H9NA 4CZYA 2WQ8A 3T3PA 5TEFA 1H2WA 2OVPB 4FAVD 2YMUA 3EQ9A 5GXIA 5CXCB 4BH6A 5GXHA 4FA1D 4FAND 3FM0A 1O6FA 2IURA 4TZ4A 4J0XA 4UM9A 4PBZA 1R5MA 4RE6A 1S4UX 4FA4D 3BG0A 2EBSA 3EI4A 2YNNA 4JSNC 2XE4A 4A7JA 3ZDZA 3KRXB 3NIFA 1TYQC 3JZHA 4CZXA 1JOFA 1U8CA 1SHYB 2AGXA 3MKQA 4CI8A 4E54A 5TEEA 4G55A 4U7AA 4LGNA 3ZE1A 5M5SA 3SMRA 2VDOA 2IUVA 5H14A 5HE1B 4BP9A 5AMSA 3ZDYA 2AQ5A 5TDHB 5C9ZB 2H47A 3RFGA 3OL2B 3ZE0A 4A08B 3SFZA 5TF2A 5M61A 4BUJC 4A11A 1OMWB 1U4CA 5CYKA 5FKSA 2CN3A 3PSLA 5B4WA 2HU7A 4ZOYA 3PSCB 4D0KA 2G99A 4AX4A 2UZXB 2BKLA 2CE8A 3IIYA 1VE7A 5HDBA 2BCJB 3SXTD 4A09B 4QAMA 4OWRA 3NIDA 1L0QA 2IUPA 4PSXB 3IUQA 4Z8LA 4ERZA 2GNQA 1PEVA 4X61B 3MXXA 4Z7NA 2HJBA 4E5ZA 2J55H 3OKYA 2AGLA 1PI6A 3I7PA 3RFHA 5E6RA 3I7NA 3V5WB 3ZE2A 4CI2A 5IJ8E 5FLXg 2H6QA 2HJ4A 4BCBA 4PXWA 2CNXA 4NENA 5M5VA 2HU5A 4MK0B 4FA9D 3F3FA 5FA5B 3BG1A 3RMZD 5M5TA 3ORVD 3UKRC 3HFQA 2J57G 4JD2C 4L1MA 5EALA 3DDUA 3K6SA 5FQDA 4JHNA 3EI4B 2G9AA 3PXWD 3C75H 4G1EA 4JT6C 2I0RA 1MG3A 4AOWA 4E54B 4ZOXA 1M1XA 4J8BA 5EMMB 4ERQA 3F3GA 4D6VA 4GGDA 1UOOA 3I2NA 4ERYA 2YNPA 2HYEA 3NVQA 1GOHA 3FCUA 3EG6A 1B9XA 3JZNA 4NBMA 4A11B 3JB9L 1E8NA 5CYKB 3ZWLB 4I79A 2VDLA 4BCCA 5M5UA 2W18A 1GG2B 3EI3A 3NVNA 3OKTA 4GQ2P 3IJCA 5AJAA 1VZ2A 3GD1I 3OF7A 2VDKA 4AEZA 1H2ZA 4A0AA 2EIEA 2XL3A 5HYNB 4GQ1A 5EMJB 3N0DA 4L9OA 3UVKA 3MMYA 4QRJA 1E8MA 1QFMA 3K27A 2YBAA 3AFCA 2B5NA 3EMHA 3JPXA 5HE0B 2I0SA 2AGWA 5IGOA 3SBPA 2OK6A 2PM9A 4JHPC 4PBYA 2J56H 4E5ZB 3OKYB 2OJYA 3OW8A 5FKQA 4KFMB 5C2WB 4NSXA 2XDWA 5GMKn 4ZN4A 1GOGA 5FXYA 4CY2A 1A0RB 1YFQA 2JKXA 3V9FA 3IURA 2PM6B 4GGAA 4J87A 2HXCA 2VZ1A 4O1QD 4DNUA 2CO0A 4DNWA 5E6UA 4O2WA 2EIDA 4NC4A 4PC0A 3OTTA 1JV2A 2IWFA 1TBGA 1BPOA 3DSMA 3EI2A 3VH0A 3JROA 4UI9R 4WK2A 2AH0A 4A2LA 5EAMA 3SWSD 3FCSA 2OVRB 1Q47A 5C92A 1XHMA 2QC5A 2H13A 4ZOVA 4Z7OA 3V7DB 3KCIA 3RN1D 2Z2NA 4GM9A 3JRPA 3RN0D 3SHFA 2OK4A 4X3EA 5A2Qg 4N14A 2VDQA 1OLZA 3EI3B 3N0EA 4A2MA 2HESX 4XYHA 1K8KC 5I5MA 2B4EA 4NAAA 4CY1A 4O3UB 2AGYA 4EWRA 2XZGA 4A0AB 1B9YA 3CIKB 4Z7QA 2QZPA 2AGZA 3QI0A 4CY5A 3SLED 2VDMA 3I89A 2IUQA 5I5JA 1JMXB 4CY3A 2BBKH 3MUNA 2VDRA 3PXSD 3IULA 2HKMA 3OKWA 4WJKA 3NIGA 5HE3B 3O4IA 2P9KC 2PM9B 3O4JA 3UVLA 2QXVA 4AMZA 4CI1A 1O6GA 2IAAA 1JJUB 3IVMA 2VC2A 5E6SA 3C99A 3BWSA 1XKSA 2P9PC 4X63B 3GREA 4PNKB 3DXKC 4IA9A 4JXMA 4XYIA 4FB1D 3AL9A 3QHYB 5THAA 1PGUA 5EAPA 3MUOA 2P9IC 1N6DA 2Q7QA 4HDJA 4LG9A 1K3IA 2H6KA 4G56B 4JT5C 4BCDA 3EI1A 3L4MD 5CXBA 4QQEA 3O4HA 5FKRA 5IT9g 5GSAA 4CZVA 3EI2B 4WK0A 3NVXA 2VDNA 3A0FA 4DNVA 1SQ9A 3SCYA 2HU8A 3F3PA 1T2XA 2O9KA 1C9IA 3SN6B 4CI3A 4A0BA 4O9DA 5C2VB 4J84A 3UVOA 1GXRA 1MG2A 4YVDA
chains in the Genus database with same CATH topology
1GOTB 2XU7A 4GQBB 1K32A 5EMKB 4ES0A 2XYIA 2P9UC 5IGQA 2H9LA 1XIPA 3U4YA 3DM0A 2Z2PA 3EWEA 5EMLB 3C9CA 5H17A 4J0WA 1NR0A 4H5JA 1PBYB 3PVWB 3W15A 4J82A 3PXTD 1JMZB 5H1MA 3JZGA 3FRXA 1FWXA 2P9NC 5EM2A 2PM7B 4L1QD 4CC9A 3AL8A 4J86A 3I7HA 3SVWD 4GMBA 3I8EA 2CO0C 5HQGA 2GC7A 2P9SC 3DWLC 3IJ1A 1QNIA 3PE7A 4J73A 2B5MA 2TRCB 3EU7A 4GM3A 3VA6A 2PBIB 2OVQB 4BL0A 3I7KA 2MTAH 2XL2A 3EI1B 5CXBB 4L3HD 5K1CC 4JSXC 5K19A 2UZYB 3UVMA 2CN2A 3ULEC 4K3ID 2Z2OA 3I7OA 4GZ8A 1VYHC 3I7LA 4OZUA 5IJ7E 4A0BB 4GM8A 2OIZA 4J8GA 3UKUC 2B5LA 4J81A 3MKSB 3CFVA 4Y5RD 4JSVC 1GP2B 2IWKA 4FA5D 3MZKA 4H5IA 4FHLA 4U1EI 2H9PA 5JWZA 2YB8B 3RRMC 3AH8B 2YNOA 3E0CA 4J77A 5SXMA 3SJLD 4O45A 1MDAH 4O3TB 4ZOZA 5EM2B 5CXCA 2H68A 3AL8B 3UR4A 4L3GD 3GFCA 4PSWB 1ERJA 5KDOB 4K3JB 1N6FA 2I3SA 3C5MA 3RLMD 1N6EA 3IIWA 3SBRA 2AH1A 3L4OD 4XEIC 3B7FA 5EARA 1RI6A 2H9MA 5I5IA 3P4FA 2I0TA 3CFSB 3VGZA 5HE2B 4R7AB 2H6NA 2P9LC 3PVUB 4Y7RA 3ODTA 3OL2A 4FWWA 1U2VC 1P22A 4QT8A 3K26A 4A08A 2CE9A 5IC7A 3RSEC 3I8CA 1NEXB 4GGCA 4IMMA 5AFU3 3JAMg 3MZLA 3KRWB 2H3XA 4X60B 2GC4A 3DXMC 4LG8A 3SBQA 4J78A 4A09A 1SQJA 3J81g 2I3TA 3J80g 4QL1A 4J79A 2HKRA 4ESGA 3FGBA 3IKOA 3UVNA 2H14A 3IJ0A 4JSPC 5FKTA 2H9NA 4CZYA 5TEFA 2OVPB 4FAVD 2YMUA 5GXIA 5CXCB 4BH6A 5GXHA 4FA1D 4FAND 3FM0A 2IURA 4TZ4A 4J0XA 4PBZA 1R5MA 1S4UX 4FA4D 3BG0A 2EBSA 3EI4A 2YNNA 4JSNC 4A7JA 3KRXB 1TYQC 3JZHA 4CZXA 1JOFA 1SHYB 2AGXA 3MKQA 4CI8A 4E54A 5TEEA 4U7AA 4LGNA 3SMRA 2IUVA 5H14A 5HE1B 5AMSA 2AQ5A 5TDHB 5C9ZB 2H47A 3RFGA 3OL2B 4A08B 3SFZA 5TF2A 4BUJC 4A11A 1OMWB 1U4CA 5CYKA 5FKSA 2CN3A 3PSLA 5B4WA 4ZOYA 3PSCB 4D0KA 2G99A 2UZXB 2CE8A 3IIYA 2BCJB 3SXTD 4A09B 4OWRA 1L0QA 2IUPA 4PSXB 4Z8LA 4ERZA 2GNQA 1PEVA 4X61B 3MXXA 4E5ZA 2HJBA 2J55H 3OKYA 2AGLA 1PI6A 3I7PA 3RFHA 3V5WB 3I7NA 4CI2A 5IJ8E 5FLXg 2H6QA 2HJ4A 4PXWA 2CNXA 4MK0B 4FA9D 3F3FA 5FA5B 3BG1A 3RMZD 3ORVD 3UKRC 3HFQA 2J57G 4JD2C 5EALA 5FQDA 3EI4B 2G9AA 3PXWD 3C75H 4JT6C 2I0RA 1MG3A 4AOWA 4E54B 4ZOXA 4J8BA 5EMMB 4ERQA 3F3GA 4D6VA 4GGDA 3I2NA 4ERYA 2YNPA 2HYEA 3NVQA 3EG6A 1B9XA 3JZNA 4A11B 3JB9L 5CYKB 3ZWLB 4I79A 2W18A 1GG2B 3EI3A 3NVNA 3OKTA 4GQ2P 3IJCA 5AJAA 4AEZA 4A0AA 2XL3A 5HYNB 4GQ1A 5EMJB 3N0DA 4L9OA 3UVKA 3MMYA 4QRJA 3K27A 2YBAA 3AFCA 2B5NA 3EMHA 3JPXA 5HE0B 2I0SA 2AGWA 5IGOA 3SBPA 2OK6A 2PM9A 4PBYA 4E5ZB 2J56H 3OKYB 2OJYA 3OW8A 5FKQA 4KFMB 5C2WB 4NSXA 5GMKn 4ZN4A 5FXYA 4CY2A 1A0RB 1YFQA 3V9FA 2PM6B 4GGAA 4J87A 2HXCA 4O1QD 2CO0A 4PC0A 3OTTA 2IWFA 1TBGA 3DSMA 3EI2A 3VH0A 3JROA 4UI9R 2AH0A 4A2LA 5EAMA 3SWSD 2OVRB 1Q47A 1XHMA 2QC5A 2H13A 4ZOVA 3V7DB 3RN1D 2Z2NA 4GM9A 3JRPA 3RN0D 3SHFA 2OK4A 4X3EA 5A2Qg 4N14A 1OLZA 3EI3B 3N0EA 4A2MA 2HESX 4XYHA 1K8KC 5I5MA 2B4EA 4CY1A 4O3UB 2AGYA 4EWRA 4A0AB 1B9YA 3CIKB 2AGZA 4CY5A 3SLED 3I89A 2IUQA 5I5JA 1JMXB 4CY3A 2BBKH 3PXSD 2HKMA 3OKWA 5HE3B 2P9KC 2PM9B 3UVLA 2QXVA 4CI1A 2IAAA 1JJUB 3C99A 3BWSA 1XKSA 2P9PC 4X63B 3GREA 4PNKB 3DXKC 4IA9A 4JXMA 4XYIA 4FB1D 3AL9A 5THAA 1PGUA 5EAPA 2P9IC 1N6DA 2Q7QA 4HDJA 4LG9A 2H6KA 4G56B 4JT5C 3EI1A 3L4MD 5CXBA 4QQEA 5FKRA 5IT9g 5GSAA 4CZVA 3EI2B 3NVXA 3A0FA 1SQ9A 3SCYA 3F3PA 4A0BA 2O9KA 4CI3A 3SN6B 4O9DA 5C2VB 4J84A 3UVOA 1GXRA 1MG2A 4YVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOT B;  2XU7 A;  4GQB B;  1K32 A;  5EMK B;  4ES0 A;  2XYI A;  2P9U C;  5IGQ A;  2H9L A;  1XIP A;  3U4Y A;  3DM0 A;  2Z2P A;  3EWE A;  5EML B;  3C9C A;  5H17 A;  4J0W A;  1NR0 A;  4H5J A;  1PBY B;  3PVW B;  3W15 A;  4J82 A;  3PXT D;  1JMZ B;  5H1M A;  3JZG A;  3FRX A;  1FWX A;  2P9N C;  5EM2 A;  2PM7 B;  4L1Q D;  4CC9 A;  3AL8 A;  4J86 A;  3I7H A;  3SVW D;  4GMB A;  3I8E A;  2CO0 C;  5HQG A;  2GC7 A;  2P9S C;  3DWL C;  3IJ1 A;  1QNI A;  3PE7 A;  4J73 A;  2B5M A;  2TRC B;  3EU7 A;  4GM3 A;  3VA6 A;  2PBI B;  2OVQ B;  4BL0 A;  3I7K A;  2MTA H;  2XL2 A;  3EI1 B;  5CXB B;  4L3H D;  5K1C C;  4JSX C;  5K19 A;  2UZY B;  3UVM A;  2CN2 A;  3ULE C;  4K3I D;  2Z2O A;  3I7O A;  4GZ8 A;  1VYH C;  3I7L A;  4OZU A;  5IJ7 E;  4A0B B;  4GM8 A;  2OIZ A;  4J8G A;  3UKU C;  2B5L A;  4J81 A;  3MKS B;  3CFV A;  4Y5R D;  4JSV C;  1GP2 B;  2IWK A;  4FA5 D;  3MZK A;  4H5I A;  4FHL A;  4U1E I;  2H9P A;  5JWZ A;  2YB8 B;  3RRM C;  3AH8 B;  2YNO A;  3E0C A;  4J77 A;  5SXM A;  3SJL D;  4O45 A;  1MDA H;  4O3T B;  4ZOZ A;  5EM2 B;  5CXC A;  2H68 A;  3AL8 B;  3UR4 A;  4L3G D;  3GFC A;  4PSW B;  1ERJ A;  5KDO B;  4K3J B;  1N6F A;  2I3S A;  3C5M A;  3RLM D;  1N6E A;  3IIW A;  3SBR A;  2AH1 A;  3L4O D;  4XEI C;  3B7F A;  5EAR A;  1RI6 A;  2H9M A;  5I5I A;  3P4F A;  2I0T A;  3CFS B;  3VGZ A;  5HE2 B;  4R7A B;  2H6N A;  2P9L C;  3PVU B;  4Y7R A;  3ODT A;  3OL2 A;  4FWW A;  1U2V C;  1P22 A;  4QT8 A;  3K26 A;  4A08 A;  2CE9 A;  5IC7 A;  3RSE C;  3I8C A;  1NEX B;  4GGC A;  4IMM A;  5AFU 3;  3JAM g;  3MZL A;  3KRW B;  2H3X A;  4X60 B;  2GC4 A;  3DXM C;  4LG8 A;  3SBQ A;  4J78 A;  4A09 A;  1SQJ A;  3J81 g;  2I3T A;  3J80 g;  4QL1 A;  4J79 A;  2HKR A;  4ESG A;  3FGB A;  3IKO A;  3UVN A;  2H14 A;  3IJ0 A;  4JSP C;  5FKT A;  2H9N A;  4CZY A;  5TEF A;  2OVP B;  4FAV D;  2YMU A;  5GXI A;  5CXC B;  4BH6 A;  5GXH A;  4FA1 D;  4FAN D;  3FM0 A;  2IUR A;  4TZ4 A;  4J0X A;  4PBZ A;  1R5M A;  1S4U X;  4FA4 D;  3BG0 A;  2EBS A;  3EI4 A;  2YNN A;  4JSN C;  4A7J A;  3KRX B;  1TYQ C;  3JZH A;  4CZX A;  1JOF A;  1SHY B;  2AGX A;  3MKQ A;  4CI8 A;  4E54 A;  5TEE A;  4U7A A;  4LGN A;  3SMR A;  2IUV A;  5H14 A;  5HE1 B;  5AMS A;  2AQ5 A;  5TDH B;  5C9Z B;  2H47 A;  3RFG A;  3OL2 B;  4A08 B;  3SFZ A;  5TF2 A;  4BUJ C;  4A11 A;  1OMW B;  1U4C A;  5CYK A;  5FKS A;  2CN3 A;  3PSL A;  5B4W A;  4ZOY A;  3PSC B;  4D0K A;  2G99 A;  2UZX B;  2CE8 A;  3IIY A;  2BCJ B;  3SXT D;  4A09 B;  4OWR A;  1L0Q A;  2IUP A;  4PSX B;  4Z8L A;  4ERZ A;  2GNQ A;  1PEV A;  4X61 B;  3MXX A;  4E5Z A;  2HJB A;  2J55 H;  3OKY A;  2AGL A;  1PI6 A;  3I7P A;  3RFH A;  3V5W B;  3I7N A;  4CI2 A;  5IJ8 E;  5FLX g;  2H6Q A;  2HJ4 A;  4PXW A;  2CNX A;  4MK0 B;  4FA9 D;  3F3F A;  5FA5 B;  3BG1 A;  3RMZ D;  3ORV D;  3UKR C;  3HFQ A;  2J57 G;  4JD2 C;  5EAL A;  5FQD A;  3EI4 B;  2G9A A;  3PXW D;  3C75 H;  4JT6 C;  2I0R A;  1MG3 A;  4AOW A;  4E54 B;  4ZOX A;  4J8B A;  5EMM B;  4ERQ A;  3F3G A;  4D6V A;  4GGD A;  3I2N A;  4ERY A;  2YNP A;  2HYE A;  3NVQ A;  3EG6 A;  1B9X A;  3JZN A;  4A11 B;  3JB9 L;  5CYK B;  3ZWL B;  4I79 A;  2W18 A;  1GG2 B;  3EI3 A;  3NVN A;  3OKT A;  4GQ2 P;  3IJC A;  5AJA A;  4AEZ A;  4A0A A;  2XL3 A;  5HYN B;  4GQ1 A;  5EMJ B;  3N0D A;  4L9O A;  3UVK A;  3MMY A;  4QRJ A;  3K27 A;  2YBA A;  3AFC A;  2B5N A;  3EMH A;  3JPX A;  5HE0 B;  2I0S A;  2AGW A;  5IGO A;  3SBP A;  2OK6 A;  2PM9 A;  4PBY A;  4E5Z B;  2J56 H;  3OKY B;  2OJY A;  3OW8 A;  5FKQ A;  4KFM B;  5C2W B;  4NSX A;  5GMK n;  4ZN4 A;  5FXY A;  4CY2 A;  1A0R B;  1YFQ A;  3V9F A;  2PM6 B;  4GGA A;  4J87 A;  2HXC A;  4O1Q D;  2CO0 A;  4PC0 A;  3OTT A;  2IWF A;  1TBG A;  3DSM A;  3EI2 A;  3VH0 A;  3JRO A;  4UI9 R;  2AH0 A;  4A2L A;  5EAM A;  3SWS D;  2OVR B;  1Q47 A;  1XHM A;  2QC5 A;  2H13 A;  4ZOV A;  3V7D B;  3RN1 D;  2Z2N A;  4GM9 A;  3JRP A;  3RN0 D;  3SHF A;  2OK4 A;  4X3E A;  5A2Q g;  4N14 A;  1OLZ A;  3EI3 B;  3N0E A;  4A2M A;  2HES X;  4XYH A;  1K8K C;  5I5M A;  2B4E A;  4CY1 A;  4O3U B;  2AGY A;  4EWR A;  4A0A B;  1B9Y A;  3CIK B;  2AGZ A;  4CY5 A;  3SLE D;  3I89 A;  2IUQ A;  5I5J A;  1JMX B;  4CY3 A;  2BBK H;  3PXS D;  2HKM A;  3OKW A;  5HE3 B;  2P9K C;  2PM9 B;  3UVL A;  2QXV A;  4CI1 A;  2IAA A;  1JJU B;  3C99 A;  3BWS A;  1XKS A;  2P9P C;  4X63 B;  3GRE A;  4PNK B;  3DXK C;  4IA9 A;  4JXM A;  4XYI A;  4FB1 D;  3AL9 A;  5THA A;  1PGU A;  5EAP A;  2P9I C;  1N6D A;  2Q7Q A;  4HDJ A;  4LG9 A;  2H6K A;  4G56 B;  4JT5 C;  3EI1 A;  3L4M D;  5CXB A;  4QQE A;  5FKR A;  5IT9 g;  5GSA A;  4CZV A;  3EI2 B;  3NVX A;  3A0F A;  1SQ9 A;  3SCY A;  3F3P A;  4A0B A;  2O9K A;  4CI3 A;  3SN6 B;  4O9D A;  5C2V B;  4J84 A;  3UVO A;  1GXR A;  1MG2 A;  4YVD A; 
#chains in the Genus database with same CATH topology
 1GOT B;  2XU7 A;  4GQB B;  1K32 A;  3MVD K;  5EMK B;  4ES0 A;  2XYI A;  4MMY A;  2EIB A;  1C9L A;  2P9U C;  4MMZ A;  5IGQ A;  2H9L A;  1XIP A;  1GOF A;  3U4Y A;  3DM0 A;  3IUJ A;  1H2X A;  1TYE A;  2Z2P A;  3EWE A;  5EML B;  3C9C A;  5H17 A;  4J0W A;  1NR0 A;  4H5J A;  1PBY B;  3PVW B;  3W15 A;  4J82 A;  3PXT D;  1JMZ B;  5H1M A;  3JZG A;  3FRX A;  1FWX A;  1UOP A;  2P9N C;  3GC3 B;  5EM2 A;  2PM7 B;  4L1Q D;  4CC9 A;  1A12 A;  3AL8 A;  4J86 A;  3I7H A;  3T3M A;  3SVW D;  4GMB A;  3I8E A;  2CO0 C;  5HQG A;  2GC7 A;  2P9S C;  3DWL C;  3IJ1 A;  3V4V A;  5C86 A;  1QNI A;  3PE7 A;  4AN0 A;  4J73 A;  4MMX A;  2B5M A;  2TRC B;  3EU7 A;  4GM3 A;  3VA6 A;  2PBI B;  2VZ3 A;  2OVQ B;  4BL0 A;  3I7K A;  2MTA H;  2XL2 A;  3EI1 B;  5CXB B;  4L3H D;  5K1C C;  2QR5 A;  4JSX C;  4AN1 A;  5K19 A;  2UZY B;  3UVM A;  2CN2 A;  1QFS A;  3ULE C;  4K3I D;  2Z2O A;  1I2M B;  3I7O A;  4GZ8 A;  1VYH C;  3I7L A;  4OZU A;  5IJ7 E;  1UTC A;  4A0B B;  4GM8 A;  1E5T A;  2OIZ A;  4J8G A;  4AMY A;  3UKU C;  2B5L A;  4J81 A;  3MKS B;  3EQ7 A;  1YR2 A;  2VDP A;  3CFV A;  4Y5R D;  2EIC A;  4JSV C;  1GP2 B;  2IWK A;  5FFO A;  3MZK A;  1JTD B;  4H5I A;  4FHL A;  4FA5 D;  4U1E I;  2H9P A;  5JWZ A;  2YB8 B;  3IUN A;  3RRM C;  3AH8 B;  2YNO A;  3E0C A;  4J77 A;  5SXM A;  3SJL D;  4O45 A;  1MDA H;  4O3T B;  3K71 A;  5M5R A;  4RE5 A;  4ZOZ A;  5EM2 B;  5CXC A;  2H68 A;  3AL8 B;  3IJE A;  3UR4 A;  4L3G D;  3GFC A;  3IUM A;  1VE6 A;  4PSW B;  1ERJ A;  5KDO B;  4K3J B;  1N6F A;  2I3S A;  3C5M A;  3RLM D;  1N6E A;  4O02 A;  3IIW A;  3SBR A;  2AH1 A;  3L4O D;  4XEI C;  3B7F A;  5EAR A;  1RI6 A;  2H9M A;  5I5I A;  3P4F A;  2I0T A;  1H2Y A;  3CFS B;  3VGZ A;  3VI4 A;  5HE2 B;  4R7A B;  2H6N A;  2P9L C;  3EQ8 A;  1UOQ A;  3PVU B;  4Y7R A;  4D9S A;  3ODT A;  3OL2 A;  4FWW A;  1U2V C;  1P22 A;  4QT8 A;  3V4P A;  3K26 A;  4A08 A;  2CE9 A;  5IC7 A;  4WK4 A;  1VZ3 A;  3RSE C;  3I8C A;  1NEX B;  3ZDX A;  4GGC A;  4IMM A;  3VI3 A;  3K72 A;  1L5G A;  5AFU 3;  3JAM g;  3MZL A;  3KRW B;  2H3X A;  4X60 B;  3O4G A;  2GC4 A;  3DXM C;  4G1M A;  4LG8 A;  4UM8 A;  3SBQ A;  4J78 A;  4A09 A;  1SQJ A;  3J81 g;  2I3T A;  3J80 g;  4BP8 A;  4QL1 A;  4J79 A;  2HKR A;  4ESG A;  5FFG A;  3FGB A;  3IKO A;  3UVN A;  2H14 A;  3IJ0 A;  4IRZ A;  4JSP C;  5FKT A;  2H9N A;  4CZY A;  2WQ8 A;  3T3P A;  5TEF A;  1H2W A;  2OVP B;  4FAV D;  2YMU A;  3EQ9 A;  5GXI A;  5CXC B;  4BH6 A;  5GXH A;  4FA1 D;  4FAN D;  3FM0 A;  1O6F A;  2IUR A;  4TZ4 A;  4J0X A;  4UM9 A;  4PBZ A;  1R5M A;  4RE6 A;  1S4U X;  4FA4 D;  3BG0 A;  2EBS A;  3EI4 A;  2YNN A;  4JSN C;  2XE4 A;  4A7J A;  3ZDZ A;  3KRX B;  3NIF A;  1TYQ C;  3JZH A;  4CZX A;  1JOF A;  1U8C A;  1SHY B;  2AGX A;  3MKQ A;  4CI8 A;  4E54 A;  5TEE A;  4G55 A;  4U7A A;  4LGN A;  3ZE1 A;  5M5S A;  3SMR A;  2VDO A;  2IUV A;  5H14 A;  5HE1 B;  4BP9 A;  5AMS A;  3ZDY A;  2AQ5 A;  5TDH B;  5C9Z B;  2H47 A;  3RFG A;  3OL2 B;  3ZE0 A;  4A08 B;  3SFZ A;  5TF2 A;  5M61 A;  4BUJ C;  4A11 A;  1OMW B;  1U4C A;  5CYK A;  5FKS A;  2CN3 A;  3PSL A;  5B4W A;  2HU7 A;  4ZOY A;  3PSC B;  4D0K A;  2G99 A;  4AX4 A;  2UZX B;  2BKL A;  2CE8 A;  3IIY A;  1VE7 A;  5HDB A;  2BCJ B;  3SXT D;  4A09 B;  4QAM A;  4OWR A;  3NID A;  1L0Q A;  2IUP A;  4PSX B;  3IUQ A;  4Z8L A;  4ERZ A;  2GNQ A;  1PEV A;  4X61 B;  3MXX A;  4Z7N A;  2HJB A;  4E5Z A;  2J55 H;  3OKY A;  2AGL A;  1PI6 A;  3I7P A;  3RFH A;  5E6R A;  3I7N A;  3V5W B;  3ZE2 A;  4CI2 A;  5IJ8 E;  5FLX g;  2H6Q A;  2HJ4 A;  4BCB A;  4PXW A;  2CNX A;  4NEN A;  5M5V A;  2HU5 A;  4MK0 B;  4FA9 D;  3F3F A;  5FA5 B;  3BG1 A;  3RMZ D;  5M5T A;  3ORV D;  3UKR C;  3HFQ A;  2J57 G;  4JD2 C;  4L1M A;  5EAL A;  3DDU A;  3K6S A;  5FQD A;  4JHN A;  3EI4 B;  2G9A A;  3PXW D;  3C75 H;  4G1E A;  4JT6 C;  2I0R A;  1MG3 A;  4AOW A;  4E54 B;  4ZOX A;  1M1X A;  4J8B A;  5EMM B;  4ERQ A;  3F3G A;  4D6V A;  4GGD A;  1UOO A;  3I2N A;  4ERY A;  2YNP A;  2HYE A;  3NVQ A;  1GOH A;  3FCU A;  3EG6 A;  1B9X A;  3JZN A;  4NBM A;  4A11 B;  3JB9 L;  1E8N A;  5CYK B;  3ZWL B;  4I79 A;  2VDL A;  4BCC A;  5M5U A;  2W18 A;  1GG2 B;  3EI3 A;  3NVN A;  3OKT A;  4GQ2 P;  3IJC A;  5AJA A;  1VZ2 A;  3GD1 I;  3OF7 A;  2VDK A;  4AEZ A;  1H2Z A;  4A0A A;  2EIE A;  2XL3 A;  5HYN B;  4GQ1 A;  5EMJ B;  3N0D A;  4L9O A;  3UVK A;  3MMY A;  4QRJ A;  1E8M A;  1QFM A;  3K27 A;  2YBA A;  3AFC A;  2B5N A;  3EMH A;  3JPX A;  5HE0 B;  2I0S A;  2AGW A;  5IGO A;  3SBP A;  2OK6 A;  2PM9 A;  4JHP C;  4PBY A;  2J56 H;  4E5Z B;  3OKY B;  2OJY A;  3OW8 A;  5FKQ A;  4KFM B;  5C2W B;  4NSX A;  2XDW A;  5GMK n;  4ZN4 A;  1GOG A;  5FXY A;  4CY2 A;  1A0R B;  1YFQ A;  2JKX A;  3V9F A;  3IUR A;  2PM6 B;  4GGA A;  4J87 A;  2HXC A;  2VZ1 A;  4O1Q D;  4DNU A;  2CO0 A;  4DNW A;  5E6U A;  4O2W A;  2EID A;  4NC4 A;  4PC0 A;  3OTT A;  1JV2 A;  2IWF A;  1TBG A;  1BPO A;  3DSM A;  3EI2 A;  3VH0 A;  3JRO A;  4UI9 R;  4WK2 A;  2AH0 A;  4A2L A;  5EAM A;  3SWS D;  3FCS A;  2OVR B;  1Q47 A;  5C92 A;  1XHM A;  2QC5 A;  2H13 A;  4ZOV A;  4Z7O A;  3V7D B;  3KCI A;  3RN1 D;  2Z2N A;  4GM9 A;  3JRP A;  3RN0 D;  3SHF A;  2OK4 A;  4X3E A;  5A2Q g;  4N14 A;  2VDQ A;  1OLZ A;  3EI3 B;  3N0E A;  4A2M A;  2HES X;  4XYH A;  1K8K C;  5I5M A;  2B4E A;  4NAA A;  4CY1 A;  4O3U B;  2AGY A;  4EWR A;  2XZG A;  4A0A B;  1B9Y A;  3CIK B;  4Z7Q A;  2QZP A;  2AGZ A;  3QI0 A;  4CY5 A;  3SLE D;  2VDM A;  3I89 A;  2IUQ A;  5I5J A;  1JMX B;  4CY3 A;  2BBK H;  3MUN A;  2VDR A;  3PXS D;  3IUL A;  2HKM A;  3OKW A;  4WJK A;  3NIG A;  5HE3 B;  3O4I A;  2P9K C;  2PM9 B;  3O4J A;  3UVL A;  2QXV A;  4AMZ A;  4CI1 A;  1O6G A;  2IAA A;  1JJU B;  3IVM A;  2VC2 A;  5E6S A;  3C99 A;  3BWS A;  1XKS A;  2P9P C;  4X63 B;  3GRE A;  4PNK B;  3DXK C;  4IA9 A;  4JXM A;  4XYI A;  4FB1 D;  3AL9 A;  3QHY B;  5THA A;  1PGU A;  5EAP A;  3MUO A;  2P9I C;  1N6D A;  2Q7Q A;  4HDJ A;  4LG9 A;  1K3I A;  2H6K A;  4G56 B;  4JT5 C;  4BCD A;  3EI1 A;  3L4M D;  5CXB A;  4QQE A;  3O4H A;  5FKR A;  5IT9 g;  5GSA A;  4CZV A;  3EI2 B;  4WK0 A;  3NVX A;  2VDN A;  3A0F A;  4DNV A;  1SQ9 A;  3SCY A;  2HU8 A;  3F3P A;  1T2X A;  2O9K A;  1C9I A;  3SN6 B;  4CI3 A;  4A0B A;  4O9D A;  5C2V B;  4J84 A;  3UVO A;  1GXR A;  1MG2 A;  4YVD A; 
#chains in the Genus database with same CATH homology
 1GOT B;  2XU7 A;  4GQB B;  1K32 A;  5EMK B;  4ES0 A;  2XYI A;  2P9U C;  5IGQ A;  2H9L A;  1XIP A;  3U4Y A;  3DM0 A;  2Z2P A;  3EWE A;  5EML B;  3C9C A;  5H17 A;  4J0W A;  1NR0 A;  4H5J A;  1PBY B;  3PVW B;  3W15 A;  4J82 A;  3PXT D;  1JMZ B;  5H1M A;  3JZG A;  3FRX A;  1FWX A;  2P9N C;  5EM2 A;  2PM7 B;  4L1Q D;  4CC9 A;  3AL8 A;  4J86 A;  3I7H A;  3SVW D;  4GMB A;  3I8E A;  2CO0 C;  5HQG A;  2GC7 A;  2P9S C;  3DWL C;  3IJ1 A;  1QNI A;  3PE7 A;  4J73 A;  2B5M A;  2TRC B;  3EU7 A;  4GM3 A;  3VA6 A;  2PBI B;  2OVQ B;  4BL0 A;  3I7K A;  2MTA H;  2XL2 A;  3EI1 B;  5CXB B;  4L3H D;  5K1C C;  4JSX C;  5K19 A;  2UZY B;  3UVM A;  2CN2 A;  3ULE C;  4K3I D;  2Z2O A;  3I7O A;  4GZ8 A;  1VYH C;  3I7L A;  4OZU A;  5IJ7 E;  4A0B B;  4GM8 A;  2OIZ A;  4J8G A;  3UKU C;  2B5L A;  4J81 A;  3MKS B;  3CFV A;  4Y5R D;  4JSV C;  1GP2 B;  2IWK A;  4FA5 D;  3MZK A;  4H5I A;  4FHL A;  4U1E I;  2H9P A;  5JWZ A;  2YB8 B;  3RRM C;  3AH8 B;  2YNO A;  3E0C A;  4J77 A;  5SXM A;  3SJL D;  4O45 A;  1MDA H;  4O3T B;  4ZOZ A;  5EM2 B;  5CXC A;  2H68 A;  3AL8 B;  3UR4 A;  4L3G D;  3GFC A;  4PSW B;  1ERJ A;  5KDO B;  4K3J B;  1N6F A;  2I3S A;  3C5M A;  3RLM D;  1N6E A;  3IIW A;  3SBR A;  2AH1 A;  3L4O D;  4XEI C;  3B7F A;  5EAR A;  1RI6 A;  2H9M A;  5I5I A;  3P4F A;  2I0T A;  3CFS B;  3VGZ A;  5HE2 B;  4R7A B;  2H6N A;  2P9L C;  3PVU B;  4Y7R A;  3ODT A;  3OL2 A;  4FWW A;  1U2V C;  1P22 A;  4QT8 A;  3K26 A;  4A08 A;  2CE9 A;  5IC7 A;  3RSE C;  3I8C A;  1NEX B;  4GGC A;  4IMM A;  5AFU 3;  3JAM g;  3MZL A;  3KRW B;  2H3X A;  4X60 B;  2GC4 A;  3DXM C;  4LG8 A;  3SBQ A;  4J78 A;  4A09 A;  1SQJ A;  3J81 g;  2I3T A;  3J80 g;  4QL1 A;  4J79 A;  2HKR A;  4ESG A;  3FGB A;  3IKO A;  3UVN A;  2H14 A;  3IJ0 A;  4JSP C;  5FKT A;  2H9N A;  4CZY A;  5TEF A;  2OVP B;  4FAV D;  2YMU A;  5GXI A;  5CXC B;  4BH6 A;  5GXH A;  4FA1 D;  4FAN D;  3FM0 A;  2IUR A;  4TZ4 A;  4J0X A;  4PBZ A;  1R5M A;  1S4U X;  4FA4 D;  3BG0 A;  2EBS A;  3EI4 A;  2YNN A;  4JSN C;  4A7J A;  3KRX B;  1TYQ C;  3JZH A;  4CZX A;  1JOF A;  1SHY B;  2AGX A;  3MKQ A;  4CI8 A;  4E54 A;  5TEE A;  4U7A A;  4LGN A;  3SMR A;  2IUV A;  5H14 A;  5HE1 B;  5AMS A;  2AQ5 A;  5TDH B;  5C9Z B;  2H47 A;  3RFG A;  3OL2 B;  4A08 B;  3SFZ A;  5TF2 A;  4BUJ C;  4A11 A;  1OMW B;  1U4C A;  5CYK A;  5FKS A;  2CN3 A;  3PSL A;  5B4W A;  4ZOY A;  3PSC B;  4D0K A;  2G99 A;  2UZX B;  2CE8 A;  3IIY A;  2BCJ B;  3SXT D;  4A09 B;  4OWR A;  1L0Q A;  2IUP A;  4PSX B;  4Z8L A;  4ERZ A;  2GNQ A;  1PEV A;  4X61 B;  3MXX A;  4E5Z A;  2HJB A;  2J55 H;  3OKY A;  2AGL A;  1PI6 A;  3I7P A;  3RFH A;  3V5W B;  3I7N A;  4CI2 A;  5IJ8 E;  5FLX g;  2H6Q A;  2HJ4 A;  4PXW A;  2CNX A;  4MK0 B;  4FA9 D;  3F3F A;  5FA5 B;  3BG1 A;  3RMZ D;  3ORV D;  3UKR C;  3HFQ A;  2J57 G;  4JD2 C;  5EAL A;  5FQD A;  3EI4 B;  2G9A A;  3PXW D;  3C75 H;  4JT6 C;  2I0R A;  1MG3 A;  4AOW A;  4E54 B;  4ZOX A;  4J8B A;  5EMM B;  4ERQ A;  3F3G A;  4D6V A;  4GGD A;  3I2N A;  4ERY A;  2YNP A;  2HYE A;  3NVQ A;  3EG6 A;  1B9X A;  3JZN A;  4A11 B;  3JB9 L;  5CYK B;  3ZWL B;  4I79 A;  2W18 A;  1GG2 B;  3EI3 A;  3NVN A;  3OKT A;  4GQ2 P;  3IJC A;  5AJA A;  4AEZ A;  4A0A A;  2XL3 A;  5HYN B;  4GQ1 A;  5EMJ B;  3N0D A;  4L9O A;  3UVK A;  3MMY A;  4QRJ A;  3K27 A;  2YBA A;  3AFC A;  2B5N A;  3EMH A;  3JPX A;  5HE0 B;  2I0S A;  2AGW A;  5IGO A;  3SBP A;  2OK6 A;  2PM9 A;  4PBY A;  4E5Z B;  2J56 H;  3OKY B;  2OJY A;  3OW8 A;  5FKQ A;  4KFM B;  5C2W B;  4NSX A;  5GMK n;  4ZN4 A;  5FXY A;  4CY2 A;  1A0R B;  1YFQ A;  3V9F A;  2PM6 B;  4GGA A;  4J87 A;  2HXC A;  4O1Q D;  2CO0 A;  4PC0 A;  3OTT A;  2IWF A;  1TBG A;  3DSM A;  3EI2 A;  3VH0 A;  3JRO A;  4UI9 R;  2AH0 A;  4A2L A;  5EAM A;  3SWS D;  2OVR B;  1Q47 A;  1XHM A;  2QC5 A;  2H13 A;  4ZOV A;  3V7D B;  3RN1 D;  2Z2N A;  4GM9 A;  3JRP A;  3RN0 D;  3SHF A;  2OK4 A;  4X3E A;  5A2Q g;  4N14 A;  1OLZ A;  3EI3 B;  3N0E A;  4A2M A;  2HES X;  4XYH A;  1K8K C;  5I5M A;  2B4E A;  4CY1 A;  4O3U B;  2AGY A;  4EWR A;  4A0A B;  1B9Y A;  3CIK B;  2AGZ A;  4CY5 A;  3SLE D;  3I89 A;  2IUQ A;  5I5J A;  1JMX B;  4CY3 A;  2BBK H;  3PXS D;  2HKM A;  3OKW A;  5HE3 B;  2P9K C;  2PM9 B;  3UVL A;  2QXV A;  4CI1 A;  2IAA A;  1JJU B;  3C99 A;  3BWS A;  1XKS A;  2P9P C;  4X63 B;  3GRE A;  4PNK B;  3DXK C;  4IA9 A;  4JXM A;  4XYI A;  4FB1 D;  3AL9 A;  5THA A;  1PGU A;  5EAP A;  2P9I C;  1N6D A;  2Q7Q A;  4HDJ A;  4LG9 A;  2H6K A;  4G56 B;  4JT5 C;  3EI1 A;  3L4M D;  5CXB A;  4QQE A;  5FKR A;  5IT9 g;  5GSA A;  4CZV A;  3EI2 B;  3NVX A;  3A0F A;  1SQ9 A;  3SCY A;  3F3P A;  4A0B A;  2O9K A;  4CI3 A;  3SN6 B;  4O9D A;  5C2V B;  4J84 A;  3UVO A;  1GXR A;  1MG2 A;  4YVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...