4GM9A

Crystal structure of human wd repeat domain 5 with compound mm-401
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
309
Chain Sequence
TQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords WD repeat-containing protein 5
publication title Crystal structure of human WD repeat domain 5 with compound MM-401
rcsb
source organism Homo sapiens
total genus 99
structure length 309
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gm9A00
4E5ZA 2AGXA 1XKSA 5IT9g 2HESX 4J73A 5FKRA 1TBGA 1VYHC 5FKTA 2UZXB 4X61B 2QXVA 1ERJA 3RMZD 4BH6A 3V7DB 4A11A 4ZOYA 5TF2A 4GGCA 2YMUA 5GXHA 3EI2B 4CY2A 3J80g 2TRCB 5CXCA 4A08A 3KRXB 4OZUA 3AL8A 3OL2A 3ULEC 3MMYA 5I5JA 3PSCB 5IC7A 5HYNB 3RFGA 5I5IA 1PGUA 4X60B 3MXXA 5HE3B 1OMWB 5THAA 3RSEC 5EMLB 3RFHA 3BWSA 4FAVD 2J55H 3SFZA 5GMKn 3PVWB 5IJ8E 2YNPA 4PSWB 2P9UC 4A0AB 3I7KA 4LG9A 1XHMA 3C5MA 4JSVC 5JWZA 5KDOB 3PXSD 3ZWLB 3UR4A 1L0QA 3I8CA 3JAMg 3I7HA 4Y7RA 4J86A 1A0RB 4E54A 2OK4A 5EARA 1GOTB 4QT8A 5H1MA 3PXWD 3RLMD 4CZXA 4R7AB 3OW8A 3F3GA 4FA9D 5EMMB 4A2MA 1GXRA 2QC5A 4PC0A 5IGOA 2YNOA 2IUPA 1MDAH 3F3FA 3UVKA 3IJCA 3SCYA 5C9ZB 2I0TA 2P9PC 5A2Qg 2OVPB 4GGAA 4J0WA 4UI9R 5SXMA 3SWSD 4CI8A 2PM7B 2UZYB 4CI2A 3PVUB 4CC9A 3IIWA 3EMHA 2OIZA 1QNIA 1N6EA 3EU7A 3JZNA 3SBQA 2PM9A 4J78A 4L9OA 1GG2B 1P22A 3L4OD 4GM9A 4N14A 4PBYA 4QQEA 3U4YA 3EI1B 3I2NA 3UVMA 4A0BB 4I79A 4ZN4A 4K3JB 4KFMB 1SQ9A 3I7NA 1B9YA 1U2VC 5GSAA 1N6DA 3DSMA 5H14A 5AMSA 2J57G 3IJ1A 5IGQA 4FA4D 2I0SA 4PXWA 2IUVA 2OVRB 3C99A 1U4CA 2EBSA 2H9LA 3L4MD 4O1QD 3AFCA 2AQ5A 2GC4A 4GGDA 2HXCA 4K3ID 2YB8B 4Y5RD 4LG8A 2AGLA 3UVOA 3FGBA 3BG1A 4J87A 2HKMA 3N0EA 2H6QA 2PM6B 4GQBB 3RRMC 2O9KA 3I7LA 1OLZA 2XL2A 2B5LA 3EI4B 2CO0C 5HE0B 1YFQA 4CZYA 2BCJB 5CXBB 1NEXB 2OK6A 2P9KC 3AH8B 2G9AA 2P9LC 3I8EA 2I3SA 2HYEA 3JRPA 4O45A 4NSXA 2AGWA 5EMKB 3AL9A 2Z2OA 1Q47A 4J82A 3EG6A 4YVDA 2B5MA 4CI3A 4H5JA 3EI2A 1MG3A 5FLXg 5FKSA 4GQ2P 1NR0A 5K1CC 4J8BA 2Z2PA 4ZOZA 4CI1A 5TEFA 3NVNA 3V5WB 4FAND 5C2WB 5B4WA 3B7FA 3MZLA 3SXTD 4EWRA 2IURA 3OTTA 4BL0A 4X63B 4X3EA 5C2VB 3IKOA 3W15A 4G56B 2B4EA 2CN2A 3A0FA 1RI6A 1PBYB 3C75H 2P9IC 5I5MA 1K32A 2HKRA 2I3TA 4JT5C 2IUQA 4A0AA 3VGZA 1JJUB 1MG2A 3JZHA 4A09B 5K19A 4GMBA 5FA5B 2YBAA 2H13A 3EI3B 5HE1B 3ORVD 3F3PA 5TDHB 3SN6B 2H6NA 1JOFA 4JSPC 2Q7QA 3UKUC 3FM0A 2AH1A 5EAPA 2CN3A 5EM2B 3OKYB 4JD2C 4ES0A 3BG0A 4ESGA 4ERYA 2I0RA 1FWXA 3PSLA 2P9NC 5CYKB 2IAAA 4E5ZB 3P4FA 4JXMA 3VH0A 2H9MA 4A2LA 4MK0B 4PNKB 3PXTD 4ERQA 4JSXC 4A11B 4J0XA 4J77A 5H17A 4H5IA 5FXYA 3MZKA 4CY1A 3JB9L 5CXCB 4A08B 3I89A 3J81g 4U1EI 3AL8B 4J79A 2GC7A 3OL2B 3SHFA 2Z2NA 2XU7A 3JZGA 3EWEA 4U7AA 3EI1A 3I7PA 3VA6A 3NVXA 4TZ4A 4ZOVA 3JPXA 4A0BA 5EAMA 4IMMA 3SJLD 4AOWA 3SBRA 4ERZA 4XYHA 4L3GD 3DXMC 2CNXA 4QL1A 1SQJA 3N0DA 4FA5D 2H9PA 4A7JA 5FKQA 3UVLA 5TEEA 3SVWD 2H47A 2XL3A 3GREA 1N6FA 3I7OA 5HE2B 3DWLC 2P9SC 4JSNC 3MKSB 1S4UX 3K26A 3OKTA 3DXKC 3C9CA 2OVQB 4E54B 3V9FA 2IWKA 4L1QD 1K8KC 5IJ7E 3EI4A 4CY5A 3K27A 4GZ8A 5CXBA 3SBPA 1PEVA 4L3HD 1SHYB 4JT6C 4HDJA 2OJYA 4J84A 3SMRA 4XEIC 4PBZA 4D6VA 4FA1D 3CFSB 2J56H 1R5MA 1XIPA 2AGZA 4D0KA 3SLED 3JROA 2GNQA 3E0CA 2HJBA 3HFQA 3RN0D 2AGYA 2XYIA 5HQGA 2G99A 2PM9B 3RN1D 2B5NA 2BBKH 5EMJB 4O3UB 1GP2B 3ODTA 4GM8A 4PSXB 2YNNA 3CFVA 2IWFA 2H14A 4OWRA 3DM0A 3KRWB 2H68A 4O3TB 3CIKB 1B9XA 4QRJA 2CE8A 3NVQA 4LGNA 4GM3A 4CZVA 4FHLA 1JMXB 2AH0A 1JMZB 2H3XA 4O9DA 2H6KA 4XYIA 5EALA 2CO0A 4AEZA 3GFCA 5AJAA 5AFU3 4A09A 4Z8LA 3PE7A 1TYQC 2MTAH 3UVNA 4IA9A 4ZOXA 3EI3A 3MKQA 4CY3A 3FRXA 5FQDA 4FB1D 3IIYA 4J81A 2W18A 2H9NA 1PI6A 4J8GA 5EM2A 3OKYA 3UKRC 2CE9A 5GXIA 3OKWA 2PBIB 4BUJC 4GQ1A 2HJ4A 4FWWA 3IJ0A 5CYKA
chains in the Genus database with same CATH superfamily
4E5ZA 2AGXA 1XKSA 5IT9g 2HESX 4J73A 5FKRA 1TBGA 1VYHC 5FKTA 2UZXB 4X61B 2QXVA 5E6SA 1ERJA 3RMZD 4BH6A 3V7DB 4A11A 1JV2A 4G1EA 4ZOYA 5TF2A 1H2XA 4GGCA 2YMUA 5GXHA 3EI2B 4CY2A 3J80g 4QAMA 2TRCB 5CXCA 4A08A 3KRXB 4OZUA 3ZDZA 3AL8A 3OL2A 5M5TA 3ULEC 3MMYA 5I5JA 3PSCB 5IC7A 5HYNB 3RFGA 5I5IA 1E8NA 2EICA 2VDMA 1PGUA 4X60B 1VE6A 3MXXA 5HE3B 4L1MA 4O2WA 3IJEA 1OMWB 3O4IA 4BCBA 5THAA 3RSEC 1BPOA 5C86A 5EMLB 3RFHA 1O6GA 3BWSA 4FAVD 2J55H 3SFZA 5GMKn 2XZGA 3PVWB 4Z7OA 5IJ8E 2YNPA 4PSWB 2P9UC 4A0AB 3I7KA 1UOPA 4LG9A 1XHMA 3C5MA 4JSVC 5JWZA 5KDOB 3PXSD 3ZWLB 3UR4A 1L0QA 3I8CA 3ZDYA 3JAMg 3I7HA 4Y7RA 4J86A 1A0RB 4E54A 2OK4A 5EARA 1UOQA 1GOTB 3VI4A 4QT8A 5H1MA 1QFSA 3PXWD 3RLMD 1JTDB 4CZXA 2HU8A 3QHYB 4R7AB 3OW8A 2VDOA 3F3GA 4FA9D 4WJKA 4A2MA 4AMYA 5EMMB 1GXRA 2QC5A 4PC0A 5IGOA 2YNOA 2IUPA 1MDAH 3F3FA 3UVKA 3IJCA 3SCYA 5C9ZB 2I0TA 2P9PC 5A2Qg 2OVPB 4GGAA 2HU7A 4J0WA 4MMXA 4UI9R 4JHPC 5M5RA 5SXMA 3SWSD 4CI8A 4D9SA 2PM7B 2UZYB 3DDUA 4CI2A 3PVUB 4CC9A 1I2MB 2EIBA 3IIWA 3EMHA 2OIZA 1QNIA 1N6EA 3EU7A 3JZNA 1A12A 3SBQA 2PM9A 3GD1I 4J78A 3IULA 1GG2B 1P22A 4L9OA 3L4OD 4DNWA 4GM9A 4N14A 4PBYA 4QQEA 3U4YA 3EI1B 5FFOA 3I2NA 3UVMA 1QFMA 4A0BB 4I79A 4ZN4A 4K3JB 4KFMB 1SQ9A 3I7NA 2VZ1A 1B9YA 1U2VC 5GSAA 1N6DA 3DSMA 4MMYA 5H14A 5AMSA 2J57G 3IJ1A 1U8CA 5IGQA 4FA4D 2VDPA 2I0SA 4PXWA 2IUVA 1E5TA 2OVRB 3C99A 1U4CA 2EBSA 2H9LA 3L4MD 3OF7A 4O1QD 3AFCA 2AQ5A 2GC4A 4GGDA 2HXCA 3GC3B 3MUNA 4K3ID 2YB8B 4Y5RD 4LG8A 2AGLA 3UVOA 3FGBA 3BG1A 4J87A 2HKMA 3N0EA 2H6QA 2PM6B 4GQBB 3RRMC 2O9KA 1H2WA 3I7LA 3V4PA 1OLZA 2XL2A 2B5LA 2VDKA 3EI4B 2CO0C 5HE0B 1YFQA 3O4JA 4CZYA 2BCJB 4NAAA 2VDNA 5CXBB 1NEXB 2OK6A 2P9KC 3AH8B 2G9AA 2P9LC 3I8EA 2I3SA 1E8MA 2HYEA 4AN1A 3JRPA 4O45A 3ZE1A 4NSXA 2AGWA 3IUQA 2WQ8A 5EMKB 3AL9A 2Z2OA 3QI0A 1Q47A 4J82A 3EG6A 4YVDA 2B5MA 4CI3A 4H5JA 3K72A 4O02A 3EI2A 1MG3A 1UOOA 5FLXg 5FKSA 4GQ2P 1NR0A 5K1CC 4J8BA 4AN0A 2XDWA 2Z2PA 4ZOZA 4CI1A 5TEFA 3NVNA 3V5WB 4FAND 5C2WB 5B4WA 3O4HA 3B7FA 3MZLA 3SXTD 4EWRA 4WK2A 2IURA 3OTTA 4BL0A 4BCCA 4X63B 4X3EA 5C2VB 3IKOA 3W15A 4G56B 2B4EA 2CN2A 4WK4A 3A0FA 1RI6A 1PBYB 3C75H 2P9IC 5E6RA 5I5MA 2XE4A 1K32A 2HKRA 2I3TA 3ZE2A 4JT5C 1GOGA 2IUQA 4A0AA 3VGZA 1JJUB 3FCUA 1MG2A 3IUJA 3JZHA 4A09B 5K19A 4GMBA 5FA5B 2YBAA 2H13A 3EI3B 5HE1B 3ORVD 3F3PA 5TDHB 3SN6B 2H6NA 1JOFA 1TYEA 4JSPC 2Q7QA 3UKUC 1H2ZA 3FM0A 2VDQA 2AH1A 5EAPA 2CN3A 5EM2B 3OKYB 4MMZA 4JD2C 2HU5A 4ES0A 3BG0A 4UM9A 4ESGA 4ERYA 2I0RA 4G1MA 1FWXA 3PSLA 3IVMA 2P9NC 5CYKB 2IAAA 4E5ZB 3P4FA 4JXMA 3T3MA 3VH0A 2H9MA 4A2LA 4MK0B 4PNKB 4AMZA 3PXTD 4ERQA 4JSXC 4A11B 4J0XA 1VE7A 4BCDA 4J77A 5H17A 4H5IA 5FXYA 3MZKA 4CY1A 3JB9L 5CXCB 4BP8A 4A08B 3I89A 2EIDA 3J81g 4U1EI 2BKLA 3AL8B 2GC7A 4J79A 3MVDK 3OL2B 3SHFA 5M5VA 2Z2NA 1K3IA 2XU7A 1M1XA 3JZGA 3EWEA 3EQ9A 4U7AA 3EI1A 5FFGA 3I7PA 3VA6A 3IUMA 3NVXA 4TZ4A 4ZOVA 3JPXA 4A0BA 5EAMA 4IMMA 2VZ3A 3SJLD 2VDLA 4NBMA 3SBRA 4AOWA 4ERZA 4XYHA 4L3GD 3DXMC 3O4GA 3K6SA 2CNXA 2QR5A 4QL1A 5C92A 1SQJA 3N0DA 4FA5D 3EQ8A 2H9PA 4A7JA 4IRZA 5FKQA 5TEEA 3UVLA 3SVWD 2H47A 1T2XA 5HDBA 3EQ7A 2XL3A 2VC2A 3GREA 1N6FA 3I7OA 5HE2B 4BP9A 3T3PA 2VDRA 3DWLC 2P9SC 4JSNC 4RE6A 1C9IA 3MKSB 1S4UX 3K26A 4DNUA 4NC4A 3OKTA 3DXKC 3C9CA 2OVQB 4E54B 4UM8A 1GOFA 3V9FA 3ZDXA 4WK0A 4DNVA 2IWKA 4L1QD 1K8KC 5IJ7E 3EI4A 1GOHA 1YR2A 5E6UA 3KCIA 3K27A 4GZ8A 4CY5A 5CXBA 3SBPA 1PEVA 4L3HD 1SHYB 1UTCA 3NIDA 4JT6C 4HDJA 2OJYA 4J84A 3SMRA 4XEIC 4PBZA 4D6VA 4FA1D 2EIEA 3CFSB 3MUOA 2J56H 1R5MA 1XIPA 3ZE0A 2AGZA 4D0KA 3NIFA 3SLED 3JROA 2GNQA 3E0CA 4RE5A 5M61A 2HJBA 3HFQA 3RN0D 2AGYA 4Z7NA 3K71A 2XYIA 5HQGA 2G99A 5M5SA 3FCSA 2PM9B 3RN1D 2B5NA 3IURA 1C9LA 2BBKH 5EMJB 4O3UB 1GP2B 3ODTA 1VZ3A 4GM8A 4PSXB 4NENA 2YNNA 3CFVA 4AX4A 2IWFA 2H14A 4OWRA 3DM0A 3KRWB 2H68A 4O3TB 3CIKB 2JKXA 1B9XA 4QRJA 2CE8A 3NVQA 4LGNA 5M5UA 4GM3A 4CZVA 4FHLA 1JMXB 2AH0A 3IUNA 4Z7QA 1JMZB 2H3XA 4O9DA 2H6KA 4XYIA 5EALA 2CO0A 1H2YA 4AEZA 1O6FA 3GFCA 5AJAA 3NIGA 5AFU3 4A09A 4Z8LA 3PE7A 1TYQC 3V4VA 1L5GA 2MTAH 3UVNA 4IA9A 4ZOXA 3VI3A 3EI3A 4JHNA 3MKQA 4CY3A 3FRXA 5FQDA 4FB1D 3IIYA 4J81A 1VZ2A 2W18A 2H9NA 4G55A 1PI6A 4J8GA 5EM2A 3OKYA 3UKRC 2CE9A 5GXIA 3OKWA 2PBIB 4BUJC 4GQ1A 2HJ4A 4FWWA 2QZPA 3IJ0A 5CYKA
chains in the Genus database with same CATH topology
4E5ZA 2AGXA 1XKSA 5IT9g 2HESX 4J73A 5FKRA 1TBGA 1VYHC 5FKTA 2UZXB 4X61B 2QXVA 1ERJA 3RMZD 4BH6A 3V7DB 4A11A 4ZOYA 5TF2A 4GGCA 2YMUA 5GXHA 3EI2B 4CY2A 3J80g 2TRCB 5CXCA 4A08A 3KRXB 4OZUA 3AL8A 3OL2A 3ULEC 3MMYA 5I5JA 3PSCB 5IC7A 5HYNB 3RFGA 5I5IA 1PGUA 4X60B 3MXXA 5HE3B 1OMWB 5THAA 3RSEC 5EMLB 3RFHA 3BWSA 4FAVD 2J55H 3SFZA 5GMKn 3PVWB 5IJ8E 2YNPA 4PSWB 2P9UC 4A0AB 3I7KA 4LG9A 1XHMA 3C5MA 4JSVC 5JWZA 5KDOB 3PXSD 3ZWLB 3UR4A 1L0QA 3I8CA 3JAMg 3I7HA 4Y7RA 4J86A 1A0RB 4E54A 2OK4A 5EARA 1GOTB 4QT8A 5H1MA 3PXWD 3RLMD 4CZXA 4R7AB 3OW8A 3F3GA 4FA9D 5EMMB 4A2MA 1GXRA 2QC5A 4PC0A 5IGOA 2YNOA 2IUPA 1MDAH 3F3FA 3UVKA 3IJCA 3SCYA 5C9ZB 2I0TA 2P9PC 5A2Qg 2OVPB 4GGAA 4J0WA 4UI9R 5SXMA 3SWSD 4CI8A 2PM7B 2UZYB 4CI2A 3PVUB 4CC9A 3IIWA 3EMHA 2OIZA 1QNIA 1N6EA 3EU7A 3JZNA 3SBQA 2PM9A 4J78A 4L9OA 1GG2B 1P22A 3L4OD 4GM9A 4N14A 4PBYA 4QQEA 3U4YA 3EI1B 3I2NA 3UVMA 4A0BB 4I79A 4ZN4A 4K3JB 4KFMB 1SQ9A 3I7NA 1B9YA 1U2VC 5GSAA 1N6DA 3DSMA 5H14A 5AMSA 2J57G 3IJ1A 5IGQA 4FA4D 2I0SA 4PXWA 2IUVA 2OVRB 3C99A 1U4CA 2EBSA 2H9LA 3L4MD 4O1QD 3AFCA 2AQ5A 2GC4A 4GGDA 2HXCA 4K3ID 2YB8B 4Y5RD 4LG8A 2AGLA 3UVOA 3FGBA 3BG1A 4J87A 2HKMA 3N0EA 2H6QA 2PM6B 4GQBB 3RRMC 2O9KA 3I7LA 1OLZA 2XL2A 2B5LA 3EI4B 2CO0C 5HE0B 1YFQA 4CZYA 2BCJB 5CXBB 1NEXB 2OK6A 2P9KC 3AH8B 2G9AA 2P9LC 3I8EA 2I3SA 2HYEA 3JRPA 4O45A 4NSXA 2AGWA 5EMKB 3AL9A 2Z2OA 1Q47A 4J82A 3EG6A 4YVDA 2B5MA 4CI3A 4H5JA 3EI2A 1MG3A 5FLXg 5FKSA 4GQ2P 1NR0A 5K1CC 4J8BA 2Z2PA 4ZOZA 4CI1A 5TEFA 3NVNA 3V5WB 4FAND 5C2WB 5B4WA 3B7FA 3MZLA 3SXTD 4EWRA 2IURA 3OTTA 4BL0A 4X63B 4X3EA 5C2VB 3IKOA 3W15A 4G56B 2B4EA 2CN2A 3A0FA 1RI6A 1PBYB 3C75H 2P9IC 5I5MA 1K32A 2HKRA 2I3TA 4JT5C 2IUQA 4A0AA 3VGZA 1JJUB 1MG2A 3JZHA 4A09B 5K19A 4GMBA 5FA5B 2YBAA 2H13A 3EI3B 5HE1B 3ORVD 3F3PA 5TDHB 3SN6B 2H6NA 1JOFA 4JSPC 2Q7QA 3UKUC 3FM0A 2AH1A 5EAPA 2CN3A 5EM2B 3OKYB 4JD2C 4ES0A 3BG0A 4ESGA 4ERYA 2I0RA 1FWXA 3PSLA 2P9NC 5CYKB 2IAAA 4E5ZB 3P4FA 4JXMA 3VH0A 2H9MA 4A2LA 4MK0B 4PNKB 3PXTD 4ERQA 4JSXC 4A11B 4J0XA 4J77A 5H17A 4H5IA 5FXYA 3MZKA 4CY1A 3JB9L 5CXCB 4A08B 3I89A 3J81g 4U1EI 3AL8B 4J79A 2GC7A 3OL2B 3SHFA 2Z2NA 2XU7A 3JZGA 3EWEA 4U7AA 3EI1A 3I7PA 3VA6A 3NVXA 4TZ4A 4ZOVA 3JPXA 4A0BA 5EAMA 4IMMA 3SJLD 4AOWA 3SBRA 4ERZA 4XYHA 4L3GD 3DXMC 2CNXA 4QL1A 1SQJA 3N0DA 4FA5D 2H9PA 4A7JA 5FKQA 3UVLA 5TEEA 3SVWD 2H47A 2XL3A 3GREA 1N6FA 3I7OA 5HE2B 3DWLC 2P9SC 4JSNC 3MKSB 1S4UX 3K26A 3OKTA 3DXKC 3C9CA 2OVQB 4E54B 3V9FA 2IWKA 4L1QD 1K8KC 5IJ7E 3EI4A 4CY5A 3K27A 4GZ8A 5CXBA 3SBPA 1PEVA 4L3HD 1SHYB 4JT6C 4HDJA 2OJYA 4J84A 3SMRA 4XEIC 4PBZA 4D6VA 4FA1D 3CFSB 2J56H 1R5MA 1XIPA 2AGZA 4D0KA 3SLED 3JROA 2GNQA 3E0CA 2HJBA 3HFQA 3RN0D 2AGYA 2XYIA 5HQGA 2G99A 2PM9B 3RN1D 2B5NA 2BBKH 5EMJB 4O3UB 1GP2B 3ODTA 4GM8A 4PSXB 2YNNA 3CFVA 2IWFA 2H14A 4OWRA 3DM0A 3KRWB 2H68A 4O3TB 3CIKB 1B9XA 4QRJA 2CE8A 3NVQA 4LGNA 4GM3A 4CZVA 4FHLA 1JMXB 2AH0A 1JMZB 2H3XA 4O9DA 2H6KA 4XYIA 5EALA 2CO0A 4AEZA 3GFCA 5AJAA 5AFU3 4A09A 4Z8LA 3PE7A 1TYQC 2MTAH 3UVNA 4IA9A 4ZOXA 3EI3A 3MKQA 4CY3A 3FRXA 5FQDA 4FB1D 3IIYA 4J81A 2W18A 2H9NA 1PI6A 4J8GA 5EM2A 3OKYA 3UKRC 2CE9A 5GXIA 3OKWA 2PBIB 4BUJC 4GQ1A 2HJ4A 4FWWA 3IJ0A 5CYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E5Z A;  2AGX A;  1XKS A;  5IT9 g;  2HES X;  4J73 A;  5FKR A;  1TBG A;  1VYH C;  5FKT A;  2UZX B;  4X61 B;  2QXV A;  1ERJ A;  3RMZ D;  4BH6 A;  3V7D B;  4A11 A;  4ZOY A;  5TF2 A;  4GGC A;  2YMU A;  5GXH A;  3EI2 B;  4CY2 A;  3J80 g;  2TRC B;  5CXC A;  4A08 A;  3KRX B;  4OZU A;  3AL8 A;  3OL2 A;  3ULE C;  3MMY A;  5I5J A;  3PSC B;  5IC7 A;  5HYN B;  3RFG A;  5I5I A;  1PGU A;  4X60 B;  3MXX A;  5HE3 B;  1OMW B;  5THA A;  3RSE C;  5EML B;  3RFH A;  3BWS A;  4FAV D;  2J55 H;  3SFZ A;  5GMK n;  3PVW B;  5IJ8 E;  2YNP A;  4PSW B;  2P9U C;  4A0A B;  3I7K A;  4LG9 A;  1XHM A;  3C5M A;  4JSV C;  5JWZ A;  5KDO B;  3PXS D;  3ZWL B;  3UR4 A;  1L0Q A;  3I8C A;  3JAM g;  3I7H A;  4Y7R A;  4J86 A;  1A0R B;  4E54 A;  2OK4 A;  5EAR A;  1GOT B;  4QT8 A;  5H1M A;  3PXW D;  3RLM D;  4CZX A;  4R7A B;  3OW8 A;  3F3G A;  4FA9 D;  5EMM B;  4A2M A;  1GXR A;  2QC5 A;  4PC0 A;  5IGO A;  2YNO A;  2IUP A;  1MDA H;  3F3F A;  3UVK A;  3IJC A;  3SCY A;  5C9Z B;  2I0T A;  2P9P C;  5A2Q g;  2OVP B;  4GGA A;  4J0W A;  4UI9 R;  5SXM A;  3SWS D;  4CI8 A;  2PM7 B;  2UZY B;  4CI2 A;  3PVU B;  4CC9 A;  3IIW A;  3EMH A;  2OIZ A;  1QNI A;  1N6E A;  3EU7 A;  3JZN A;  3SBQ A;  2PM9 A;  4J78 A;  4L9O A;  1GG2 B;  1P22 A;  3L4O D;  4GM9 A;  4N14 A;  4PBY A;  4QQE A;  3U4Y A;  3EI1 B;  3I2N A;  3UVM A;  4A0B B;  4I79 A;  4ZN4 A;  4K3J B;  4KFM B;  1SQ9 A;  3I7N A;  1B9Y A;  1U2V C;  5GSA A;  1N6D A;  3DSM A;  5H14 A;  5AMS A;  2J57 G;  3IJ1 A;  5IGQ A;  4FA4 D;  2I0S A;  4PXW A;  2IUV A;  2OVR B;  3C99 A;  1U4C A;  2EBS A;  2H9L A;  3L4M D;  4O1Q D;  3AFC A;  2AQ5 A;  2GC4 A;  4GGD A;  2HXC A;  4K3I D;  2YB8 B;  4Y5R D;  4LG8 A;  2AGL A;  3UVO A;  3FGB A;  3BG1 A;  4J87 A;  2HKM A;  3N0E A;  2H6Q A;  2PM6 B;  4GQB B;  3RRM C;  2O9K A;  3I7L A;  1OLZ A;  2XL2 A;  2B5L A;  3EI4 B;  2CO0 C;  5HE0 B;  1YFQ A;  4CZY A;  2BCJ B;  5CXB B;  1NEX B;  2OK6 A;  2P9K C;  3AH8 B;  2G9A A;  2P9L C;  3I8E A;  2I3S A;  2HYE A;  3JRP A;  4O45 A;  4NSX A;  2AGW A;  5EMK B;  3AL9 A;  2Z2O A;  1Q47 A;  4J82 A;  3EG6 A;  4YVD A;  2B5M A;  4CI3 A;  4H5J A;  3EI2 A;  1MG3 A;  5FLX g;  5FKS A;  4GQ2 P;  1NR0 A;  5K1C C;  4J8B A;  2Z2P A;  4ZOZ A;  4CI1 A;  5TEF A;  3NVN A;  3V5W B;  4FAN D;  5C2W B;  5B4W A;  3B7F A;  3MZL A;  3SXT D;  4EWR A;  2IUR A;  3OTT A;  4BL0 A;  4X63 B;  4X3E A;  5C2V B;  3IKO A;  3W15 A;  4G56 B;  2B4E A;  2CN2 A;  3A0F A;  1RI6 A;  1PBY B;  3C75 H;  2P9I C;  5I5M A;  1K32 A;  2HKR A;  2I3T A;  4JT5 C;  2IUQ A;  4A0A A;  3VGZ A;  1JJU B;  1MG2 A;  3JZH A;  4A09 B;  5K19 A;  4GMB A;  5FA5 B;  2YBA A;  2H13 A;  3EI3 B;  5HE1 B;  3ORV D;  3F3P A;  5TDH B;  3SN6 B;  2H6N A;  1JOF A;  4JSP C;  2Q7Q A;  3UKU C;  3FM0 A;  2AH1 A;  5EAP A;  2CN3 A;  5EM2 B;  3OKY B;  4JD2 C;  4ES0 A;  3BG0 A;  4ESG A;  4ERY A;  2I0R A;  1FWX A;  3PSL A;  2P9N C;  5CYK B;  2IAA A;  4E5Z B;  3P4F A;  4JXM A;  3VH0 A;  2H9M A;  4A2L A;  4MK0 B;  4PNK B;  3PXT D;  4ERQ A;  4JSX C;  4A11 B;  4J0X A;  4J77 A;  5H17 A;  4H5I A;  5FXY A;  3MZK A;  4CY1 A;  3JB9 L;  5CXC B;  4A08 B;  3I89 A;  3J81 g;  4U1E I;  3AL8 B;  4J79 A;  2GC7 A;  3OL2 B;  3SHF A;  2Z2N A;  2XU7 A;  3JZG A;  3EWE A;  4U7A A;  3EI1 A;  3I7P A;  3VA6 A;  3NVX A;  4TZ4 A;  4ZOV A;  3JPX A;  4A0B A;  5EAM A;  4IMM A;  3SJL D;  4AOW A;  3SBR A;  4ERZ A;  4XYH A;  4L3G D;  3DXM C;  2CNX A;  4QL1 A;  1SQJ A;  3N0D A;  4FA5 D;  2H9P A;  4A7J A;  5FKQ A;  3UVL A;  5TEE A;  3SVW D;  2H47 A;  2XL3 A;  3GRE A;  1N6F A;  3I7O A;  5HE2 B;  3DWL C;  2P9S C;  4JSN C;  3MKS B;  1S4U X;  3K26 A;  3OKT A;  3DXK C;  3C9C A;  2OVQ B;  4E54 B;  3V9F A;  2IWK A;  4L1Q D;  1K8K C;  5IJ7 E;  3EI4 A;  4CY5 A;  3K27 A;  4GZ8 A;  5CXB A;  3SBP A;  1PEV A;  4L3H D;  1SHY B;  4JT6 C;  4HDJ A;  2OJY A;  4J84 A;  3SMR A;  4XEI C;  4PBZ A;  4D6V A;  4FA1 D;  3CFS B;  2J56 H;  1R5M A;  1XIP A;  2AGZ A;  4D0K A;  3SLE D;  3JRO A;  2GNQ A;  3E0C A;  2HJB A;  3HFQ A;  3RN0 D;  2AGY A;  2XYI A;  5HQG A;  2G99 A;  2PM9 B;  3RN1 D;  2B5N A;  2BBK H;  5EMJ B;  4O3U B;  1GP2 B;  3ODT A;  4GM8 A;  4PSX B;  2YNN A;  3CFV A;  2IWF A;  2H14 A;  4OWR A;  3DM0 A;  3KRW B;  2H68 A;  4O3T B;  3CIK B;  1B9X A;  4QRJ A;  2CE8 A;  3NVQ A;  4LGN A;  4GM3 A;  4CZV A;  4FHL A;  1JMX B;  2AH0 A;  1JMZ B;  2H3X A;  4O9D A;  2H6K A;  4XYI A;  5EAL A;  2CO0 A;  4AEZ A;  3GFC A;  5AJA A;  5AFU 3;  4A09 A;  4Z8L A;  3PE7 A;  1TYQ C;  2MTA H;  3UVN A;  4IA9 A;  4ZOX A;  3EI3 A;  3MKQ A;  4CY3 A;  3FRX A;  5FQD A;  4FB1 D;  3IIY A;  4J81 A;  2W18 A;  2H9N A;  1PI6 A;  4J8G A;  5EM2 A;  3OKY A;  3UKR C;  2CE9 A;  5GXI A;  3OKW A;  2PBI B;  4BUJ C;  4GQ1 A;  2HJ4 A;  4FWW A;  3IJ0 A;  5CYK A; 
#chains in the Genus database with same CATH topology
 4E5Z A;  2AGX A;  1XKS A;  5IT9 g;  2HES X;  4J73 A;  5FKR A;  1TBG A;  1VYH C;  5FKT A;  2UZX B;  4X61 B;  2QXV A;  5E6S A;  1ERJ A;  3RMZ D;  4BH6 A;  3V7D B;  4A11 A;  1JV2 A;  4G1E A;  4ZOY A;  5TF2 A;  1H2X A;  4GGC A;  2YMU A;  5GXH A;  3EI2 B;  4CY2 A;  3J80 g;  4QAM A;  2TRC B;  5CXC A;  4A08 A;  3KRX B;  4OZU A;  3ZDZ A;  3AL8 A;  3OL2 A;  5M5T A;  3ULE C;  3MMY A;  5I5J A;  3PSC B;  5IC7 A;  5HYN B;  3RFG A;  5I5I A;  1E8N A;  2EIC A;  2VDM A;  1PGU A;  4X60 B;  1VE6 A;  3MXX A;  5HE3 B;  4L1M A;  4O2W A;  3IJE A;  1OMW B;  3O4I A;  4BCB A;  5THA A;  3RSE C;  1BPO A;  5C86 A;  5EML B;  3RFH A;  1O6G A;  3BWS A;  4FAV D;  2J55 H;  3SFZ A;  5GMK n;  2XZG A;  3PVW B;  4Z7O A;  5IJ8 E;  2YNP A;  4PSW B;  2P9U C;  4A0A B;  3I7K A;  1UOP A;  4LG9 A;  1XHM A;  3C5M A;  4JSV C;  5JWZ A;  5KDO B;  3PXS D;  3ZWL B;  3UR4 A;  1L0Q A;  3I8C A;  3ZDY A;  3JAM g;  3I7H A;  4Y7R A;  4J86 A;  1A0R B;  4E54 A;  2OK4 A;  5EAR A;  1UOQ A;  1GOT B;  3VI4 A;  4QT8 A;  5H1M A;  1QFS A;  3PXW D;  3RLM D;  1JTD B;  4CZX A;  2HU8 A;  3QHY B;  4R7A B;  3OW8 A;  2VDO A;  3F3G A;  4FA9 D;  4WJK A;  4A2M A;  4AMY A;  5EMM B;  1GXR A;  2QC5 A;  4PC0 A;  5IGO A;  2YNO A;  2IUP A;  1MDA H;  3F3F A;  3UVK A;  3IJC A;  3SCY A;  5C9Z B;  2I0T A;  2P9P C;  5A2Q g;  2OVP B;  4GGA A;  2HU7 A;  4J0W A;  4MMX A;  4UI9 R;  4JHP C;  5M5R A;  5SXM A;  3SWS D;  4CI8 A;  4D9S A;  2PM7 B;  2UZY B;  3DDU A;  4CI2 A;  3PVU B;  4CC9 A;  1I2M B;  2EIB A;  3IIW A;  3EMH A;  2OIZ A;  1QNI A;  1N6E A;  3EU7 A;  3JZN A;  1A12 A;  3SBQ A;  2PM9 A;  3GD1 I;  4J78 A;  3IUL A;  1GG2 B;  1P22 A;  4L9O A;  3L4O D;  4DNW A;  4GM9 A;  4N14 A;  4PBY A;  4QQE A;  3U4Y A;  3EI1 B;  5FFO A;  3I2N A;  3UVM A;  1QFM A;  4A0B B;  4I79 A;  4ZN4 A;  4K3J B;  4KFM B;  1SQ9 A;  3I7N A;  2VZ1 A;  1B9Y A;  1U2V C;  5GSA A;  1N6D A;  3DSM A;  4MMY A;  5H14 A;  5AMS A;  2J57 G;  3IJ1 A;  1U8C A;  5IGQ A;  4FA4 D;  2VDP A;  2I0S A;  4PXW A;  2IUV A;  1E5T A;  2OVR B;  3C99 A;  1U4C A;  2EBS A;  2H9L A;  3L4M D;  3OF7 A;  4O1Q D;  3AFC A;  2AQ5 A;  2GC4 A;  4GGD A;  2HXC A;  3GC3 B;  3MUN A;  4K3I D;  2YB8 B;  4Y5R D;  4LG8 A;  2AGL A;  3UVO A;  3FGB A;  3BG1 A;  4J87 A;  2HKM A;  3N0E A;  2H6Q A;  2PM6 B;  4GQB B;  3RRM C;  2O9K A;  1H2W A;  3I7L A;  3V4P A;  1OLZ A;  2XL2 A;  2B5L A;  2VDK A;  3EI4 B;  2CO0 C;  5HE0 B;  1YFQ A;  3O4J A;  4CZY A;  2BCJ B;  4NAA A;  2VDN A;  5CXB B;  1NEX B;  2OK6 A;  2P9K C;  3AH8 B;  2G9A A;  2P9L C;  3I8E A;  2I3S A;  1E8M A;  2HYE A;  4AN1 A;  3JRP A;  4O45 A;  3ZE1 A;  4NSX A;  2AGW A;  3IUQ A;  2WQ8 A;  5EMK B;  3AL9 A;  2Z2O A;  3QI0 A;  1Q47 A;  4J82 A;  3EG6 A;  4YVD A;  2B5M A;  4CI3 A;  4H5J A;  3K72 A;  4O02 A;  3EI2 A;  1MG3 A;  1UOO A;  5FLX g;  5FKS A;  4GQ2 P;  1NR0 A;  5K1C C;  4J8B A;  4AN0 A;  2XDW A;  2Z2P A;  4ZOZ A;  4CI1 A;  5TEF A;  3NVN A;  3V5W B;  4FAN D;  5C2W B;  5B4W A;  3O4H A;  3B7F A;  3MZL A;  3SXT D;  4EWR A;  4WK2 A;  2IUR A;  3OTT A;  4BL0 A;  4BCC A;  4X63 B;  4X3E A;  5C2V B;  3IKO A;  3W15 A;  4G56 B;  2B4E A;  2CN2 A;  4WK4 A;  3A0F A;  1RI6 A;  1PBY B;  3C75 H;  2P9I C;  5E6R A;  5I5M A;  2XE4 A;  1K32 A;  2HKR A;  2I3T A;  3ZE2 A;  4JT5 C;  1GOG A;  2IUQ A;  4A0A A;  3VGZ A;  1JJU B;  3FCU A;  1MG2 A;  3IUJ A;  3JZH A;  4A09 B;  5K19 A;  4GMB A;  5FA5 B;  2YBA A;  2H13 A;  3EI3 B;  5HE1 B;  3ORV D;  3F3P A;  5TDH B;  3SN6 B;  2H6N A;  1JOF A;  1TYE A;  4JSP C;  2Q7Q A;  3UKU C;  1H2Z A;  3FM0 A;  2VDQ A;  2AH1 A;  5EAP A;  2CN3 A;  5EM2 B;  3OKY B;  4MMZ A;  4JD2 C;  2HU5 A;  4ES0 A;  3BG0 A;  4UM9 A;  4ESG A;  4ERY A;  2I0R A;  4G1M A;  1FWX A;  3PSL A;  3IVM A;  2P9N C;  5CYK B;  2IAA A;  4E5Z B;  3P4F A;  4JXM A;  3T3M A;  3VH0 A;  2H9M A;  4A2L A;  4MK0 B;  4PNK B;  4AMZ A;  3PXT D;  4ERQ A;  4JSX C;  4A11 B;  4J0X A;  1VE7 A;  4BCD A;  4J77 A;  5H17 A;  4H5I A;  5FXY A;  3MZK A;  4CY1 A;  3JB9 L;  5CXC B;  4BP8 A;  4A08 B;  3I89 A;  2EID A;  3J81 g;  4U1E I;  2BKL A;  3AL8 B;  2GC7 A;  4J79 A;  3MVD K;  3OL2 B;  3SHF A;  5M5V A;  2Z2N A;  1K3I A;  2XU7 A;  1M1X A;  3JZG A;  3EWE A;  3EQ9 A;  4U7A A;  3EI1 A;  5FFG A;  3I7P A;  3VA6 A;  3IUM A;  3NVX A;  4TZ4 A;  4ZOV A;  3JPX A;  4A0B A;  5EAM A;  4IMM A;  2VZ3 A;  3SJL D;  2VDL A;  4NBM A;  3SBR A;  4AOW A;  4ERZ A;  4XYH A;  4L3G D;  3DXM C;  3O4G A;  3K6S A;  2CNX A;  2QR5 A;  4QL1 A;  5C92 A;  1SQJ A;  3N0D A;  4FA5 D;  3EQ8 A;  2H9P A;  4A7J A;  4IRZ A;  5FKQ A;  5TEE A;  3UVL A;  3SVW D;  2H47 A;  1T2X A;  5HDB A;  3EQ7 A;  2XL3 A;  2VC2 A;  3GRE A;  1N6F A;  3I7O A;  5HE2 B;  4BP9 A;  3T3P A;  2VDR A;  3DWL C;  2P9S C;  4JSN C;  4RE6 A;  1C9I A;  3MKS B;  1S4U X;  3K26 A;  4DNU A;  4NC4 A;  3OKT A;  3DXK C;  3C9C A;  2OVQ B;  4E54 B;  4UM8 A;  1GOF A;  3V9F A;  3ZDX A;  4WK0 A;  4DNV A;  2IWK A;  4L1Q D;  1K8K C;  5IJ7 E;  3EI4 A;  1GOH A;  1YR2 A;  5E6U A;  3KCI A;  3K27 A;  4GZ8 A;  4CY5 A;  5CXB A;  3SBP A;  1PEV A;  4L3H D;  1SHY B;  1UTC A;  3NID A;  4JT6 C;  4HDJ A;  2OJY A;  4J84 A;  3SMR A;  4XEI C;  4PBZ A;  4D6V A;  4FA1 D;  2EIE A;  3CFS B;  3MUO A;  2J56 H;  1R5M A;  1XIP A;  3ZE0 A;  2AGZ A;  4D0K A;  3NIF A;  3SLE D;  3JRO A;  2GNQ A;  3E0C A;  4RE5 A;  5M61 A;  2HJB A;  3HFQ A;  3RN0 D;  2AGY A;  4Z7N A;  3K71 A;  2XYI A;  5HQG A;  2G99 A;  5M5S A;  3FCS A;  2PM9 B;  3RN1 D;  2B5N A;  3IUR A;  1C9L A;  2BBK H;  5EMJ B;  4O3U B;  1GP2 B;  3ODT A;  1VZ3 A;  4GM8 A;  4PSX B;  4NEN A;  2YNN A;  3CFV A;  4AX4 A;  2IWF A;  2H14 A;  4OWR A;  3DM0 A;  3KRW B;  2H68 A;  4O3T B;  3CIK B;  2JKX A;  1B9X A;  4QRJ A;  2CE8 A;  3NVQ A;  4LGN A;  5M5U A;  4GM3 A;  4CZV A;  4FHL A;  1JMX B;  2AH0 A;  3IUN A;  4Z7Q A;  1JMZ B;  2H3X A;  4O9D A;  2H6K A;  4XYI A;  5EAL A;  2CO0 A;  1H2Y A;  4AEZ A;  1O6F A;  3GFC A;  5AJA A;  3NIG A;  5AFU 3;  4A09 A;  4Z8L A;  3PE7 A;  1TYQ C;  3V4V A;  1L5G A;  2MTA H;  3UVN A;  4IA9 A;  4ZOX A;  3VI3 A;  3EI3 A;  4JHN A;  3MKQ A;  4CY3 A;  3FRX A;  5FQD A;  4FB1 D;  3IIY A;  4J81 A;  1VZ2 A;  2W18 A;  2H9N A;  4G55 A;  1PI6 A;  4J8G A;  5EM2 A;  3OKY A;  3UKR C;  2CE9 A;  5GXI A;  3OKW A;  2PBI B;  4BUJ C;  4GQ1 A;  2HJ4 A;  4FWW A;  2QZP A;  3IJ0 A;  5CYK A; 
#chains in the Genus database with same CATH homology
 4E5Z A;  2AGX A;  1XKS A;  5IT9 g;  2HES X;  4J73 A;  5FKR A;  1TBG A;  1VYH C;  5FKT A;  2UZX B;  4X61 B;  2QXV A;  1ERJ A;  3RMZ D;  4BH6 A;  3V7D B;  4A11 A;  4ZOY A;  5TF2 A;  4GGC A;  2YMU A;  5GXH A;  3EI2 B;  4CY2 A;  3J80 g;  2TRC B;  5CXC A;  4A08 A;  3KRX B;  4OZU A;  3AL8 A;  3OL2 A;  3ULE C;  3MMY A;  5I5J A;  3PSC B;  5IC7 A;  5HYN B;  3RFG A;  5I5I A;  1PGU A;  4X60 B;  3MXX A;  5HE3 B;  1OMW B;  5THA A;  3RSE C;  5EML B;  3RFH A;  3BWS A;  4FAV D;  2J55 H;  3SFZ A;  5GMK n;  3PVW B;  5IJ8 E;  2YNP A;  4PSW B;  2P9U C;  4A0A B;  3I7K A;  4LG9 A;  1XHM A;  3C5M A;  4JSV C;  5JWZ A;  5KDO B;  3PXS D;  3ZWL B;  3UR4 A;  1L0Q A;  3I8C A;  3JAM g;  3I7H A;  4Y7R A;  4J86 A;  1A0R B;  4E54 A;  2OK4 A;  5EAR A;  1GOT B;  4QT8 A;  5H1M A;  3PXW D;  3RLM D;  4CZX A;  4R7A B;  3OW8 A;  3F3G A;  4FA9 D;  5EMM B;  4A2M A;  1GXR A;  2QC5 A;  4PC0 A;  5IGO A;  2YNO A;  2IUP A;  1MDA H;  3F3F A;  3UVK A;  3IJC A;  3SCY A;  5C9Z B;  2I0T A;  2P9P C;  5A2Q g;  2OVP B;  4GGA A;  4J0W A;  4UI9 R;  5SXM A;  3SWS D;  4CI8 A;  2PM7 B;  2UZY B;  4CI2 A;  3PVU B;  4CC9 A;  3IIW A;  3EMH A;  2OIZ A;  1QNI A;  1N6E A;  3EU7 A;  3JZN A;  3SBQ A;  2PM9 A;  4J78 A;  4L9O A;  1GG2 B;  1P22 A;  3L4O D;  4GM9 A;  4N14 A;  4PBY A;  4QQE A;  3U4Y A;  3EI1 B;  3I2N A;  3UVM A;  4A0B B;  4I79 A;  4ZN4 A;  4K3J B;  4KFM B;  1SQ9 A;  3I7N A;  1B9Y A;  1U2V C;  5GSA A;  1N6D A;  3DSM A;  5H14 A;  5AMS A;  2J57 G;  3IJ1 A;  5IGQ A;  4FA4 D;  2I0S A;  4PXW A;  2IUV A;  2OVR B;  3C99 A;  1U4C A;  2EBS A;  2H9L A;  3L4M D;  4O1Q D;  3AFC A;  2AQ5 A;  2GC4 A;  4GGD A;  2HXC A;  4K3I D;  2YB8 B;  4Y5R D;  4LG8 A;  2AGL A;  3UVO A;  3FGB A;  3BG1 A;  4J87 A;  2HKM A;  3N0E A;  2H6Q A;  2PM6 B;  4GQB B;  3RRM C;  2O9K A;  3I7L A;  1OLZ A;  2XL2 A;  2B5L A;  3EI4 B;  2CO0 C;  5HE0 B;  1YFQ A;  4CZY A;  2BCJ B;  5CXB B;  1NEX B;  2OK6 A;  2P9K C;  3AH8 B;  2G9A A;  2P9L C;  3I8E A;  2I3S A;  2HYE A;  3JRP A;  4O45 A;  4NSX A;  2AGW A;  5EMK B;  3AL9 A;  2Z2O A;  1Q47 A;  4J82 A;  3EG6 A;  4YVD A;  2B5M A;  4CI3 A;  4H5J A;  3EI2 A;  1MG3 A;  5FLX g;  5FKS A;  4GQ2 P;  1NR0 A;  5K1C C;  4J8B A;  2Z2P A;  4ZOZ A;  4CI1 A;  5TEF A;  3NVN A;  3V5W B;  4FAN D;  5C2W B;  5B4W A;  3B7F A;  3MZL A;  3SXT D;  4EWR A;  2IUR A;  3OTT A;  4BL0 A;  4X63 B;  4X3E A;  5C2V B;  3IKO A;  3W15 A;  4G56 B;  2B4E A;  2CN2 A;  3A0F A;  1RI6 A;  1PBY B;  3C75 H;  2P9I C;  5I5M A;  1K32 A;  2HKR A;  2I3T A;  4JT5 C;  2IUQ A;  4A0A A;  3VGZ A;  1JJU B;  1MG2 A;  3JZH A;  4A09 B;  5K19 A;  4GMB A;  5FA5 B;  2YBA A;  2H13 A;  3EI3 B;  5HE1 B;  3ORV D;  3F3P A;  5TDH B;  3SN6 B;  2H6N A;  1JOF A;  4JSP C;  2Q7Q A;  3UKU C;  3FM0 A;  2AH1 A;  5EAP A;  2CN3 A;  5EM2 B;  3OKY B;  4JD2 C;  4ES0 A;  3BG0 A;  4ESG A;  4ERY A;  2I0R A;  1FWX A;  3PSL A;  2P9N C;  5CYK B;  2IAA A;  4E5Z B;  3P4F A;  4JXM A;  3VH0 A;  2H9M A;  4A2L A;  4MK0 B;  4PNK B;  3PXT D;  4ERQ A;  4JSX C;  4A11 B;  4J0X A;  4J77 A;  5H17 A;  4H5I A;  5FXY A;  3MZK A;  4CY1 A;  3JB9 L;  5CXC B;  4A08 B;  3I89 A;  3J81 g;  4U1E I;  3AL8 B;  4J79 A;  2GC7 A;  3OL2 B;  3SHF A;  2Z2N A;  2XU7 A;  3JZG A;  3EWE A;  4U7A A;  3EI1 A;  3I7P A;  3VA6 A;  3NVX A;  4TZ4 A;  4ZOV A;  3JPX A;  4A0B A;  5EAM A;  4IMM A;  3SJL D;  4AOW A;  3SBR A;  4ERZ A;  4XYH A;  4L3G D;  3DXM C;  2CNX A;  4QL1 A;  1SQJ A;  3N0D A;  4FA5 D;  2H9P A;  4A7J A;  5FKQ A;  3UVL A;  5TEE A;  3SVW D;  2H47 A;  2XL3 A;  3GRE A;  1N6F A;  3I7O A;  5HE2 B;  3DWL C;  2P9S C;  4JSN C;  3MKS B;  1S4U X;  3K26 A;  3OKT A;  3DXK C;  3C9C A;  2OVQ B;  4E54 B;  3V9F A;  2IWK A;  4L1Q D;  1K8K C;  5IJ7 E;  3EI4 A;  4CY5 A;  3K27 A;  4GZ8 A;  5CXB A;  3SBP A;  1PEV A;  4L3H D;  1SHY B;  4JT6 C;  4HDJ A;  2OJY A;  4J84 A;  3SMR A;  4XEI C;  4PBZ A;  4D6V A;  4FA1 D;  3CFS B;  2J56 H;  1R5M A;  1XIP A;  2AGZ A;  4D0K A;  3SLE D;  3JRO A;  2GNQ A;  3E0C A;  2HJB A;  3HFQ A;  3RN0 D;  2AGY A;  2XYI A;  5HQG A;  2G99 A;  2PM9 B;  3RN1 D;  2B5N A;  2BBK H;  5EMJ B;  4O3U B;  1GP2 B;  3ODT A;  4GM8 A;  4PSX B;  2YNN A;  3CFV A;  2IWF A;  2H14 A;  4OWR A;  3DM0 A;  3KRW B;  2H68 A;  4O3T B;  3CIK B;  1B9X A;  4QRJ A;  2CE8 A;  3NVQ A;  4LGN A;  4GM3 A;  4CZV A;  4FHL A;  1JMX B;  2AH0 A;  1JMZ B;  2H3X A;  4O9D A;  2H6K A;  4XYI A;  5EAL A;  2CO0 A;  4AEZ A;  3GFC A;  5AJA A;  5AFU 3;  4A09 A;  4Z8L A;  3PE7 A;  1TYQ C;  2MTA H;  3UVN A;  4IA9 A;  4ZOX A;  3EI3 A;  3MKQ A;  4CY3 A;  3FRX A;  5FQD A;  4FB1 D;  3IIY A;  4J81 A;  2W18 A;  2H9N A;  1PI6 A;  4J8G A;  5EM2 A;  3OKY A;  3UKR C;  2CE9 A;  5GXI A;  3OKW A;  2PBI B;  4BUJ C;  4GQ1 A;  2HJ4 A;  4FWW A;  3IJ0 A;  5CYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...