3MXXA

Crystal structure of wdr5 mutant (s62a)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
315
Chain Sequence
GGQQMGRGSEFVKPNYALKFTLAGHTKAVSSVKFSPNGEWLAASSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Effect of Asp-His-Ser/Thr-Trp Tetrad on the Thermostability of WD40-Repeat Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
total genus 103
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2010-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3mxxA00
4X63B 1JMXB 3DWLC 4J79A 4QL1A 3I8EA 4EWRA 2P9SC 3SBPA 2GC7A 3UVLA 4X61B 2G99A 3OW8A 3SFZA 3JPXA 3UR4A 3VA6A 2Z2PA 4IA9A 2OJYA 3FGBA 5HYNB 4FHLA 3GFCA 1PEVA 3F3FA 2P9UC 4CY2A 3SWSD 2CE9A 4GZ8A 4XYHA 4A0AA 4JSPC 2BBKH 4O45A 5EAPA 2IWFA 4J77A 3F3GA 4CZXA 5IJ8E 3IIWA 5FKSA 2IWKA 4GGCA 4FAND 1PI6A 3J81g 4CY3A 3ORVD 3A0FA 4JXMA 3AL9A 4O9DA 1MG3A 2P9IC 3J80g 3MKSB 2P9PC 4GQ2P 1XIPA 2P9LC 3JROA 1K8KC 4GM3A 5K1CC 3AL8A 3KRXB 3PVWB 1NEXB 4CY5A 2OK4A 4HDJA 1XHMA 2P9NC 2XL3A 3EI3A 2H13A 4O3TB 2H6QA 1GOTB 4CZVA 4J0XA 3SXTD 3OKWA 2H9PA 4E54B 4QT8A 3VGZA 3I7LA 1XKSA 3C99A 5H1MA 2UZXB 3UVOA 3OKTA 4J0WA 4J82A 5EM2A 4U7AA 3MKQA 1PBYB 3E0CA 5HQGA 5HE2B 4J8BA 5EARA 2YNPA 2BCJB 4E5ZA 1TYQC 3EI4A 3RN1D 2G9AA 3BG1A 4O3UB 3V5WB 1S4UX 3RN0D 2YB8B 4JSXC 5IC7A 1ERJA 4ERZA 5AFU3 2GNQA 5HE3B 4L1QD 3BG0A 1R5MA 4D6VA 3SN6B 4TZ4A 5GXHA 4FA4D 2J57G 2CO0A 4X60B 2HXCA 3JB9L 3SCYA 4JSNC 3JZGA 4GM9A 5CXBB 3UVKA 2Z2NA 3FRXA 2AH0A 4AOWA 5FXYA 4CI2A 4LG9A 2I3SA 1SQ9A 3IIYA 2Z2OA 3EI2A 3IJ0A 4J84A 4A7JA 4NSXA 3AFCA 3JRPA 5JWZA 2AGXA 2XU7A 4PBZA 3SMRA 4A11B 5FKTA 3CFSB 3OL2A 2IUVA 4A2MA 3PSLA 5I5IA 2YMUA 2AQ5A 3PVUB 2CE8A 5TDHB 5H14A 3OKYB 1U2VC 5EMMB 5TF2A 4A0AB 4O1QD 4K3ID 4BL0A 1K32A 2YNNA 5CXCA 4PC0A 5GSAA 2QXVA 4AEZA 2OK6A 3V9FA 5B4WA 4FWWA 4YVDA 3UKRC 4J86A 3EU7A 3RLMD 2MTAH 1FWXA 2EBSA 5SXMA 4GM8A 4ERQA 3I89A 3FM0A 3SLED 4FA9D 3I8CA 2J55H 2AH1A 2CN3A 4MK0B 4ES0A 1SQJA 2H9MA 1A0RB 1VYHC 4K3JB 4GQ1A 4L3GD 3K27A 2IUPA 4I79A 3I7NA 3PXTD 1GP2B 3OL2B 2TRCB 3JZNA 5GMKn 4A11A 4CC9A 4OWRA 3KRWB 1YFQA 1OLZA 2AGYA 3I7PA 5TEEA 4FA1D 4U1EI 2XL2A 3I7KA 1N6FA 2CN2A 2HYEA 3N0EA 4CI1A 3SHFA 5H17A 4ZOZA 4FAVD 3MXXA 4FA5D 4GGAA 4Z8LA 3U4YA 3IJ1A 4L9OA 5EMLB 2IAAA 5IGOA 4L3HD 1QNIA 5FLXg 4PSWB 4H5IA 4QRJA 4CI8A 2H14A 2XYIA 4PSXB 5IT9g 1N6EA 1OMWB 3EMHA 3I2NA 1JOFA 4XYIA 5I5JA 3V7DB 4BH6A 3GREA 4CZYA 2J56H 3ULEC 4UI9R 4JD2C 2OIZA 3DSMA 3VH0A 5C2VB 5KDOB 3AL8B 2I0SA 4A09B 3B7FA 4J8GA 4E5ZB 1Q47A 1GXRA 1P22A 3C9CA 4N14A 2H47A 3CIKB 4JT6C 5CXCB 5EM2B 3MZLA 2GC4A 3SBRA 3UKUC 1L0QA 3OKYA 2HESX 3PXSD 4KFMB 3RFGA 2HKRA 4GQBB 4ESGA 2PM9A 3EI1A 4OZUA 3I7HA 4Y7RA 5EMKB 3N0DA 4Y5RD 4PXWA 3SBQA 3RFHA 4JT5C 1NR0A 1MDAH 4XEIC 3F3PA 3EWEA 4ZOVA 5HE0B 4CY1A 5A2Qg 4ZOYA 5IGQA 1MG2A 3JZHA 3C5MA 3EG6A 2B4EA 2B5NA 2CO0C 3MZKA 4QQEA 4R7AB 4LGNA 3OTTA 2H9NA 2H9LA 4ZN4A 3EI1B 2B5MA 2PM9B 2HJBA 2W18A 3NVQA 2P9KC 3UVMA 3RMZD 4A0BB 1PGUA 4GMBA 4A0BA 4PBYA 1GG2B 2I0TA 2YBAA 4G56B 4J73A 2HJ4A 3P4FA 5FQDA 2B5LA 2AGLA 3SJLD 4BUJC 2IUQA 2H3XA 4J78A 2OVPB 5FKQA 2O9KA 4A09A 1B9XA 4J87A 3BWSA 4A2LA 2OVQB 2CNXA 4D0KA 5FA5B 5AJAA 3DXMC 2YNOA 2I0RA 2QC5A 4ZOXA 1RI6A 5IJ7E 3MMYA 3NVNA 5TEFA 5FKRA 4J81A 2AGWA 4JSVC 3PE7A 5HE1B 2UZYB 2OVRB 3CFVA 5CXBA 5THAA 2I3TA 3L4MD 3DM0A 3RRMC 3W15A 4A08A 3NVXA 1JMZB 5EAMA 4CI3A 3RSEC 5CYKA 1TBGA 4A08B 3IKOA 4X3EA 5C2WB 1U4CA 4GGDA 2H68A 5I5MA 2Q7QA 3EI2B 4FB1D 3UVNA 3AH8B 2IURA 4PNKB 5EALA 3L4OD 3HFQA 3EI3B 4H5JA 3DXKC 5GXIA 1N6DA 1B9YA 3EI4B 4IMMA 1JJUB 5AMSA 1SHYB 3C75H 3JAMg 3PSCB 3PXWD 2PM6B 3ODTA 5C9ZB 5K19A 3SVWD 3I7OA 3ZWLB 2HKMA 2H6NA 2PM7B 2PBIB 5CYKB 5EMJB 2H6KA 3K26A 3IJCA 4ERYA 2AGZA 4LG8A 4E54A
chains in the Genus database with same CATH superfamily
4X63B 1JMXB 3DWLC 4J79A 4QL1A 3I8EA 4EWRA 2P9SC 3SBPA 4UM9A 2GC7A 2HU5A 3UVLA 4X61B 2G99A 3OW8A 3SFZA 3JPXA 3QHYB 3UR4A 3VA6A 2Z2PA 4IA9A 2OJYA 3IULA 3FGBA 5HYNB 1H2ZA 4FHLA 3GFCA 1PEVA 4G1MA 3F3FA 2P9UC 4CY2A 3SWSD 2CE9A 4GZ8A 4XYHA 5HDBA 4A0AA 4JSPC 2BBKH 4O45A 5EAPA 2IWFA 4J77A 3F3GA 4CZXA 5IJ8E 3IIWA 2QZPA 5FKSA 2IWKA 4GGCA 4FAND 1PI6A 3MVDK 3J81g 4CY3A 3ORVD 3K71A 3A0FA 4JXMA 3AL9A 4O9DA 1GOHA 1MG3A 2P9IC 1UTCA 3J80g 1I2MB 3MKSB 2P9PC 4GQ2P 1XIPA 3O4JA 4JHPC 2P9LC 3JROA 1K8KC 4GM3A 5K1CC 3AL8A 2EIDA 3KRXB 3PVWB 1NEXB 4CY5A 2OK4A 4MMYA 4HDJA 1XHMA 2P9NC 2XL3A 1O6GA 3IUJA 3EI3A 2H13A 3T3PA 4O3TB 2H6QA 1GOTB 4CZVA 4J0XA 5C92A 3SXTD 3OKWA 1QFSA 2H9PA 4E54B 4QT8A 3VGZA 1VZ2A 1UOQA 3ZE1A 3EQ7A 3I7LA 1TYEA 2WQ8A 4BP8A 1XKSA 1H2YA 3C99A 4QAMA 5H1MA 2UZXB 3UVOA 3OKTA 4J0WA 4J82A 5EM2A 2EICA 4U7AA 4WK4A 3MKQA 1PBYB 3E0CA 5HQGA 5HE2B 4J8BA 5EARA 4NAAA 2YNPA 2BCJB 4E5ZA 3FCUA 1TYQC 3EI4A 3RN1D 2G9AA 4WJKA 3BG1A 4JHNA 4O3UB 1S4UX 3RN0D 3V5WB 5C86A 2YB8B 4JSXC 1JV2A 5IC7A 1ERJA 4ERZA 5AFU3 2GNQA 5HE3B 4L1QD 2EIBA 4MMZA 3BG0A 4RE6A 5E6RA 1O6FA 1R5MA 4D6VA 3SN6B 4RE5A 4TZ4A 5GXHA 4FA4D 2J57G 2CO0A 4X60B 2HXCA 3JB9L 3SCYA 4JSNC 3EQ8A 3JZGA 4GM9A 5CXBB 3UVKA 2Z2NA 3FRXA 2AH0A 4AOWA 5FXYA 4CI2A 4LG9A 2I3SA 1SQ9A 3IIYA 3GC3B 2Z2OA 3IJEA 2VDRA 3EI2A 1GOFA 3IJ0A 1C9IA 4J84A 4A7JA 1E5TA 4NSXA 3AFCA 3K6SA 3JRPA 2VDNA 5JWZA 2AGXA 3KCIA 4BCCA 2XU7A 2HU7A 1VE6A 3O4HA 5M5SA 2XE4A 4PBZA 4G1EA 3SMRA 4A11B 5FKTA 3CFSB 3OL2A 2IUVA 4A2MA 3PSLA 5I5IA 2YMUA 2AQ5A 3PVUB 4BCBA 2CE8A 5TDHB 5H14A 3OKYB 3DDUA 1U2VC 3NIGA 5EMMB 5TF2A 5E6SA 4O1QD 4A0AB 4K3ID 1UOOA 4BL0A 1K32A 2YNNA 2EIEA 5CXCA 4PC0A 5GSAA 2QXVA 4Z7OA 4AEZA 2OK6A 4G55A 5M5RA 3V9FA 5B4WA 4FWWA 4YVDA 3UKRC 4J86A 3EU7A 3RLMD 2MTAH 1FWXA 2EBSA 4BP9A 5SXMA 4GM8A 4ERQA 2QR5A 3I89A 3FM0A 3IUNA 3SLED 4D9SA 4FA9D 3I8CA 1JTDB 2J55H 2AH1A 3FCSA 2CN3A 4MK0B 4WK2A 4ES0A 1SQJA 2H9MA 1A0RB 1VYHC 4K3JB 3IVMA 4GQ1A 4L3GD 3K27A 2IUPA 4I79A 3I7NA 3PXTD 1GP2B 3OL2B 2TRCB 3JZNA 4NBMA 5GMKn 4A11A 2VDOA 4CC9A 4OWRA 3KRWB 1YFQA 3IUQA 1OLZA 2AGYA 3I7PA 5TEEA 4FA1D 4U1EI 2XL2A 3I7KA 1N6FA 2HU8A 1L5GA 2VZ3A 2XDWA 2CN2A 2HYEA 3N0EA 4CI1A 3SHFA 5H17A 3ZDZA 4ZOZA 4FAVD 1VE7A 3MXXA 4FA5D 4GGAA 4Z8LA 4AN1A 3U4YA 3IJ1A 4L9OA 5EMLB 4L1MA 1UOPA 2IAAA 4Z7QA 5IGOA 4L3HD 1QNIA 5FLXg 4PSWB 4H5IA 4QRJA 4BCDA 4CI8A 2H14A 2XYIA 4PSXB 5IT9g 1N6EA 1OMWB 3EMHA 3I2NA 1JOFA 5M61A 4XYIA 5I5JA 3VI3A 3V7DB 3ZE2A 3GREA 4BH6A 1YR2A 5M5UA 4CZYA 2J56H 3EQ9A 3ULEC 4UI9R 4JD2C 2OIZA 3DSMA 3VH0A 5C2VB 5KDOB 3GD1I 3AL8B 2VDKA 2I0SA 4A09B 3B7FA 4J8GA 1E8MA 4E5ZB 1Q47A 1GXRA 1P22A 3C9CA 4N14A 2H47A 2VDPA 3CIKB 4JT6C 3T3MA 4AN0A 5CXCB 5EM2B 1H2XA 3MZLA 2GC4A 3SBRA 3UKUC 4WK0A 1L0QA 3OKYA 2HESX 3ZE0A 3PXSD 4KFMB 4NC4A 3RFGA 2HKRA 4GQBB 4ESGA 1T2XA 1C9LA 2PM9A 3MUOA 3V4VA 3EI1A 4OZUA 3I7HA 4Y7RA 4DNUA 5EMKB 3N0DA 4Y5RD 3NIDA 4PXWA 1BPOA 1H2WA 3SBQA 3RFHA 4JT5C 1NR0A 1MDAH 4NENA 4XEIC 3F3PA 3EWEA 4ZOVA 5HE0B 4CY1A 5A2Qg 4ZOYA 5IGQA 4DNWA 1MG2A 3JZHA 3C5MA 3EG6A 4IRZA 2B4EA 2B5NA 2CO0C 3MZKA 3ZDXA 4QQEA 4R7AB 4LGNA 3OTTA 3VI4A 2H9NA 4DNVA 2H9LA 4ZN4A 3EI1B 2B5MA 2PM9B 2HJBA 2W18A 3NVQA 2P9KC 3UVMA 3RMZD 4A0BB 1PGUA 3OF7A 4GMBA 4A0BA 4O02A 4PBYA 1GG2B 4Z7NA 2I0TA 2YBAA 4G56B 4J73A 2HJ4A 3P4FA 5FQDA 2VZ1A 2B5LA 2AGLA 3SJLD 4BUJC 2IUQA 2BKLA 2H3XA 4J78A 5M5VA 3MUNA 2OVPB 5FKQA 2O9KA 4A09A 4AMYA 1B9XA 4J87A 3BWSA 3V4PA 4A2LA 2VDLA 2OVQB 2CNXA 2VDQA 4D0KA 5FA5B 1M1XA 2JKXA 5AJAA 3DXMC 2YNOA 2I0RA 2QC5A 4ZOXA 1RI6A 5IJ7E 3MMYA 3NVNA 5TEFA 5FKRA 4J81A 2AGWA 3NIFA 4JSVC 1K3IA 3PE7A 1E8NA 5HE1B 4O2WA 2UZYB 2OVRB 2XZGA 3CFVA 5CXBA 5THAA 2I3TA 3O4IA 3L4MD 3DM0A 3RRMC 3W15A 4A08A 3NVXA 2VDMA 5FFGA 1JMZB 5EAMA 4CI3A 3RSEC 3ZDYA 5CYKA 1TBGA 4A08B 3IKOA 4X3EA 5C2WB 3IUMA 1A12A 1U4CA 1U8CA 3K72A 4GGDA 2H68A 2VC2A 5I5MA 3O4GA 2Q7QA 4MMXA 3EI2B 4FB1D 3UVNA 3AH8B 2IURA 4PNKB 5EALA 3L4OD 3HFQA 4AX4A 3QI0A 3EI3B 4H5JA 4UM8A 3DXKC 5GXIA 1N6DA 1B9YA 3EI4B 4IMMA 5E6UA 1JJUB 5AMSA 1SHYB 3C75H 3JAMg 3PSCB 3PXWD 3IURA 5FFOA 2PM6B 5M5TA 1VZ3A 3ODTA 5C9ZB 1GOGA 5K19A 3SVWD 3I7OA 3ZWLB 2HKMA 1QFMA 4AMZA 2H6NA 2PM7B 2PBIB 5CYKB 5EMJB 2H6KA 3K26A 3IJCA 4ERYA 2AGZA 4LG8A 4E54A
chains in the Genus database with same CATH topology
4X63B 1JMXB 3DWLC 4J79A 4QL1A 3I8EA 4EWRA 2P9SC 3SBPA 2GC7A 3UVLA 4X61B 2G99A 3OW8A 3SFZA 3JPXA 3UR4A 3VA6A 2Z2PA 4IA9A 2OJYA 3FGBA 5HYNB 4FHLA 3GFCA 1PEVA 3F3FA 2P9UC 4CY2A 3SWSD 2CE9A 4GZ8A 4XYHA 4A0AA 4JSPC 2BBKH 4O45A 5EAPA 2IWFA 4J77A 3F3GA 4CZXA 5IJ8E 3IIWA 5FKSA 2IWKA 4GGCA 4FAND 1PI6A 3J81g 4CY3A 3ORVD 3A0FA 4JXMA 3AL9A 4O9DA 1MG3A 2P9IC 3J80g 3MKSB 2P9PC 4GQ2P 1XIPA 2P9LC 3JROA 1K8KC 4GM3A 5K1CC 3AL8A 3KRXB 3PVWB 1NEXB 4CY5A 2OK4A 4HDJA 1XHMA 2P9NC 2XL3A 3EI3A 2H13A 4O3TB 2H6QA 1GOTB 4CZVA 4J0XA 3SXTD 3OKWA 2H9PA 4E54B 4QT8A 3VGZA 3I7LA 1XKSA 3C99A 5H1MA 2UZXB 3UVOA 3OKTA 4J0WA 4J82A 5EM2A 4U7AA 3MKQA 1PBYB 3E0CA 5HQGA 5HE2B 4J8BA 5EARA 2YNPA 2BCJB 4E5ZA 1TYQC 3EI4A 3RN1D 2G9AA 3BG1A 4O3UB 3V5WB 1S4UX 3RN0D 2YB8B 4JSXC 5IC7A 1ERJA 4ERZA 5AFU3 2GNQA 5HE3B 4L1QD 3BG0A 1R5MA 4D6VA 3SN6B 4TZ4A 5GXHA 4FA4D 2J57G 2CO0A 4X60B 2HXCA 3JB9L 3SCYA 4JSNC 3JZGA 4GM9A 5CXBB 3UVKA 2Z2NA 3FRXA 2AH0A 4AOWA 5FXYA 4CI2A 4LG9A 2I3SA 1SQ9A 3IIYA 2Z2OA 3EI2A 3IJ0A 4J84A 4A7JA 4NSXA 3AFCA 3JRPA 5JWZA 2AGXA 2XU7A 4PBZA 3SMRA 4A11B 5FKTA 3CFSB 3OL2A 2IUVA 4A2MA 3PSLA 5I5IA 2YMUA 2AQ5A 3PVUB 2CE8A 5TDHB 5H14A 3OKYB 1U2VC 5EMMB 5TF2A 4A0AB 4O1QD 4K3ID 4BL0A 1K32A 2YNNA 5CXCA 4PC0A 5GSAA 2QXVA 4AEZA 2OK6A 3V9FA 5B4WA 4FWWA 4YVDA 3UKRC 4J86A 3EU7A 3RLMD 2MTAH 1FWXA 2EBSA 5SXMA 4GM8A 4ERQA 3I89A 3FM0A 3SLED 4FA9D 3I8CA 2J55H 2AH1A 2CN3A 4MK0B 4ES0A 1SQJA 2H9MA 1A0RB 1VYHC 4K3JB 4GQ1A 4L3GD 3K27A 2IUPA 4I79A 3I7NA 3PXTD 1GP2B 3OL2B 2TRCB 3JZNA 5GMKn 4A11A 4CC9A 4OWRA 3KRWB 1YFQA 1OLZA 2AGYA 3I7PA 5TEEA 4FA1D 4U1EI 2XL2A 3I7KA 1N6FA 2CN2A 2HYEA 3N0EA 4CI1A 3SHFA 5H17A 4ZOZA 4FAVD 3MXXA 4FA5D 4GGAA 4Z8LA 3U4YA 3IJ1A 4L9OA 5EMLB 2IAAA 5IGOA 4L3HD 1QNIA 5FLXg 4PSWB 4H5IA 4QRJA 4CI8A 2H14A 2XYIA 4PSXB 5IT9g 1N6EA 1OMWB 3EMHA 3I2NA 1JOFA 4XYIA 5I5JA 3V7DB 4BH6A 3GREA 4CZYA 2J56H 3ULEC 4UI9R 4JD2C 2OIZA 3DSMA 3VH0A 5C2VB 5KDOB 3AL8B 2I0SA 4A09B 3B7FA 4J8GA 4E5ZB 1Q47A 1GXRA 1P22A 3C9CA 4N14A 2H47A 3CIKB 4JT6C 5CXCB 5EM2B 3MZLA 2GC4A 3SBRA 3UKUC 1L0QA 3OKYA 2HESX 3PXSD 4KFMB 3RFGA 2HKRA 4GQBB 4ESGA 2PM9A 3EI1A 4OZUA 3I7HA 4Y7RA 5EMKB 3N0DA 4Y5RD 4PXWA 3SBQA 3RFHA 4JT5C 1NR0A 1MDAH 4XEIC 3F3PA 3EWEA 4ZOVA 5HE0B 4CY1A 5A2Qg 4ZOYA 5IGQA 1MG2A 3JZHA 3C5MA 3EG6A 2B4EA 2B5NA 2CO0C 3MZKA 4QQEA 4R7AB 4LGNA 3OTTA 2H9NA 2H9LA 4ZN4A 3EI1B 2B5MA 2PM9B 2HJBA 2W18A 3NVQA 2P9KC 3UVMA 3RMZD 4A0BB 1PGUA 4GMBA 4A0BA 4PBYA 1GG2B 2I0TA 2YBAA 4G56B 4J73A 2HJ4A 3P4FA 5FQDA 2B5LA 2AGLA 3SJLD 4BUJC 2IUQA 2H3XA 4J78A 2OVPB 5FKQA 2O9KA 4A09A 1B9XA 4J87A 3BWSA 4A2LA 2OVQB 2CNXA 4D0KA 5FA5B 5AJAA 3DXMC 2YNOA 2I0RA 2QC5A 4ZOXA 1RI6A 5IJ7E 3MMYA 3NVNA 5TEFA 5FKRA 4J81A 2AGWA 4JSVC 3PE7A 5HE1B 2UZYB 2OVRB 3CFVA 5CXBA 5THAA 2I3TA 3L4MD 3DM0A 3RRMC 3W15A 4A08A 3NVXA 1JMZB 5EAMA 4CI3A 3RSEC 5CYKA 1TBGA 4A08B 3IKOA 4X3EA 5C2WB 1U4CA 4GGDA 2H68A 5I5MA 2Q7QA 3EI2B 4FB1D 3UVNA 3AH8B 2IURA 4PNKB 5EALA 3L4OD 3HFQA 3EI3B 4H5JA 3DXKC 5GXIA 1N6DA 1B9YA 3EI4B 4IMMA 1JJUB 5AMSA 1SHYB 3C75H 3JAMg 3PSCB 3PXWD 2PM6B 3ODTA 5C9ZB 5K19A 3SVWD 3I7OA 3ZWLB 2HKMA 2H6NA 2PM7B 2PBIB 5CYKB 5EMJB 2H6KA 3K26A 3IJCA 4ERYA 2AGZA 4LG8A 4E54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X63 B;  1JMX B;  3DWL C;  4J79 A;  4QL1 A;  3I8E A;  4EWR A;  2P9S C;  3SBP A;  2GC7 A;  3UVL A;  4X61 B;  2G99 A;  3OW8 A;  3SFZ A;  3JPX A;  3UR4 A;  3VA6 A;  2Z2P A;  4IA9 A;  2OJY A;  3FGB A;  5HYN B;  4FHL A;  3GFC A;  1PEV A;  3F3F A;  2P9U C;  4CY2 A;  3SWS D;  2CE9 A;  4GZ8 A;  4XYH A;  4A0A A;  4JSP C;  2BBK H;  4O45 A;  5EAP A;  2IWF A;  4J77 A;  3F3G A;  4CZX A;  5IJ8 E;  3IIW A;  5FKS A;  2IWK A;  4GGC A;  4FAN D;  1PI6 A;  3J81 g;  4CY3 A;  3ORV D;  3A0F A;  4JXM A;  3AL9 A;  4O9D A;  1MG3 A;  2P9I C;  3J80 g;  3MKS B;  2P9P C;  4GQ2 P;  1XIP A;  2P9L C;  3JRO A;  1K8K C;  4GM3 A;  5K1C C;  3AL8 A;  3KRX B;  3PVW B;  1NEX B;  4CY5 A;  2OK4 A;  4HDJ A;  1XHM A;  2P9N C;  2XL3 A;  3EI3 A;  2H13 A;  4O3T B;  2H6Q A;  1GOT B;  4CZV A;  4J0X A;  3SXT D;  3OKW A;  2H9P A;  4E54 B;  4QT8 A;  3VGZ A;  3I7L A;  1XKS A;  3C99 A;  5H1M A;  2UZX B;  3UVO A;  3OKT A;  4J0W A;  4J82 A;  5EM2 A;  4U7A A;  3MKQ A;  1PBY B;  3E0C A;  5HQG A;  5HE2 B;  4J8B A;  5EAR A;  2YNP A;  2BCJ B;  4E5Z A;  1TYQ C;  3EI4 A;  3RN1 D;  2G9A A;  3BG1 A;  4O3U B;  3V5W B;  1S4U X;  3RN0 D;  2YB8 B;  4JSX C;  5IC7 A;  1ERJ A;  4ERZ A;  5AFU 3;  2GNQ A;  5HE3 B;  4L1Q D;  3BG0 A;  1R5M A;  4D6V A;  3SN6 B;  4TZ4 A;  5GXH A;  4FA4 D;  2J57 G;  2CO0 A;  4X60 B;  2HXC A;  3JB9 L;  3SCY A;  4JSN C;  3JZG A;  4GM9 A;  5CXB B;  3UVK A;  2Z2N A;  3FRX A;  2AH0 A;  4AOW A;  5FXY A;  4CI2 A;  4LG9 A;  2I3S A;  1SQ9 A;  3IIY A;  2Z2O A;  3EI2 A;  3IJ0 A;  4J84 A;  4A7J A;  4NSX A;  3AFC A;  3JRP A;  5JWZ A;  2AGX A;  2XU7 A;  4PBZ A;  3SMR A;  4A11 B;  5FKT A;  3CFS B;  3OL2 A;  2IUV A;  4A2M A;  3PSL A;  5I5I A;  2YMU A;  2AQ5 A;  3PVU B;  2CE8 A;  5TDH B;  5H14 A;  3OKY B;  1U2V C;  5EMM B;  5TF2 A;  4A0A B;  4O1Q D;  4K3I D;  4BL0 A;  1K32 A;  2YNN A;  5CXC A;  4PC0 A;  5GSA A;  2QXV A;  4AEZ A;  2OK6 A;  3V9F A;  5B4W A;  4FWW A;  4YVD A;  3UKR C;  4J86 A;  3EU7 A;  3RLM D;  2MTA H;  1FWX A;  2EBS A;  5SXM A;  4GM8 A;  4ERQ A;  3I89 A;  3FM0 A;  3SLE D;  4FA9 D;  3I8C A;  2J55 H;  2AH1 A;  2CN3 A;  4MK0 B;  4ES0 A;  1SQJ A;  2H9M A;  1A0R B;  1VYH C;  4K3J B;  4GQ1 A;  4L3G D;  3K27 A;  2IUP A;  4I79 A;  3I7N A;  3PXT D;  1GP2 B;  3OL2 B;  2TRC B;  3JZN A;  5GMK n;  4A11 A;  4CC9 A;  4OWR A;  3KRW B;  1YFQ A;  1OLZ A;  2AGY A;  3I7P A;  5TEE A;  4FA1 D;  4U1E I;  2XL2 A;  3I7K A;  1N6F A;  2CN2 A;  2HYE A;  3N0E A;  4CI1 A;  3SHF A;  5H17 A;  4ZOZ A;  4FAV D;  3MXX A;  4FA5 D;  4GGA A;  4Z8L A;  3U4Y A;  3IJ1 A;  4L9O A;  5EML B;  2IAA A;  5IGO A;  4L3H D;  1QNI A;  5FLX g;  4PSW B;  4H5I A;  4QRJ A;  4CI8 A;  2H14 A;  2XYI A;  4PSX B;  5IT9 g;  1N6E A;  1OMW B;  3EMH A;  3I2N A;  1JOF A;  4XYI A;  5I5J A;  3V7D B;  4BH6 A;  3GRE A;  4CZY A;  2J56 H;  3ULE C;  4UI9 R;  4JD2 C;  2OIZ A;  3DSM A;  3VH0 A;  5C2V B;  5KDO B;  3AL8 B;  2I0S A;  4A09 B;  3B7F A;  4J8G A;  4E5Z B;  1Q47 A;  1GXR A;  1P22 A;  3C9C A;  4N14 A;  2H47 A;  3CIK B;  4JT6 C;  5CXC B;  5EM2 B;  3MZL A;  2GC4 A;  3SBR A;  3UKU C;  1L0Q A;  3OKY A;  2HES X;  3PXS D;  4KFM B;  3RFG A;  2HKR A;  4GQB B;  4ESG A;  2PM9 A;  3EI1 A;  4OZU A;  3I7H A;  4Y7R A;  5EMK B;  3N0D A;  4Y5R D;  4PXW A;  3SBQ A;  3RFH A;  4JT5 C;  1NR0 A;  1MDA H;  4XEI C;  3F3P A;  3EWE A;  4ZOV A;  5HE0 B;  4CY1 A;  5A2Q g;  4ZOY A;  5IGQ A;  1MG2 A;  3JZH A;  3C5M A;  3EG6 A;  2B4E A;  2B5N A;  2CO0 C;  3MZK A;  4QQE A;  4R7A B;  4LGN A;  3OTT A;  2H9N A;  2H9L A;  4ZN4 A;  3EI1 B;  2B5M A;  2PM9 B;  2HJB A;  2W18 A;  3NVQ A;  2P9K C;  3UVM A;  3RMZ D;  4A0B B;  1PGU A;  4GMB A;  4A0B A;  4PBY A;  1GG2 B;  2I0T A;  2YBA A;  4G56 B;  4J73 A;  2HJ4 A;  3P4F A;  5FQD A;  2B5L A;  2AGL A;  3SJL D;  4BUJ C;  2IUQ A;  2H3X A;  4J78 A;  2OVP B;  5FKQ A;  2O9K A;  4A09 A;  1B9X A;  4J87 A;  3BWS A;  4A2L A;  2OVQ B;  2CNX A;  4D0K A;  5FA5 B;  5AJA A;  3DXM C;  2YNO A;  2I0R A;  2QC5 A;  4ZOX A;  1RI6 A;  5IJ7 E;  3MMY A;  3NVN A;  5TEF A;  5FKR A;  4J81 A;  2AGW A;  4JSV C;  3PE7 A;  5HE1 B;  2UZY B;  2OVR B;  3CFV A;  5CXB A;  5THA A;  2I3T A;  3L4M D;  3DM0 A;  3RRM C;  3W15 A;  4A08 A;  3NVX A;  1JMZ B;  5EAM A;  4CI3 A;  3RSE C;  5CYK A;  1TBG A;  4A08 B;  3IKO A;  4X3E A;  5C2W B;  1U4C A;  4GGD A;  2H68 A;  5I5M A;  2Q7Q A;  3EI2 B;  4FB1 D;  3UVN A;  3AH8 B;  2IUR A;  4PNK B;  5EAL A;  3L4O D;  3HFQ A;  3EI3 B;  4H5J A;  3DXK C;  5GXI A;  1N6D A;  1B9Y A;  3EI4 B;  4IMM A;  1JJU B;  5AMS A;  1SHY B;  3C75 H;  3JAM g;  3PSC B;  3PXW D;  2PM6 B;  3ODT A;  5C9Z B;  5K19 A;  3SVW D;  3I7O A;  3ZWL B;  2HKM A;  2H6N A;  2PM7 B;  2PBI B;  5CYK B;  5EMJ B;  2H6K A;  3K26 A;  3IJC A;  4ERY A;  2AGZ A;  4LG8 A;  4E54 A; 
#chains in the Genus database with same CATH topology
 4X63 B;  1JMX B;  3DWL C;  4J79 A;  4QL1 A;  3I8E A;  4EWR A;  2P9S C;  3SBP A;  4UM9 A;  2GC7 A;  2HU5 A;  3UVL A;  4X61 B;  2G99 A;  3OW8 A;  3SFZ A;  3JPX A;  3QHY B;  3UR4 A;  3VA6 A;  2Z2P A;  4IA9 A;  2OJY A;  3IUL A;  3FGB A;  5HYN B;  1H2Z A;  4FHL A;  3GFC A;  1PEV A;  4G1M A;  3F3F A;  2P9U C;  4CY2 A;  3SWS D;  2CE9 A;  4GZ8 A;  4XYH A;  5HDB A;  4A0A A;  4JSP C;  2BBK H;  4O45 A;  5EAP A;  2IWF A;  4J77 A;  3F3G A;  4CZX A;  5IJ8 E;  3IIW A;  2QZP A;  5FKS A;  2IWK A;  4GGC A;  4FAN D;  1PI6 A;  3MVD K;  3J81 g;  4CY3 A;  3ORV D;  3K71 A;  3A0F A;  4JXM A;  3AL9 A;  4O9D A;  1GOH A;  1MG3 A;  2P9I C;  1UTC A;  3J80 g;  1I2M B;  3MKS B;  2P9P C;  4GQ2 P;  1XIP A;  3O4J A;  4JHP C;  2P9L C;  3JRO A;  1K8K C;  4GM3 A;  5K1C C;  3AL8 A;  2EID A;  3KRX B;  3PVW B;  1NEX B;  4CY5 A;  2OK4 A;  4MMY A;  4HDJ A;  1XHM A;  2P9N C;  2XL3 A;  1O6G A;  3IUJ A;  3EI3 A;  2H13 A;  3T3P A;  4O3T B;  2H6Q A;  1GOT B;  4CZV A;  4J0X A;  5C92 A;  3SXT D;  3OKW A;  1QFS A;  2H9P A;  4E54 B;  4QT8 A;  3VGZ A;  1VZ2 A;  1UOQ A;  3ZE1 A;  3EQ7 A;  3I7L A;  1TYE A;  2WQ8 A;  4BP8 A;  1XKS A;  1H2Y A;  3C99 A;  4QAM A;  5H1M A;  2UZX B;  3UVO A;  3OKT A;  4J0W A;  4J82 A;  5EM2 A;  2EIC A;  4U7A A;  4WK4 A;  3MKQ A;  1PBY B;  3E0C A;  5HQG A;  5HE2 B;  4J8B A;  5EAR A;  4NAA A;  2YNP A;  2BCJ B;  4E5Z A;  3FCU A;  1TYQ C;  3EI4 A;  3RN1 D;  2G9A A;  4WJK A;  3BG1 A;  4JHN A;  4O3U B;  1S4U X;  3RN0 D;  3V5W B;  5C86 A;  2YB8 B;  4JSX C;  1JV2 A;  5IC7 A;  1ERJ A;  4ERZ A;  5AFU 3;  2GNQ A;  5HE3 B;  4L1Q D;  2EIB A;  4MMZ A;  3BG0 A;  4RE6 A;  5E6R A;  1O6F A;  1R5M A;  4D6V A;  3SN6 B;  4RE5 A;  4TZ4 A;  5GXH A;  4FA4 D;  2J57 G;  2CO0 A;  4X60 B;  2HXC A;  3JB9 L;  3SCY A;  4JSN C;  3EQ8 A;  3JZG A;  4GM9 A;  5CXB B;  3UVK A;  2Z2N A;  3FRX A;  2AH0 A;  4AOW A;  5FXY A;  4CI2 A;  4LG9 A;  2I3S A;  1SQ9 A;  3IIY A;  3GC3 B;  2Z2O A;  3IJE A;  2VDR A;  3EI2 A;  1GOF A;  3IJ0 A;  1C9I A;  4J84 A;  4A7J A;  1E5T A;  4NSX A;  3AFC A;  3K6S A;  3JRP A;  2VDN A;  5JWZ A;  2AGX A;  3KCI A;  4BCC A;  2XU7 A;  2HU7 A;  1VE6 A;  3O4H A;  5M5S A;  2XE4 A;  4PBZ A;  4G1E A;  3SMR A;  4A11 B;  5FKT A;  3CFS B;  3OL2 A;  2IUV A;  4A2M A;  3PSL A;  5I5I A;  2YMU A;  2AQ5 A;  3PVU B;  4BCB A;  2CE8 A;  5TDH B;  5H14 A;  3OKY B;  3DDU A;  1U2V C;  3NIG A;  5EMM B;  5TF2 A;  5E6S A;  4O1Q D;  4A0A B;  4K3I D;  1UOO A;  4BL0 A;  1K32 A;  2YNN A;  2EIE A;  5CXC A;  4PC0 A;  5GSA A;  2QXV A;  4Z7O A;  4AEZ A;  2OK6 A;  4G55 A;  5M5R A;  3V9F A;  5B4W A;  4FWW A;  4YVD A;  3UKR C;  4J86 A;  3EU7 A;  3RLM D;  2MTA H;  1FWX A;  2EBS A;  4BP9 A;  5SXM A;  4GM8 A;  4ERQ A;  2QR5 A;  3I89 A;  3FM0 A;  3IUN A;  3SLE D;  4D9S A;  4FA9 D;  3I8C A;  1JTD B;  2J55 H;  2AH1 A;  3FCS A;  2CN3 A;  4MK0 B;  4WK2 A;  4ES0 A;  1SQJ A;  2H9M A;  1A0R B;  1VYH C;  4K3J B;  3IVM A;  4GQ1 A;  4L3G D;  3K27 A;  2IUP A;  4I79 A;  3I7N A;  3PXT D;  1GP2 B;  3OL2 B;  2TRC B;  3JZN A;  4NBM A;  5GMK n;  4A11 A;  2VDO A;  4CC9 A;  4OWR A;  3KRW B;  1YFQ A;  3IUQ A;  1OLZ A;  2AGY A;  3I7P A;  5TEE A;  4FA1 D;  4U1E I;  2XL2 A;  3I7K A;  1N6F A;  2HU8 A;  1L5G A;  2VZ3 A;  2XDW A;  2CN2 A;  2HYE A;  3N0E A;  4CI1 A;  3SHF A;  5H17 A;  3ZDZ A;  4ZOZ A;  4FAV D;  1VE7 A;  3MXX A;  4FA5 D;  4GGA A;  4Z8L A;  4AN1 A;  3U4Y A;  3IJ1 A;  4L9O A;  5EML B;  4L1M A;  1UOP A;  2IAA A;  4Z7Q A;  5IGO A;  4L3H D;  1QNI A;  5FLX g;  4PSW B;  4H5I A;  4QRJ A;  4BCD A;  4CI8 A;  2H14 A;  2XYI A;  4PSX B;  5IT9 g;  1N6E A;  1OMW B;  3EMH A;  3I2N A;  1JOF A;  5M61 A;  4XYI A;  5I5J A;  3VI3 A;  3V7D B;  3ZE2 A;  3GRE A;  4BH6 A;  1YR2 A;  5M5U A;  4CZY A;  2J56 H;  3EQ9 A;  3ULE C;  4UI9 R;  4JD2 C;  2OIZ A;  3DSM A;  3VH0 A;  5C2V B;  5KDO B;  3GD1 I;  3AL8 B;  2VDK A;  2I0S A;  4A09 B;  3B7F A;  4J8G A;  1E8M A;  4E5Z B;  1Q47 A;  1GXR A;  1P22 A;  3C9C A;  4N14 A;  2H47 A;  2VDP A;  3CIK B;  4JT6 C;  3T3M A;  4AN0 A;  5CXC B;  5EM2 B;  1H2X A;  3MZL A;  2GC4 A;  3SBR A;  3UKU C;  4WK0 A;  1L0Q A;  3OKY A;  2HES X;  3ZE0 A;  3PXS D;  4KFM B;  4NC4 A;  3RFG A;  2HKR A;  4GQB B;  4ESG A;  1T2X A;  1C9L A;  2PM9 A;  3MUO A;  3V4V A;  3EI1 A;  4OZU A;  3I7H A;  4Y7R A;  4DNU A;  5EMK B;  3N0D A;  4Y5R D;  3NID A;  4PXW A;  1BPO A;  1H2W A;  3SBQ A;  3RFH A;  4JT5 C;  1NR0 A;  1MDA H;  4NEN A;  4XEI C;  3F3P A;  3EWE A;  4ZOV A;  5HE0 B;  4CY1 A;  5A2Q g;  4ZOY A;  5IGQ A;  4DNW A;  1MG2 A;  3JZH A;  3C5M A;  3EG6 A;  4IRZ A;  2B4E A;  2B5N A;  2CO0 C;  3MZK A;  3ZDX A;  4QQE A;  4R7A B;  4LGN A;  3OTT A;  3VI4 A;  2H9N A;  4DNV A;  2H9L A;  4ZN4 A;  3EI1 B;  2B5M A;  2PM9 B;  2HJB A;  2W18 A;  3NVQ A;  2P9K C;  3UVM A;  3RMZ D;  4A0B B;  1PGU A;  3OF7 A;  4GMB A;  4A0B A;  4O02 A;  4PBY A;  1GG2 B;  4Z7N A;  2I0T A;  2YBA A;  4G56 B;  4J73 A;  2HJ4 A;  3P4F A;  5FQD A;  2VZ1 A;  2B5L A;  2AGL A;  3SJL D;  4BUJ C;  2IUQ A;  2BKL A;  2H3X A;  4J78 A;  5M5V A;  3MUN A;  2OVP B;  5FKQ A;  2O9K A;  4A09 A;  4AMY A;  1B9X A;  4J87 A;  3BWS A;  3V4P A;  4A2L A;  2VDL A;  2OVQ B;  2CNX A;  2VDQ A;  4D0K A;  5FA5 B;  1M1X A;  2JKX A;  5AJA A;  3DXM C;  2YNO A;  2I0R A;  2QC5 A;  4ZOX A;  1RI6 A;  5IJ7 E;  3MMY A;  3NVN A;  5TEF A;  5FKR A;  4J81 A;  2AGW A;  3NIF A;  4JSV C;  1K3I A;  3PE7 A;  1E8N A;  5HE1 B;  4O2W A;  2UZY B;  2OVR B;  2XZG A;  3CFV A;  5CXB A;  5THA A;  2I3T A;  3O4I A;  3L4M D;  3DM0 A;  3RRM C;  3W15 A;  4A08 A;  3NVX A;  2VDM A;  5FFG A;  1JMZ B;  5EAM A;  4CI3 A;  3RSE C;  3ZDY A;  5CYK A;  1TBG A;  4A08 B;  3IKO A;  4X3E A;  5C2W B;  3IUM A;  1A12 A;  1U4C A;  1U8C A;  3K72 A;  4GGD A;  2H68 A;  2VC2 A;  5I5M A;  3O4G A;  2Q7Q A;  4MMX A;  3EI2 B;  4FB1 D;  3UVN A;  3AH8 B;  2IUR A;  4PNK B;  5EAL A;  3L4O D;  3HFQ A;  4AX4 A;  3QI0 A;  3EI3 B;  4H5J A;  4UM8 A;  3DXK C;  5GXI A;  1N6D A;  1B9Y A;  3EI4 B;  4IMM A;  5E6U A;  1JJU B;  5AMS A;  1SHY B;  3C75 H;  3JAM g;  3PSC B;  3PXW D;  3IUR A;  5FFO A;  2PM6 B;  5M5T A;  1VZ3 A;  3ODT A;  5C9Z B;  1GOG A;  5K19 A;  3SVW D;  3I7O A;  3ZWL B;  2HKM A;  1QFM A;  4AMZ A;  2H6N A;  2PM7 B;  2PBI B;  5CYK B;  5EMJ B;  2H6K A;  3K26 A;  3IJC A;  4ERY A;  2AGZ A;  4LG8 A;  4E54 A; 
#chains in the Genus database with same CATH homology
 4X63 B;  1JMX B;  3DWL C;  4J79 A;  4QL1 A;  3I8E A;  4EWR A;  2P9S C;  3SBP A;  2GC7 A;  3UVL A;  4X61 B;  2G99 A;  3OW8 A;  3SFZ A;  3JPX A;  3UR4 A;  3VA6 A;  2Z2P A;  4IA9 A;  2OJY A;  3FGB A;  5HYN B;  4FHL A;  3GFC A;  1PEV A;  3F3F A;  2P9U C;  4CY2 A;  3SWS D;  2CE9 A;  4GZ8 A;  4XYH A;  4A0A A;  4JSP C;  2BBK H;  4O45 A;  5EAP A;  2IWF A;  4J77 A;  3F3G A;  4CZX A;  5IJ8 E;  3IIW A;  5FKS A;  2IWK A;  4GGC A;  4FAN D;  1PI6 A;  3J81 g;  4CY3 A;  3ORV D;  3A0F A;  4JXM A;  3AL9 A;  4O9D A;  1MG3 A;  2P9I C;  3J80 g;  3MKS B;  2P9P C;  4GQ2 P;  1XIP A;  2P9L C;  3JRO A;  1K8K C;  4GM3 A;  5K1C C;  3AL8 A;  3KRX B;  3PVW B;  1NEX B;  4CY5 A;  2OK4 A;  4HDJ A;  1XHM A;  2P9N C;  2XL3 A;  3EI3 A;  2H13 A;  4O3T B;  2H6Q A;  1GOT B;  4CZV A;  4J0X A;  3SXT D;  3OKW A;  2H9P A;  4E54 B;  4QT8 A;  3VGZ A;  3I7L A;  1XKS A;  3C99 A;  5H1M A;  2UZX B;  3UVO A;  3OKT A;  4J0W A;  4J82 A;  5EM2 A;  4U7A A;  3MKQ A;  1PBY B;  3E0C A;  5HQG A;  5HE2 B;  4J8B A;  5EAR A;  2YNP A;  2BCJ B;  4E5Z A;  1TYQ C;  3EI4 A;  3RN1 D;  2G9A A;  3BG1 A;  4O3U B;  3V5W B;  1S4U X;  3RN0 D;  2YB8 B;  4JSX C;  5IC7 A;  1ERJ A;  4ERZ A;  5AFU 3;  2GNQ A;  5HE3 B;  4L1Q D;  3BG0 A;  1R5M A;  4D6V A;  3SN6 B;  4TZ4 A;  5GXH A;  4FA4 D;  2J57 G;  2CO0 A;  4X60 B;  2HXC A;  3JB9 L;  3SCY A;  4JSN C;  3JZG A;  4GM9 A;  5CXB B;  3UVK A;  2Z2N A;  3FRX A;  2AH0 A;  4AOW A;  5FXY A;  4CI2 A;  4LG9 A;  2I3S A;  1SQ9 A;  3IIY A;  2Z2O A;  3EI2 A;  3IJ0 A;  4J84 A;  4A7J A;  4NSX A;  3AFC A;  3JRP A;  5JWZ A;  2AGX A;  2XU7 A;  4PBZ A;  3SMR A;  4A11 B;  5FKT A;  3CFS B;  3OL2 A;  2IUV A;  4A2M A;  3PSL A;  5I5I A;  2YMU A;  2AQ5 A;  3PVU B;  2CE8 A;  5TDH B;  5H14 A;  3OKY B;  1U2V C;  5EMM B;  5TF2 A;  4A0A B;  4O1Q D;  4K3I D;  4BL0 A;  1K32 A;  2YNN A;  5CXC A;  4PC0 A;  5GSA A;  2QXV A;  4AEZ A;  2OK6 A;  3V9F A;  5B4W A;  4FWW A;  4YVD A;  3UKR C;  4J86 A;  3EU7 A;  3RLM D;  2MTA H;  1FWX A;  2EBS A;  5SXM A;  4GM8 A;  4ERQ A;  3I89 A;  3FM0 A;  3SLE D;  4FA9 D;  3I8C A;  2J55 H;  2AH1 A;  2CN3 A;  4MK0 B;  4ES0 A;  1SQJ A;  2H9M A;  1A0R B;  1VYH C;  4K3J B;  4GQ1 A;  4L3G D;  3K27 A;  2IUP A;  4I79 A;  3I7N A;  3PXT D;  1GP2 B;  3OL2 B;  2TRC B;  3JZN A;  5GMK n;  4A11 A;  4CC9 A;  4OWR A;  3KRW B;  1YFQ A;  1OLZ A;  2AGY A;  3I7P A;  5TEE A;  4FA1 D;  4U1E I;  2XL2 A;  3I7K A;  1N6F A;  2CN2 A;  2HYE A;  3N0E A;  4CI1 A;  3SHF A;  5H17 A;  4ZOZ A;  4FAV D;  3MXX A;  4FA5 D;  4GGA A;  4Z8L A;  3U4Y A;  3IJ1 A;  4L9O A;  5EML B;  2IAA A;  5IGO A;  4L3H D;  1QNI A;  5FLX g;  4PSW B;  4H5I A;  4QRJ A;  4CI8 A;  2H14 A;  2XYI A;  4PSX B;  5IT9 g;  1N6E A;  1OMW B;  3EMH A;  3I2N A;  1JOF A;  4XYI A;  5I5J A;  3V7D B;  4BH6 A;  3GRE A;  4CZY A;  2J56 H;  3ULE C;  4UI9 R;  4JD2 C;  2OIZ A;  3DSM A;  3VH0 A;  5C2V B;  5KDO B;  3AL8 B;  2I0S A;  4A09 B;  3B7F A;  4J8G A;  4E5Z B;  1Q47 A;  1GXR A;  1P22 A;  3C9C A;  4N14 A;  2H47 A;  3CIK B;  4JT6 C;  5CXC B;  5EM2 B;  3MZL A;  2GC4 A;  3SBR A;  3UKU C;  1L0Q A;  3OKY A;  2HES X;  3PXS D;  4KFM B;  3RFG A;  2HKR A;  4GQB B;  4ESG A;  2PM9 A;  3EI1 A;  4OZU A;  3I7H A;  4Y7R A;  5EMK B;  3N0D A;  4Y5R D;  4PXW A;  3SBQ A;  3RFH A;  4JT5 C;  1NR0 A;  1MDA H;  4XEI C;  3F3P A;  3EWE A;  4ZOV A;  5HE0 B;  4CY1 A;  5A2Q g;  4ZOY A;  5IGQ A;  1MG2 A;  3JZH A;  3C5M A;  3EG6 A;  2B4E A;  2B5N A;  2CO0 C;  3MZK A;  4QQE A;  4R7A B;  4LGN A;  3OTT A;  2H9N A;  2H9L A;  4ZN4 A;  3EI1 B;  2B5M A;  2PM9 B;  2HJB A;  2W18 A;  3NVQ A;  2P9K C;  3UVM A;  3RMZ D;  4A0B B;  1PGU A;  4GMB A;  4A0B A;  4PBY A;  1GG2 B;  2I0T A;  2YBA A;  4G56 B;  4J73 A;  2HJ4 A;  3P4F A;  5FQD A;  2B5L A;  2AGL A;  3SJL D;  4BUJ C;  2IUQ A;  2H3X A;  4J78 A;  2OVP B;  5FKQ A;  2O9K A;  4A09 A;  1B9X A;  4J87 A;  3BWS A;  4A2L A;  2OVQ B;  2CNX A;  4D0K A;  5FA5 B;  5AJA A;  3DXM C;  2YNO A;  2I0R A;  2QC5 A;  4ZOX A;  1RI6 A;  5IJ7 E;  3MMY A;  3NVN A;  5TEF A;  5FKR A;  4J81 A;  2AGW A;  4JSV C;  3PE7 A;  5HE1 B;  2UZY B;  2OVR B;  3CFV A;  5CXB A;  5THA A;  2I3T A;  3L4M D;  3DM0 A;  3RRM C;  3W15 A;  4A08 A;  3NVX A;  1JMZ B;  5EAM A;  4CI3 A;  3RSE C;  5CYK A;  1TBG A;  4A08 B;  3IKO A;  4X3E A;  5C2W B;  1U4C A;  4GGD A;  2H68 A;  5I5M A;  2Q7Q A;  3EI2 B;  4FB1 D;  3UVN A;  3AH8 B;  2IUR A;  4PNK B;  5EAL A;  3L4O D;  3HFQ A;  3EI3 B;  4H5J A;  3DXK C;  5GXI A;  1N6D A;  1B9Y A;  3EI4 B;  4IMM A;  1JJU B;  5AMS A;  1SHY B;  3C75 H;  3JAM g;  3PSC B;  3PXW D;  2PM6 B;  3ODT A;  5C9Z B;  5K19 A;  3SVW D;  3I7O A;  3ZWL B;  2HKM A;  2H6N A;  2PM7 B;  2PBI B;  5CYK B;  5EMJ B;  2H6K A;  3K26 A;  3IJC A;  4ERY A;  2AGZ A;  4LG8 A;  4E54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...