4GM9A

Crystal structure of human wd repeat domain 5 with compound mm-401
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
309
Chain Sequence
TQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Crystal structure of human WD repeat domain 5 with compound MM-401
rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 99
structure length 309
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gm9A00
3RN1D 3DWLC 2OK6A 4FAND 3JZHA 3SXTD 4CZYA 2P9PC 4GM9A 5IJ8E 3OTTA 4QQEA 3UVLA 3SBQA 2IUVA 4UI9R 4GZ8A 1A0RB 3OW8A 2OK4A 3GREA 3C99A 2HYEA 4E54B 2CNXA 5EAPA 4CI8A 5K19A 4QRJA 2QC5A 3PXWD 4J8GA 2YMUA 1PBYB 2H9MA 1N6DA 4BH6A 2AH1A 4ESGA 3UVNA 3W15A 5CXCB 4FA9D 3SCYA 5GXHA 2J55H 3I7HA 3PE7A 1ERJA 5HE0B 4OZUA 4A2MA 2Z2OA 3RMZD 5I5JA 3DM0A 2PM6B 1OLZA 1MG3A 4U1EI 5FA5B 1SHYB 2YNOA 3I89A 5A2Qg 3EI4B 4X61B 3I7LA 4J79A 5AJAA 1VYHC 4GGAA 1OMWB 4FA5D 2H6KA 5AFU3 4A08B 2IWKA 4HDJA 2H9LA 3UKUC 3GFCA 4AEZA 2I3SA 3E0CA 2GC4A 3B7FA 3IJ0A 5CYKA 5IJ7E 4J0WA 3JAMg 3J81g 3FRXA 4PBYA 3ORVD 5B4WA 3IKOA 4ZOZA 1GP2B 2AGWA 3DSMA 4CY5A 5SXMA 1XHMA 4Y7RA 5HE2B 2CE8A 2J56H 3PVWB 3DXKC 4ERQA 4PSXB 2B5MA 3AL8B 3C5MA 4CI3A 3AFCA 3I7OA 3EI3B 4JSXC 2P9LC 2OVQB 4A11A 5CXBB 4J87A 2I0TA 1SQ9A 2CN2A 4FHLA 5JWZA 2UZYB 4I79A 5HE3B 2OIZA 1K32A 3PVUB 2B4EA 3MZLA 1GXRA 3SWSD 4Y5RD 1P22A 5FKRA 4U7AA 4GQ1A 4JSVC 2YNPA 3JB9L 3RN0D 2H47A 3V9FA 1QNIA 5TDHB 4ZOVA 3RRMC 1N6EA 2XL3A 4L9OA 4J0XA 1K8KC 2B5LA 4L3GD 3EG6A 5IGOA 5GXIA 2HKMA 3I7NA 2CO0A 4PNKB 4CY1A 1PEVA 4A0AB 4JT6C 4AOWA 2GNQA 5EMLB 4GM3A 5TEFA 3EWEA 2H3XA 2I0RA 4A09A 4ERZA 4XYIA 4FA1D 5I5IA 3SMRA 4BUJC 1MG2A 3F3PA 4O9DA 4GMBA 3RLMD 1S4UX 3I2NA 4A0BB 2HESX 2I3TA 5HQGA 4CC9A 3CIKB 3OKYB 1NEXB 3CFSB 2XU7A 3MMYA 3EI2B 4GGCA 5EAMA 4QL1A 5IGQA 5FLXg 2J57G 4GQBB 2H6NA 3N0DA 2YNNA 2YB8B 3SN6B 1GG2B 2HXCA 5C2WB 3PXTD 3EI1A 2H9PA 3RFGA 4CI2A 3I8CA 3BG1A 5C9ZB 3K27A 3IJ1A 4G56B 4J84A 4A2LA 4GQ2P 5KDOB 3IJCA 4O3UB 2P9IC 3V7DB 1U4CA 3AL9A 5IT9g 3NVNA 3NVQA 4E54A 4LG9A 3I7KA 1JOFA 3JPXA 2IWFA 4R7AB 5EM2B 4KFMB 4XEIC 3SBPA 2CN3A 4JSPC 2HJ4A 5CXCA 1YFQA 4K3ID 4OWRA 5I5MA 2OVPB 2Z2NA 4JT5C 1FWXA 3DXMC 4GGDA 2OJYA 2PM9B 2AGXA 4CZVA 4E5ZB 4NSXA 5H17A 1XKSA 5FKSA 3EI4A 3KRXB 2G99A 1N6FA 4J82A 3SLED 2H6QA 2QXVA 3F3FA 4H5JA 5EMKB 3VA6A 4ZOYA 3UVOA 2IUQA 3C9CA 2BBKH 2P9UC 5H14A 3C75H 3F3GA 3PXSD 1TBGA 4PC0A 4L3HD 3FM0A 4ES0A 4O1QD 5C2VB 2OVRB 3MXXA 3N0EA 4J73A 4MK0B 3ZWLB 3SFZA 2H14A 2IURA 3ODTA 3RFHA 3PSCB 3NVXA 3AL8A 2AGLA 2P9KC 4YVDA 4A7JA 5IC7A 3EI3A 4O3TB 3BG0A 2HKRA 1JJUB 4L1QD 5H1MA 5AMSA 5HYNB 2H9NA 3MKQA 2EBSA 5CXBA 5EMMB 2H13A 3SJLD 3VGZA 4PBZA 4TZ4A 1GOTB 2PM7B 2CE9A 3IIWA 3V5WB 3EI1B 2YBAA 2AQ5A 2B5NA 4JD2C 3OL2A 3PSLA 1L0QA 3U4YA 4QT8A 4J78A 4PSWB 2I0SA 4Z8LA 2Q7QA 1PGUA 4FB1D 3UR4A 2UZXB 4J8BA 3UVKA 4FAVD 5CYKB 3JROA 3FGBA 2AGYA 2XL2A 3OKTA 5GMKn 2H68A 3OKWA 4J81A 1MDAH 4H5IA 4A0AA 2O9KA 5EALA 4J86A 3CFVA 3JRPA 1B9YA 5THAA 3KRWB 3JZNA 5FQDA 4BL0A 2CO0C 2AGZA 2PBIB 4IA9A 3I7PA 3AH8B 4A0BA 3SHFA 2XYIA 3OKYA 4A11B 5FKTA 3JZGA 1SQJA 2TRCB 3EI2A 2IUPA 3EU7A 5K1CC 3SBRA 1JMZB 3L4MD 4K3JB 4ZOXA 3VH0A 3MKSB 2P9NC 2IAAA 3L4OD 5HE1B 5GSAA 2AH0A 2P9SC 3RSEC 5TEEA 3BWSA 2BCJB 3K26A 4FA4D 3P4FA 3SVWD 3UVMA 4CY3A 3UKRC 4A08A 2HJBA 4LG8A 3J80g 4GM8A 5EARA 4CY2A 1JMXB 3I8EA 4A09B 1R5MA 4X3EA 4O45A 3ULEC 3IIYA 1PI6A 5TF2A 5FKQA 4ZN4A 4CZXA 2MTAH 4JSNC 4ERYA 1RI6A 2GC7A 5EM2A 1U2VC 4X63B 4N14A 1XIPA 4JXMA 3OL2B 5EMJB 4EWRA 4CI1A 4IMMA 3MZKA 4X60B 3A0FA 1NR0A 4XYHA 3HFQA 1B9XA 2G9AA 4PXWA 4FWWA 2Z2PA 5FXYA 1Q47A 1TYQC 4J77A 3EMHA 4LGNA 2PM9A 2W18A 4E5ZA 4D0KA 4D6VA
chains in the Genus database with same CATH superfamily
3RN1D 3DWLC 2OK6A 4FAND 4L1MA 3JZHA 1BPOA 2WQ8A 3SXTD 2VZ3A 4CZYA 2P9PC 4NENA 4GM9A 4WK4A 3O4IA 2XZGA 5IJ8E 3ZE1A 3OTTA 4QQEA 4UM9A 3UVLA 3SBQA 2IUVA 4UI9R 4GZ8A 1A0RB 3OW8A 2OK4A 1C9IA 3GREA 3C99A 2HYEA 4E54B 2CNXA 4NBMA 5EAPA 4CI8A 5K19A 4QRJA 2QC5A 3PXWD 4J8GA 2YMUA 3EQ7A 1PBYB 2EIBA 2H9MA 1H2WA 1N6DA 4BH6A 2AH1A 4ESGA 4UM8A 3UVNA 3V4PA 3W15A 1O6FA 2BKLA 5CXCB 4FA9D 3SCYA 5GXHA 2J55H 3I7HA 3PE7A 1ERJA 5HE0B 4OZUA 1QFSA 4A2MA 2Z2OA 3RMZD 5I5JA 3IURA 4MMZA 3DM0A 1T2XA 4MMXA 2PM6B 1OLZA 4AMYA 1MG3A 4U1EI 5FA5B 1SHYB 2YNOA 3I89A 5A2Qg 3EI4B 4X61B 2VDOA 1VZ3A 3I7LA 1VYHC 4GGAA 1OMWB 4J79A 2H6KA 5AJAA 4FA5D 5AFU3 2XE4A 2IWKA 4HDJA 2EICA 2H9LA 3UKUC 5M5UA 3K71A 3GFCA 4AX4A 4AEZA 2I3SA 3E0CA 2GC4A 3B7FA 3IJ0A 5CYKA 5IJ7E 1VE6A 4J0WA 4NC4A 3JAMg 3J81g 3FCUA 1L5GA 2VZ1A 4WK0A 3FRXA 4PBYA 5FFOA 3ORVD 5B4WA 3IKOA 4ZOZA 1GP2B 3ZE0A 2AGWA 3DSMA 4CY5A 5SXMA 1XHMA 4Y7RA 5HE2B 2CE8A 2J56H 1QFMA 3PVWB 3DXKC 4ERQA 4PSXB 5C92A 2B5MA 3AL8B 3ZE2A 3C5MA 4Z7OA 4CI3A 1K3IA 3AFCA 3I7OA 3EI3B 4JSXC 1H2XA 2P9LC 3T3PA 2OVQB 4A11A 5CXBB 4J87A 1I2MB 5M5RA 2I0TA 1SQ9A 2CN2A 4FHLA 5JWZA 2UZYB 4I79A 5HE3B 1A12A 2OIZA 3DDUA 1K32A 3PVUB 2B4EA 3MZLA 1GXRA 3SWSD 4Y5RD 1P22A 5FKRA 4U7AA 4GQ1A 4JSVC 2YNPA 5M61A 3JB9L 3OF7A 2H47A 3RN0D 3V9FA 1QNIA 5TDHB 4ZOVA 1GOHA 3RRMC 1N6EA 2XL3A 4L9OA 4J0XA 4DNWA 1K8KC 2B5LA 3IUJA 3EG6A 4L3GD 4RE5A 5IGOA 5GXIA 2HKMA 3I7NA 2CO0A 4PNKB 4CY1A 1PEVA 3T3MA 4A0AB 3O4JA 4JT6C 4AOWA 2GNQA 4D9SA 5EMLB 4GM3A 5TEFA 3EWEA 2H3XA 2I0RA 4A09A 4ERZA 4XYIA 4FA1D 3IVMA 5I5IA 3SMRA 4BUJC 1MG2A 3F3PA 2QZPA 4BCCA 4O9DA 3KCIA 4GMBA 3RLMD 1S4UX 3ZDXA 3I2NA 1M1XA 4A0BB 2VDMA 1TYEA 2HESX 2I3TA 5HQGA 4CC9A 4Z7QA 4Z7NA 4RE6A 3CIKB 3OKYB 1NEXB 3CFSB 2XU7A 3EQ9A 3MMYA 3EI2B 4GGCA 5EAMA 4QL1A 5IGQA 5FLXg 2J57G 3GD1I 3O4HA 2VDKA 4GQBB 5C86A 2H6NA 3N0DA 2YNNA 2YB8B 3SN6B 1GG2B 2HXCA 2QR5A 1GOFA 5C2WB 3PXTD 3EI1A 2H9PA 3RFGA 4CI2A 3I8CA 3BG1A 5C9ZB 3K27A 3IJ1A 4G56B 4J84A 1YR2A 4A2LA 4GQ2P 5KDOB 3IJCA 4O3UB 2P9IC 3V7DB 1U4CA 1E8MA 3K72A 3AL9A 3IUQA 5IT9g 3IUNA 3NVNA 3NVQA 4E54A 4LG9A 3I7KA 3EQ8A 1JOFA 3JPXA 2IWFA 5HDBA 4R7AB 5EM2B 4DNVA 2EIDA 4KFMB 4XEIC 3SBPA 3ZDYA 5M5SA 2CN3A 4O02A 4JSPC 2HJ4A 5CXCA 2JKXA 4A08B 1YFQA 4K3ID 1E5TA 4OWRA 5I5MA 2OVPB 2Z2NA 4JT5C 3QHYB 1FWXA 3DXMC 4GGDA 2OJYA 2PM9B 2AGXA 4CZVA 4E5ZB 4DNUA 4NSXA 3MUNA 5H17A 1XKSA 1UOOA 5FKSA 3EI4A 3KRXB 2G99A 1N6FA 4J82A 4WK2A 3SLED 2H6QA 3IUMA 2QXVA 3F3FA 4H5JA 5EMKB 1VE7A 3VA6A 4ZOYA 3UVOA 2IUQA 3C9CA 2BBKH 2P9UC 5H14A 3C75H 3F3GA 3PXSD 1TBGA 4JHNA 4PC0A 4AMZA 4L3HD 3FM0A 4ES0A 4O1QD 5C2VB 2OVRB 2HU5A 3MXXA 3N0EA 4J73A 4MK0B 3ZWLB 3SFZA 5E6UA 2H14A 1JV2A 2IURA 3ODTA 4BCBA 3RFHA 3PSCB 4JHPC 1C9LA 3NVXA 3AL8A 2AGLA 2P9KC 4YVDA 4A7JA 5IC7A 4AN1A 3EI3A 4O3TB 1VZ2A 3BG0A 2HKRA 1JJUB 4L1QD 5H1MA 5M5TA 5AMSA 5HYNB 2VC2A 3MKQA 2H9NA 2EBSA 5CXBA 5EMMB 2H13A 3SJLD 4WJKA 4PBZA 3VGZA 4TZ4A 1GOTB 2PM7B 2CE9A 3IIWA 3V5WB 3EI1B 2YBAA 2AQ5A 2B5NA 4JD2C 3OL2A 1H2YA 3PSLA 1L0QA 3U4YA 4QT8A 4J78A 4QAMA 2HU7A 4PSWB 2I0SA 1U8CA 4Z8LA 2Q7QA 1UTCA 2EIEA 1PGUA 4FB1D 3UR4A 2UZXB 4J8BA 3FCSA 3UVKA 4FAVD 5CYKB 3JROA 3FGBA 3VI4A 2AGYA 2XL2A 3OKTA 5GMKn 2H68A 3OKWA 4J81A 1MDAH 4H5IA 4A0AA 2O9KA 4IRZA 5EALA 1UOPA 2XDWA 4J86A 3CFVA 3JRPA 1B9YA 5FFGA 5THAA 3KRWB 3JZNA 5FQDA 3VI3A 4BL0A 2CO0C 3O4GA 2AGZA 4G1MA 2PBIB 4IA9A 3I7PA 3AH8B 4A0BA 1H2ZA 5E6RA 4O2WA 4G1EA 3SHFA 2XYIA 3OKYA 4A11B 5FKTA 3JZGA 1SQJA 2TRCB 3MVDK 3EI2A 3NIGA 2IUPA 3EU7A 5K1CC 3SBRA 1JMZB 3L4MD 4K3JB 4ZOXA 3VH0A 3MKSB 2P9NC 2IAAA 1O6GA 3L4OD 5HE1B 1E8NA 3MUOA 3QI0A 3ZDZA 5GSAA 2AH0A 2P9SC 3RSEC 5TEEA 3BWSA 2BCJB 3K26A 4FA4D 4NAAA 3P4FA 3SVWD 1JTDB 3UVMA 4CY3A 3UKRC 4A08A 4BP9A 2HJBA 4LG8A 3J80g 4GM8A 5EARA 4CY2A 1JMXB 3I8EA 2VDRA 3NIDA 4A09B 1R5MA 4X3EA 4O45A 3ULEC 3IIYA 1PI6A 5TF2A 5FKQA 4ZN4A 3GC3B 2HU8A 3V4VA 4CZXA 2MTAH 4JSNC 4ERYA 1RI6A 2GC7A 5EM2A 1U2VC 4X63B 4N14A 5M5VA 1XIPA 4G55A 3NIFA 4JXMA 3OL2B 5EMJB 2VDQA 3IJEA 4BCDA 4BP8A 4IMMA 4EWRA 3MZKA 1UOQA 4X60B 4CI1A 3A0FA 2VDNA 1NR0A 4XYHA 3K6SA 3HFQA 4MMYA 1B9XA 2G9AA 4PXWA 2VDLA 4FWWA 3IULA 5E6SA 2Z2PA 5FXYA 1Q47A 1TYQC 4J77A 3EMHA 4LGNA 2VDPA 1GOGA 4AN0A 2PM9A 2W18A 4E5ZA 4D0KA 4D6VA
chains in the Genus database with same CATH topology
3RN1D 3DWLC 2OK6A 4FAND 3JZHA 3SXTD 4CZYA 2P9PC 4GM9A 5IJ8E 3OTTA 4QQEA 3UVLA 3SBQA 2IUVA 4UI9R 4GZ8A 1A0RB 3OW8A 2OK4A 3GREA 3C99A 2HYEA 4E54B 2CNXA 5EAPA 4CI8A 5K19A 4QRJA 2QC5A 3PXWD 4J8GA 2YMUA 1PBYB 2H9MA 1N6DA 4BH6A 2AH1A 4ESGA 3UVNA 3W15A 5CXCB 4FA9D 3SCYA 5GXHA 2J55H 3I7HA 3PE7A 1ERJA 5HE0B 4OZUA 4A2MA 2Z2OA 3RMZD 5I5JA 3DM0A 2PM6B 1OLZA 1MG3A 4U1EI 5FA5B 1SHYB 2YNOA 3I89A 5A2Qg 3EI4B 4X61B 3I7LA 4J79A 5AJAA 1VYHC 4GGAA 1OMWB 4FA5D 2H6KA 5AFU3 4A08B 2IWKA 4HDJA 2H9LA 3UKUC 3GFCA 4AEZA 2I3SA 3E0CA 2GC4A 3B7FA 3IJ0A 5CYKA 5IJ7E 4J0WA 3JAMg 3J81g 3FRXA 4PBYA 3ORVD 5B4WA 3IKOA 4ZOZA 1GP2B 2AGWA 3DSMA 4CY5A 5SXMA 1XHMA 4Y7RA 5HE2B 2CE8A 2J56H 3PVWB 3DXKC 4ERQA 4PSXB 2B5MA 3AL8B 3C5MA 4CI3A 3AFCA 3I7OA 3EI3B 4JSXC 2P9LC 2OVQB 4A11A 5CXBB 4J87A 2I0TA 1SQ9A 2CN2A 4FHLA 5JWZA 2UZYB 4I79A 5HE3B 2OIZA 1K32A 3PVUB 2B4EA 3MZLA 1GXRA 3SWSD 4Y5RD 1P22A 5FKRA 4U7AA 4GQ1A 4JSVC 2YNPA 3JB9L 3RN0D 2H47A 3V9FA 1QNIA 5TDHB 4ZOVA 3RRMC 1N6EA 2XL3A 4L9OA 4J0XA 1K8KC 2B5LA 4L3GD 3EG6A 5IGOA 5GXIA 2HKMA 3I7NA 2CO0A 4PNKB 4CY1A 1PEVA 4A0AB 4JT6C 4AOWA 2GNQA 5EMLB 4GM3A 5TEFA 3EWEA 2H3XA 2I0RA 4A09A 4ERZA 4XYIA 4FA1D 5I5IA 3SMRA 4BUJC 1MG2A 3F3PA 4O9DA 4GMBA 3RLMD 1S4UX 3I2NA 4A0BB 2HESX 2I3TA 5HQGA 4CC9A 3CIKB 3OKYB 1NEXB 3CFSB 2XU7A 3MMYA 3EI2B 4GGCA 5EAMA 4QL1A 5IGQA 5FLXg 2J57G 4GQBB 2H6NA 3N0DA 2YNNA 2YB8B 3SN6B 1GG2B 2HXCA 5C2WB 3PXTD 3EI1A 2H9PA 3RFGA 4CI2A 3I8CA 3BG1A 5C9ZB 3K27A 3IJ1A 4G56B 4J84A 4A2LA 4GQ2P 5KDOB 3IJCA 4O3UB 2P9IC 3V7DB 1U4CA 3AL9A 5IT9g 3NVNA 3NVQA 4E54A 4LG9A 3I7KA 1JOFA 3JPXA 2IWFA 4R7AB 5EM2B 4KFMB 4XEIC 3SBPA 2CN3A 4JSPC 2HJ4A 5CXCA 1YFQA 4K3ID 4OWRA 5I5MA 2OVPB 2Z2NA 4JT5C 1FWXA 3DXMC 4GGDA 2OJYA 2PM9B 2AGXA 4CZVA 4E5ZB 4NSXA 5H17A 1XKSA 5FKSA 3EI4A 3KRXB 2G99A 1N6FA 4J82A 3SLED 2H6QA 2QXVA 3F3FA 4H5JA 5EMKB 3VA6A 4ZOYA 3UVOA 2IUQA 3C9CA 2BBKH 2P9UC 5H14A 3C75H 3F3GA 3PXSD 1TBGA 4PC0A 4L3HD 3FM0A 4ES0A 4O1QD 5C2VB 2OVRB 3MXXA 3N0EA 4J73A 4MK0B 3ZWLB 3SFZA 2H14A 2IURA 3ODTA 3RFHA 3PSCB 3NVXA 3AL8A 2AGLA 2P9KC 4YVDA 4A7JA 5IC7A 3EI3A 4O3TB 3BG0A 2HKRA 1JJUB 4L1QD 5H1MA 5AMSA 5HYNB 2H9NA 3MKQA 2EBSA 5CXBA 5EMMB 2H13A 3SJLD 3VGZA 4PBZA 4TZ4A 1GOTB 2PM7B 2CE9A 3IIWA 3V5WB 3EI1B 2YBAA 2AQ5A 2B5NA 4JD2C 3OL2A 3PSLA 1L0QA 3U4YA 4QT8A 4J78A 4PSWB 2I0SA 4Z8LA 2Q7QA 1PGUA 4FB1D 3UR4A 2UZXB 4J8BA 3UVKA 4FAVD 5CYKB 3JROA 3FGBA 2AGYA 2XL2A 3OKTA 5GMKn 2H68A 3OKWA 4J81A 1MDAH 4H5IA 4A0AA 2O9KA 5EALA 4J86A 3CFVA 3JRPA 1B9YA 5THAA 3KRWB 3JZNA 5FQDA 4BL0A 2CO0C 2AGZA 2PBIB 4IA9A 3I7PA 3AH8B 4A0BA 3SHFA 2XYIA 3OKYA 4A11B 5FKTA 3JZGA 1SQJA 2TRCB 3EI2A 2IUPA 3EU7A 5K1CC 3SBRA 1JMZB 3L4MD 4K3JB 4ZOXA 3VH0A 3MKSB 2P9NC 2IAAA 3L4OD 5HE1B 5GSAA 2AH0A 2P9SC 3RSEC 5TEEA 3BWSA 2BCJB 3K26A 4FA4D 3P4FA 3SVWD 3UVMA 4CY3A 3UKRC 4A08A 2HJBA 4LG8A 3J80g 4GM8A 5EARA 4CY2A 1JMXB 3I8EA 4A09B 1R5MA 4X3EA 4O45A 3ULEC 3IIYA 1PI6A 5TF2A 5FKQA 4ZN4A 4CZXA 2MTAH 4JSNC 4ERYA 1RI6A 2GC7A 5EM2A 1U2VC 4X63B 4N14A 1XIPA 4JXMA 3OL2B 5EMJB 4EWRA 4CI1A 4IMMA 3MZKA 4X60B 3A0FA 1NR0A 4XYHA 3HFQA 1B9XA 2G9AA 4PXWA 4FWWA 2Z2PA 5FXYA 1Q47A 1TYQC 4J77A 3EMHA 4LGNA 2PM9A 2W18A 4E5ZA 4D0KA 4D6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN1 D;  3DWL C;  2OK6 A;  4FAN D;  3JZH A;  3SXT D;  4CZY A;  2P9P C;  4GM9 A;  5IJ8 E;  3OTT A;  4QQE A;  3UVL A;  3SBQ A;  2IUV A;  4UI9 R;  4GZ8 A;  1A0R B;  3OW8 A;  2OK4 A;  3GRE A;  3C99 A;  2HYE A;  4E54 B;  2CNX A;  5EAP A;  4CI8 A;  5K19 A;  4QRJ A;  2QC5 A;  3PXW D;  4J8G A;  2YMU A;  1PBY B;  2H9M A;  1N6D A;  4BH6 A;  2AH1 A;  4ESG A;  3UVN A;  3W15 A;  5CXC B;  4FA9 D;  3SCY A;  5GXH A;  2J55 H;  3I7H A;  3PE7 A;  1ERJ A;  5HE0 B;  4OZU A;  4A2M A;  2Z2O A;  3RMZ D;  5I5J A;  3DM0 A;  2PM6 B;  1OLZ A;  1MG3 A;  4U1E I;  5FA5 B;  1SHY B;  2YNO A;  3I89 A;  5A2Q g;  3EI4 B;  4X61 B;  3I7L A;  4J79 A;  5AJA A;  1VYH C;  4GGA A;  1OMW B;  4FA5 D;  2H6K A;  5AFU 3;  4A08 B;  2IWK A;  4HDJ A;  2H9L A;  3UKU C;  3GFC A;  4AEZ A;  2I3S A;  3E0C A;  2GC4 A;  3B7F A;  3IJ0 A;  5CYK A;  5IJ7 E;  4J0W A;  3JAM g;  3J81 g;  3FRX A;  4PBY A;  3ORV D;  5B4W A;  3IKO A;  4ZOZ A;  1GP2 B;  2AGW A;  3DSM A;  4CY5 A;  5SXM A;  1XHM A;  4Y7R A;  5HE2 B;  2CE8 A;  2J56 H;  3PVW B;  3DXK C;  4ERQ A;  4PSX B;  2B5M A;  3AL8 B;  3C5M A;  4CI3 A;  3AFC A;  3I7O A;  3EI3 B;  4JSX C;  2P9L C;  2OVQ B;  4A11 A;  5CXB B;  4J87 A;  2I0T A;  1SQ9 A;  2CN2 A;  4FHL A;  5JWZ A;  2UZY B;  4I79 A;  5HE3 B;  2OIZ A;  1K32 A;  3PVU B;  2B4E A;  3MZL A;  1GXR A;  3SWS D;  4Y5R D;  1P22 A;  5FKR A;  4U7A A;  4GQ1 A;  4JSV C;  2YNP A;  3JB9 L;  3RN0 D;  2H47 A;  3V9F A;  1QNI A;  5TDH B;  4ZOV A;  3RRM C;  1N6E A;  2XL3 A;  4L9O A;  4J0X A;  1K8K C;  2B5L A;  4L3G D;  3EG6 A;  5IGO A;  5GXI A;  2HKM A;  3I7N A;  2CO0 A;  4PNK B;  4CY1 A;  1PEV A;  4A0A B;  4JT6 C;  4AOW A;  2GNQ A;  5EML B;  4GM3 A;  5TEF A;  3EWE A;  2H3X A;  2I0R A;  4A09 A;  4ERZ A;  4XYI A;  4FA1 D;  5I5I A;  3SMR A;  4BUJ C;  1MG2 A;  3F3P A;  4O9D A;  4GMB A;  3RLM D;  1S4U X;  3I2N A;  4A0B B;  2HES X;  2I3T A;  5HQG A;  4CC9 A;  3CIK B;  3OKY B;  1NEX B;  3CFS B;  2XU7 A;  3MMY A;  3EI2 B;  4GGC A;  5EAM A;  4QL1 A;  5IGQ A;  5FLX g;  2J57 G;  4GQB B;  2H6N A;  3N0D A;  2YNN A;  2YB8 B;  3SN6 B;  1GG2 B;  2HXC A;  5C2W B;  3PXT D;  3EI1 A;  2H9P A;  3RFG A;  4CI2 A;  3I8C A;  3BG1 A;  5C9Z B;  3K27 A;  3IJ1 A;  4G56 B;  4J84 A;  4A2L A;  4GQ2 P;  5KDO B;  3IJC A;  4O3U B;  2P9I C;  3V7D B;  1U4C A;  3AL9 A;  5IT9 g;  3NVN A;  3NVQ A;  4E54 A;  4LG9 A;  3I7K A;  1JOF A;  3JPX A;  2IWF A;  4R7A B;  5EM2 B;  4KFM B;  4XEI C;  3SBP A;  2CN3 A;  4JSP C;  2HJ4 A;  5CXC A;  1YFQ A;  4K3I D;  4OWR A;  5I5M A;  2OVP B;  2Z2N A;  4JT5 C;  1FWX A;  3DXM C;  4GGD A;  2OJY A;  2PM9 B;  2AGX A;  4CZV A;  4E5Z B;  4NSX A;  5H17 A;  1XKS A;  5FKS A;  3EI4 A;  3KRX B;  2G99 A;  1N6F A;  4J82 A;  3SLE D;  2H6Q A;  2QXV A;  3F3F A;  4H5J A;  5EMK B;  3VA6 A;  4ZOY A;  3UVO A;  2IUQ A;  3C9C A;  2BBK H;  2P9U C;  5H14 A;  3C75 H;  3F3G A;  3PXS D;  1TBG A;  4PC0 A;  4L3H D;  3FM0 A;  4ES0 A;  4O1Q D;  5C2V B;  2OVR B;  3MXX A;  3N0E A;  4J73 A;  4MK0 B;  3ZWL B;  3SFZ A;  2H14 A;  2IUR A;  3ODT A;  3RFH A;  3PSC B;  3NVX A;  3AL8 A;  2AGL A;  2P9K C;  4YVD A;  4A7J A;  5IC7 A;  3EI3 A;  4O3T B;  3BG0 A;  2HKR A;  1JJU B;  4L1Q D;  5H1M A;  5AMS A;  5HYN B;  2H9N A;  3MKQ A;  2EBS A;  5CXB A;  5EMM B;  2H13 A;  3SJL D;  3VGZ A;  4PBZ A;  4TZ4 A;  1GOT B;  2PM7 B;  2CE9 A;  3IIW A;  3V5W B;  3EI1 B;  2YBA A;  2AQ5 A;  2B5N A;  4JD2 C;  3OL2 A;  3PSL A;  1L0Q A;  3U4Y A;  4QT8 A;  4J78 A;  4PSW B;  2I0S A;  4Z8L A;  2Q7Q A;  1PGU A;  4FB1 D;  3UR4 A;  2UZX B;  4J8B A;  3UVK A;  4FAV D;  5CYK B;  3JRO A;  3FGB A;  2AGY A;  2XL2 A;  3OKT A;  5GMK n;  2H68 A;  3OKW A;  4J81 A;  1MDA H;  4H5I A;  4A0A A;  2O9K A;  5EAL A;  4J86 A;  3CFV A;  3JRP A;  1B9Y A;  5THA A;  3KRW B;  3JZN A;  5FQD A;  4BL0 A;  2CO0 C;  2AGZ A;  2PBI B;  4IA9 A;  3I7P A;  3AH8 B;  4A0B A;  3SHF A;  2XYI A;  3OKY A;  4A11 B;  5FKT A;  3JZG A;  1SQJ A;  2TRC B;  3EI2 A;  2IUP A;  3EU7 A;  5K1C C;  3SBR A;  1JMZ B;  3L4M D;  4K3J B;  4ZOX A;  3VH0 A;  3MKS B;  2P9N C;  2IAA A;  3L4O D;  5HE1 B;  5GSA A;  2AH0 A;  2P9S C;  3RSE C;  5TEE A;  3BWS A;  2BCJ B;  3K26 A;  4FA4 D;  3P4F A;  3SVW D;  3UVM A;  4CY3 A;  3UKR C;  4A08 A;  2HJB A;  4LG8 A;  3J80 g;  4GM8 A;  5EAR A;  4CY2 A;  1JMX B;  3I8E A;  4A09 B;  1R5M A;  4X3E A;  4O45 A;  3ULE C;  3IIY A;  1PI6 A;  5TF2 A;  5FKQ A;  4ZN4 A;  4CZX A;  2MTA H;  4JSN C;  4ERY A;  1RI6 A;  2GC7 A;  5EM2 A;  1U2V C;  4X63 B;  4N14 A;  1XIP A;  4JXM A;  3OL2 B;  5EMJ B;  4EWR A;  4CI1 A;  4IMM A;  3MZK A;  4X60 B;  3A0F A;  1NR0 A;  4XYH A;  3HFQ A;  1B9X A;  2G9A A;  4PXW A;  4FWW A;  2Z2P A;  5FXY A;  1Q47 A;  1TYQ C;  4J77 A;  3EMH A;  4LGN A;  2PM9 A;  2W18 A;  4E5Z A;  4D0K A;  4D6V A; 
#chains in the Genus database with same CATH topology
 3RN1 D;  3DWL C;  2OK6 A;  4FAN D;  4L1M A;  3JZH A;  1BPO A;  2WQ8 A;  3SXT D;  2VZ3 A;  4CZY A;  2P9P C;  4NEN A;  4GM9 A;  4WK4 A;  3O4I A;  2XZG A;  5IJ8 E;  3ZE1 A;  3OTT A;  4QQE A;  4UM9 A;  3UVL A;  3SBQ A;  2IUV A;  4UI9 R;  4GZ8 A;  1A0R B;  3OW8 A;  2OK4 A;  1C9I A;  3GRE A;  3C99 A;  2HYE A;  4E54 B;  2CNX A;  4NBM A;  5EAP A;  4CI8 A;  5K19 A;  4QRJ A;  2QC5 A;  3PXW D;  4J8G A;  2YMU A;  3EQ7 A;  1PBY B;  2EIB A;  2H9M A;  1H2W A;  1N6D A;  4BH6 A;  2AH1 A;  4ESG A;  4UM8 A;  3UVN A;  3V4P A;  3W15 A;  1O6F A;  2BKL A;  5CXC B;  4FA9 D;  3SCY A;  5GXH A;  2J55 H;  3I7H A;  3PE7 A;  1ERJ A;  5HE0 B;  4OZU A;  1QFS A;  4A2M A;  2Z2O A;  3RMZ D;  5I5J A;  3IUR A;  4MMZ A;  3DM0 A;  1T2X A;  4MMX A;  2PM6 B;  1OLZ A;  4AMY A;  1MG3 A;  4U1E I;  5FA5 B;  1SHY B;  2YNO A;  3I89 A;  5A2Q g;  3EI4 B;  4X61 B;  2VDO A;  1VZ3 A;  3I7L A;  1VYH C;  4GGA A;  1OMW B;  4J79 A;  2H6K A;  5AJA A;  4FA5 D;  5AFU 3;  2XE4 A;  2IWK A;  4HDJ A;  2EIC A;  2H9L A;  3UKU C;  5M5U A;  3K71 A;  3GFC A;  4AX4 A;  4AEZ A;  2I3S A;  3E0C A;  2GC4 A;  3B7F A;  3IJ0 A;  5CYK A;  5IJ7 E;  1VE6 A;  4J0W A;  4NC4 A;  3JAM g;  3J81 g;  3FCU A;  1L5G A;  2VZ1 A;  4WK0 A;  3FRX A;  4PBY A;  5FFO A;  3ORV D;  5B4W A;  3IKO A;  4ZOZ A;  1GP2 B;  3ZE0 A;  2AGW A;  3DSM A;  4CY5 A;  5SXM A;  1XHM A;  4Y7R A;  5HE2 B;  2CE8 A;  2J56 H;  1QFM A;  3PVW B;  3DXK C;  4ERQ A;  4PSX B;  5C92 A;  2B5M A;  3AL8 B;  3ZE2 A;  3C5M A;  4Z7O A;  4CI3 A;  1K3I A;  3AFC A;  3I7O A;  3EI3 B;  4JSX C;  1H2X A;  2P9L C;  3T3P A;  2OVQ B;  4A11 A;  5CXB B;  4J87 A;  1I2M B;  5M5R A;  2I0T A;  1SQ9 A;  2CN2 A;  4FHL A;  5JWZ A;  2UZY B;  4I79 A;  5HE3 B;  1A12 A;  2OIZ A;  3DDU A;  1K32 A;  3PVU B;  2B4E A;  3MZL A;  1GXR A;  3SWS D;  4Y5R D;  1P22 A;  5FKR A;  4U7A A;  4GQ1 A;  4JSV C;  2YNP A;  5M61 A;  3JB9 L;  3OF7 A;  2H47 A;  3RN0 D;  3V9F A;  1QNI A;  5TDH B;  4ZOV A;  1GOH A;  3RRM C;  1N6E A;  2XL3 A;  4L9O A;  4J0X A;  4DNW A;  1K8K C;  2B5L A;  3IUJ A;  3EG6 A;  4L3G D;  4RE5 A;  5IGO A;  5GXI A;  2HKM A;  3I7N A;  2CO0 A;  4PNK B;  4CY1 A;  1PEV A;  3T3M A;  4A0A B;  3O4J A;  4JT6 C;  4AOW A;  2GNQ A;  4D9S A;  5EML B;  4GM3 A;  5TEF A;  3EWE A;  2H3X A;  2I0R A;  4A09 A;  4ERZ A;  4XYI A;  4FA1 D;  3IVM A;  5I5I A;  3SMR A;  4BUJ C;  1MG2 A;  3F3P A;  2QZP A;  4BCC A;  4O9D A;  3KCI A;  4GMB A;  3RLM D;  1S4U X;  3ZDX A;  3I2N A;  1M1X A;  4A0B B;  2VDM A;  1TYE A;  2HES X;  2I3T A;  5HQG A;  4CC9 A;  4Z7Q A;  4Z7N A;  4RE6 A;  3CIK B;  3OKY B;  1NEX B;  3CFS B;  2XU7 A;  3EQ9 A;  3MMY A;  3EI2 B;  4GGC A;  5EAM A;  4QL1 A;  5IGQ A;  5FLX g;  2J57 G;  3GD1 I;  3O4H A;  2VDK A;  4GQB B;  5C86 A;  2H6N A;  3N0D A;  2YNN A;  2YB8 B;  3SN6 B;  1GG2 B;  2HXC A;  2QR5 A;  1GOF A;  5C2W B;  3PXT D;  3EI1 A;  2H9P A;  3RFG A;  4CI2 A;  3I8C A;  3BG1 A;  5C9Z B;  3K27 A;  3IJ1 A;  4G56 B;  4J84 A;  1YR2 A;  4A2L A;  4GQ2 P;  5KDO B;  3IJC A;  4O3U B;  2P9I C;  3V7D B;  1U4C A;  1E8M A;  3K72 A;  3AL9 A;  3IUQ A;  5IT9 g;  3IUN A;  3NVN A;  3NVQ A;  4E54 A;  4LG9 A;  3I7K A;  3EQ8 A;  1JOF A;  3JPX A;  2IWF A;  5HDB A;  4R7A B;  5EM2 B;  4DNV A;  2EID A;  4KFM B;  4XEI C;  3SBP A;  3ZDY A;  5M5S A;  2CN3 A;  4O02 A;  4JSP C;  2HJ4 A;  5CXC A;  2JKX A;  4A08 B;  1YFQ A;  4K3I D;  1E5T A;  4OWR A;  5I5M A;  2OVP B;  2Z2N A;  4JT5 C;  3QHY B;  1FWX A;  3DXM C;  4GGD A;  2OJY A;  2PM9 B;  2AGX A;  4CZV A;  4E5Z B;  4DNU A;  4NSX A;  3MUN A;  5H17 A;  1XKS A;  1UOO A;  5FKS A;  3EI4 A;  3KRX B;  2G99 A;  1N6F A;  4J82 A;  4WK2 A;  3SLE D;  2H6Q A;  3IUM A;  2QXV A;  3F3F A;  4H5J A;  5EMK B;  1VE7 A;  3VA6 A;  4ZOY A;  3UVO A;  2IUQ A;  3C9C A;  2BBK H;  2P9U C;  5H14 A;  3C75 H;  3F3G A;  3PXS D;  1TBG A;  4JHN A;  4PC0 A;  4AMZ A;  4L3H D;  3FM0 A;  4ES0 A;  4O1Q D;  5C2V B;  2OVR B;  2HU5 A;  3MXX A;  3N0E A;  4J73 A;  4MK0 B;  3ZWL B;  3SFZ A;  5E6U A;  2H14 A;  1JV2 A;  2IUR A;  3ODT A;  4BCB A;  3RFH A;  3PSC B;  4JHP C;  1C9L A;  3NVX A;  3AL8 A;  2AGL A;  2P9K C;  4YVD A;  4A7J A;  5IC7 A;  4AN1 A;  3EI3 A;  4O3T B;  1VZ2 A;  3BG0 A;  2HKR A;  1JJU B;  4L1Q D;  5H1M A;  5M5T A;  5AMS A;  5HYN B;  2VC2 A;  3MKQ A;  2H9N A;  2EBS A;  5CXB A;  5EMM B;  2H13 A;  3SJL D;  4WJK A;  4PBZ A;  3VGZ A;  4TZ4 A;  1GOT B;  2PM7 B;  2CE9 A;  3IIW A;  3V5W B;  3EI1 B;  2YBA A;  2AQ5 A;  2B5N A;  4JD2 C;  3OL2 A;  1H2Y A;  3PSL A;  1L0Q A;  3U4Y A;  4QT8 A;  4J78 A;  4QAM A;  2HU7 A;  4PSW B;  2I0S A;  1U8C A;  4Z8L A;  2Q7Q A;  1UTC A;  2EIE A;  1PGU A;  4FB1 D;  3UR4 A;  2UZX B;  4J8B A;  3FCS A;  3UVK A;  4FAV D;  5CYK B;  3JRO A;  3FGB A;  3VI4 A;  2AGY A;  2XL2 A;  3OKT A;  5GMK n;  2H68 A;  3OKW A;  4J81 A;  1MDA H;  4H5I A;  4A0A A;  2O9K A;  4IRZ A;  5EAL A;  1UOP A;  2XDW A;  4J86 A;  3CFV A;  3JRP A;  1B9Y A;  5FFG A;  5THA A;  3KRW B;  3JZN A;  5FQD A;  3VI3 A;  4BL0 A;  2CO0 C;  3O4G A;  2AGZ A;  4G1M A;  2PBI B;  4IA9 A;  3I7P A;  3AH8 B;  4A0B A;  1H2Z A;  5E6R A;  4O2W A;  4G1E A;  3SHF A;  2XYI A;  3OKY A;  4A11 B;  5FKT A;  3JZG A;  1SQJ A;  2TRC B;  3MVD K;  3EI2 A;  3NIG A;  2IUP A;  3EU7 A;  5K1C C;  3SBR A;  1JMZ B;  3L4M D;  4K3J B;  4ZOX A;  3VH0 A;  3MKS B;  2P9N C;  2IAA A;  1O6G A;  3L4O D;  5HE1 B;  1E8N A;  3MUO A;  3QI0 A;  3ZDZ A;  5GSA A;  2AH0 A;  2P9S C;  3RSE C;  5TEE A;  3BWS A;  2BCJ B;  3K26 A;  4FA4 D;  4NAA A;  3P4F A;  3SVW D;  1JTD B;  3UVM A;  4CY3 A;  3UKR C;  4A08 A;  4BP9 A;  2HJB A;  4LG8 A;  3J80 g;  4GM8 A;  5EAR A;  4CY2 A;  1JMX B;  3I8E A;  2VDR A;  3NID A;  4A09 B;  1R5M A;  4X3E A;  4O45 A;  3ULE C;  3IIY A;  1PI6 A;  5TF2 A;  5FKQ A;  4ZN4 A;  3GC3 B;  2HU8 A;  3V4V A;  4CZX A;  2MTA H;  4JSN C;  4ERY A;  1RI6 A;  2GC7 A;  5EM2 A;  1U2V C;  4X63 B;  4N14 A;  5M5V A;  1XIP A;  4G55 A;  3NIF A;  4JXM A;  3OL2 B;  5EMJ B;  2VDQ A;  3IJE A;  4BCD A;  4BP8 A;  4IMM A;  4EWR A;  3MZK A;  1UOQ A;  4X60 B;  4CI1 A;  3A0F A;  2VDN A;  1NR0 A;  4XYH A;  3K6S A;  3HFQ A;  4MMY A;  1B9X A;  2G9A A;  4PXW A;  2VDL A;  4FWW A;  3IUL A;  5E6S A;  2Z2P A;  5FXY A;  1Q47 A;  1TYQ C;  4J77 A;  3EMH A;  4LGN A;  2VDP A;  1GOG A;  4AN0 A;  2PM9 A;  2W18 A;  4E5Z A;  4D0K A;  4D6V A; 
#chains in the Genus database with same CATH homology
 3RN1 D;  3DWL C;  2OK6 A;  4FAN D;  3JZH A;  3SXT D;  4CZY A;  2P9P C;  4GM9 A;  5IJ8 E;  3OTT A;  4QQE A;  3UVL A;  3SBQ A;  2IUV A;  4UI9 R;  4GZ8 A;  1A0R B;  3OW8 A;  2OK4 A;  3GRE A;  3C99 A;  2HYE A;  4E54 B;  2CNX A;  5EAP A;  4CI8 A;  5K19 A;  4QRJ A;  2QC5 A;  3PXW D;  4J8G A;  2YMU A;  1PBY B;  2H9M A;  1N6D A;  4BH6 A;  2AH1 A;  4ESG A;  3UVN A;  3W15 A;  5CXC B;  4FA9 D;  3SCY A;  5GXH A;  2J55 H;  3I7H A;  3PE7 A;  1ERJ A;  5HE0 B;  4OZU A;  4A2M A;  2Z2O A;  3RMZ D;  5I5J A;  3DM0 A;  2PM6 B;  1OLZ A;  1MG3 A;  4U1E I;  5FA5 B;  1SHY B;  2YNO A;  3I89 A;  5A2Q g;  3EI4 B;  4X61 B;  3I7L A;  4J79 A;  5AJA A;  1VYH C;  4GGA A;  1OMW B;  4FA5 D;  2H6K A;  5AFU 3;  4A08 B;  2IWK A;  4HDJ A;  2H9L A;  3UKU C;  3GFC A;  4AEZ A;  2I3S A;  3E0C A;  2GC4 A;  3B7F A;  3IJ0 A;  5CYK A;  5IJ7 E;  4J0W A;  3JAM g;  3J81 g;  3FRX A;  4PBY A;  3ORV D;  5B4W A;  3IKO A;  4ZOZ A;  1GP2 B;  2AGW A;  3DSM A;  4CY5 A;  5SXM A;  1XHM A;  4Y7R A;  5HE2 B;  2CE8 A;  2J56 H;  3PVW B;  3DXK C;  4ERQ A;  4PSX B;  2B5M A;  3AL8 B;  3C5M A;  4CI3 A;  3AFC A;  3I7O A;  3EI3 B;  4JSX C;  2P9L C;  2OVQ B;  4A11 A;  5CXB B;  4J87 A;  2I0T A;  1SQ9 A;  2CN2 A;  4FHL A;  5JWZ A;  2UZY B;  4I79 A;  5HE3 B;  2OIZ A;  1K32 A;  3PVU B;  2B4E A;  3MZL A;  1GXR A;  3SWS D;  4Y5R D;  1P22 A;  5FKR A;  4U7A A;  4GQ1 A;  4JSV C;  2YNP A;  3JB9 L;  3RN0 D;  2H47 A;  3V9F A;  1QNI A;  5TDH B;  4ZOV A;  3RRM C;  1N6E A;  2XL3 A;  4L9O A;  4J0X A;  1K8K C;  2B5L A;  4L3G D;  3EG6 A;  5IGO A;  5GXI A;  2HKM A;  3I7N A;  2CO0 A;  4PNK B;  4CY1 A;  1PEV A;  4A0A B;  4JT6 C;  4AOW A;  2GNQ A;  5EML B;  4GM3 A;  5TEF A;  3EWE A;  2H3X A;  2I0R A;  4A09 A;  4ERZ A;  4XYI A;  4FA1 D;  5I5I A;  3SMR A;  4BUJ C;  1MG2 A;  3F3P A;  4O9D A;  4GMB A;  3RLM D;  1S4U X;  3I2N A;  4A0B B;  2HES X;  2I3T A;  5HQG A;  4CC9 A;  3CIK B;  3OKY B;  1NEX B;  3CFS B;  2XU7 A;  3MMY A;  3EI2 B;  4GGC A;  5EAM A;  4QL1 A;  5IGQ A;  5FLX g;  2J57 G;  4GQB B;  2H6N A;  3N0D A;  2YNN A;  2YB8 B;  3SN6 B;  1GG2 B;  2HXC A;  5C2W B;  3PXT D;  3EI1 A;  2H9P A;  3RFG A;  4CI2 A;  3I8C A;  3BG1 A;  5C9Z B;  3K27 A;  3IJ1 A;  4G56 B;  4J84 A;  4A2L A;  4GQ2 P;  5KDO B;  3IJC A;  4O3U B;  2P9I C;  3V7D B;  1U4C A;  3AL9 A;  5IT9 g;  3NVN A;  3NVQ A;  4E54 A;  4LG9 A;  3I7K A;  1JOF A;  3JPX A;  2IWF A;  4R7A B;  5EM2 B;  4KFM B;  4XEI C;  3SBP A;  2CN3 A;  4JSP C;  2HJ4 A;  5CXC A;  1YFQ A;  4K3I D;  4OWR A;  5I5M A;  2OVP B;  2Z2N A;  4JT5 C;  1FWX A;  3DXM C;  4GGD A;  2OJY A;  2PM9 B;  2AGX A;  4CZV A;  4E5Z B;  4NSX A;  5H17 A;  1XKS A;  5FKS A;  3EI4 A;  3KRX B;  2G99 A;  1N6F A;  4J82 A;  3SLE D;  2H6Q A;  2QXV A;  3F3F A;  4H5J A;  5EMK B;  3VA6 A;  4ZOY A;  3UVO A;  2IUQ A;  3C9C A;  2BBK H;  2P9U C;  5H14 A;  3C75 H;  3F3G A;  3PXS D;  1TBG A;  4PC0 A;  4L3H D;  3FM0 A;  4ES0 A;  4O1Q D;  5C2V B;  2OVR B;  3MXX A;  3N0E A;  4J73 A;  4MK0 B;  3ZWL B;  3SFZ A;  2H14 A;  2IUR A;  3ODT A;  3RFH A;  3PSC B;  3NVX A;  3AL8 A;  2AGL A;  2P9K C;  4YVD A;  4A7J A;  5IC7 A;  3EI3 A;  4O3T B;  3BG0 A;  2HKR A;  1JJU B;  4L1Q D;  5H1M A;  5AMS A;  5HYN B;  2H9N A;  3MKQ A;  2EBS A;  5CXB A;  5EMM B;  2H13 A;  3SJL D;  3VGZ A;  4PBZ A;  4TZ4 A;  1GOT B;  2PM7 B;  2CE9 A;  3IIW A;  3V5W B;  3EI1 B;  2YBA A;  2AQ5 A;  2B5N A;  4JD2 C;  3OL2 A;  3PSL A;  1L0Q A;  3U4Y A;  4QT8 A;  4J78 A;  4PSW B;  2I0S A;  4Z8L A;  2Q7Q A;  1PGU A;  4FB1 D;  3UR4 A;  2UZX B;  4J8B A;  3UVK A;  4FAV D;  5CYK B;  3JRO A;  3FGB A;  2AGY A;  2XL2 A;  3OKT A;  5GMK n;  2H68 A;  3OKW A;  4J81 A;  1MDA H;  4H5I A;  4A0A A;  2O9K A;  5EAL A;  4J86 A;  3CFV A;  3JRP A;  1B9Y A;  5THA A;  3KRW B;  3JZN A;  5FQD A;  4BL0 A;  2CO0 C;  2AGZ A;  2PBI B;  4IA9 A;  3I7P A;  3AH8 B;  4A0B A;  3SHF A;  2XYI A;  3OKY A;  4A11 B;  5FKT A;  3JZG A;  1SQJ A;  2TRC B;  3EI2 A;  2IUP A;  3EU7 A;  5K1C C;  3SBR A;  1JMZ B;  3L4M D;  4K3J B;  4ZOX A;  3VH0 A;  3MKS B;  2P9N C;  2IAA A;  3L4O D;  5HE1 B;  5GSA A;  2AH0 A;  2P9S C;  3RSE C;  5TEE A;  3BWS A;  2BCJ B;  3K26 A;  4FA4 D;  3P4F A;  3SVW D;  3UVM A;  4CY3 A;  3UKR C;  4A08 A;  2HJB A;  4LG8 A;  3J80 g;  4GM8 A;  5EAR A;  4CY2 A;  1JMX B;  3I8E A;  4A09 B;  1R5M A;  4X3E A;  4O45 A;  3ULE C;  3IIY A;  1PI6 A;  5TF2 A;  5FKQ A;  4ZN4 A;  4CZX A;  2MTA H;  4JSN C;  4ERY A;  1RI6 A;  2GC7 A;  5EM2 A;  1U2V C;  4X63 B;  4N14 A;  1XIP A;  4JXM A;  3OL2 B;  5EMJ B;  4EWR A;  4CI1 A;  4IMM A;  3MZK A;  4X60 B;  3A0F A;  1NR0 A;  4XYH A;  3HFQ A;  1B9X A;  2G9A A;  4PXW A;  4FWW A;  2Z2P A;  5FXY A;  1Q47 A;  1TYQ C;  4J77 A;  3EMH A;  4LGN A;  2PM9 A;  2W18 A;  4E5Z A;  4D0K A;  4D6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...