4GM9A

Crystal structure of human wd repeat domain 5 with compound mm-401
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
309
Chain Sequence
TQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Crystal structure of human WD repeat domain 5 with compound MM-401
rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 99
structure length 309
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gm9A00
4XEIC 3L4MD 3E0CA 2P9UC 4U1EI 2PM6B 4J84A 2B5NA 5A2Qg 4CZYA 3ORVD 3N0EA 2BCJB 3SBPA 3P4FA 3OL2A 3IJ1A 5I5MA 3A0FA 1OMWB 5KDOB 4IMMA 3AFCA 3ODTA 2G9AA 3SLED 4G56B 4U7AA 4LG8A 2P9NC 2HESX 5EAPA 2IUVA 3SHFA 5FQDA 4I79A 2H68A 4E54B 4L3GD 4L9OA 3RSEC 2H6QA 3SMRA 5AFU3 4FA4D 2EBSA 2HKMA 3IJCA 4A09B 3KRWB 3FM0A 3MMYA 2HKRA 2B4EA 5IJ8E 2P9IC 2I0RA 1N6EA 2H14A 4JSNC 4YVDA 5EMJB 4A11A 3U4YA 1U4CA 5IT9g 3OL2B 3SJLD 3RFGA 1TBGA 2AGWA 1MDAH 2OVPB 1PEVA 2H6NA 5FA5B 3SWSD 2OK6A 2UZYB 4GQBB 3RN0D 3I7NA 5EALA 3MZKA 5C9ZB 3SBQA 4J8BA 2IURA 3SCYA 3NVXA 5IGQA 2CN3A 4X63B 1TYQC 5HQGA 2IAAA 4CI3A 1JOFA 5GXIA 4FA1D 2XL2A 4QT8A 1PBYB 3CFSB 2CO0C 4JSXC 3AH8B 4A11B 4ERYA 3EG6A 4D0KA 4QRJA 4A08A 2CN2A 2W18A 4AOWA 2B5LA 1Q47A 3FRXA 1GP2B 5EMLB 3MXXA 2AGXA 4X61B 3JROA 3I2NA 1GG2B 2G99A 1JJUB 4GQ1A 4J81A 5B4WA 2AH0A 5SXMA 4LG9A 5IC7A 5EM2A 3JRPA 4MK0B 4ZOVA 2O9KA 3PE7A 3IKOA 3V9FA 2I0SA 3EI3A 4FA9D 1PI6A 2OIZA 4J82A 3F3PA 2P9KC 4A08B 1K8KC 5CYKA 4A09A 5THAA 2OVRB 1SQ9A 4GM8A 3J81g 4JT5C 2TRCB 1S4UX 5K19A 1YFQA 2CE8A 2AGLA 4A0AA 3I8CA 2J57G 3GFCA 5HE0B 5EM2B 1B9XA 3PSLA 1JMXB 4CY5A 3EI2A 4EWRA 4FHLA 3JZHA 5C2WB 2H9PA 4GQ2P 4ES0A 3L4OD 3EI3B 2BBKH 4AEZA 1N6DA 4CY2A 2H9MA 4Y7RA 3VH0A 4J73A 4Y5RD 4Z8LA 4HDJA 5CYKB 3BG0A 3I7HA 3ULEC 4CY1A 4BUJC 3RN1D 2H6KA 5I5JA 4CI2A 3BG1A 3UKRC 4ZN4A 2CE9A 4J86A 5FKQA 5HE2B 5H17A 4E5ZA 4L1QD 4UI9R 3UVNA 2AGZA 3JZNA 4A0AB 5FXYA 2MTAH 5GSAA 5TEFA 2J55H 3JPXA 4A7JA 4FAND 3BWSA 3EI2B 2QXVA 4JSPC 3ZWLB 5EMKB 5C2VB 4CZVA 2H9NA 2OK4A 4CI8A 5CXCA 4X3EA 3DM0A 3EI4A 5CXBA 5JWZA 3V7DB 5H1MA 5I5IA 3JB9L 4A2LA 3F3GA 3UVOA 2GC7A 3DXMC 3DWLC 3OKTA 3J80g 3PVUB 4E5ZB 3OW8A 3PXTD 4FB1D 3IIYA 5AMSA 5IGOA 2H3XA 2YB8B 1L0QA 2XU7A 3IIWA 4J0XA 3I8EA 4PSXB 4CZXA 4JT6C 4XYIA 4H5IA 2GNQA 4R7AB 4TZ4A 4JD2C 1OLZA 2YMUA 3RRMC 5CXCB 2PBIB 2AGYA 3EMHA 3EI4B 5CXBB 2PM7B 3HFQA 2OVQB 5K1CC 4O9DA 2CO0A 3RLMD 4OWRA 3K26A 4QQEA 4GM3A 3MZLA 4ERZA 2YNPA 4JXMA 2XYIA 3C9CA 1PGUA 5H14A 2QC5A 2Z2NA 1ERJA 4GGDA 4CI1A 3MKQA 3UKUC 3N0DA 1N6FA 2H13A 3I7KA 1SHYB 2J56H 4LGNA 2YNNA 3OKYA 2I3SA 3K27A 2P9PC 5GXHA 1VYHC 3SXTD 3F3FA 1U2VC 4KFMB 5HE1B 3UVLA 3SBRA 4ZOZA 3VA6A 1FWXA 3CIKB 4PXWA 4X60B 5TDHB 4PBYA 1MG3A 3EI1A 3IJ0A 3AL8A 2H47A 3GREA 4ESGA 3SN6B 4QL1A 3I7PA 2YBAA 5FKSA 2GC4A 2Q7QA 2HYEA 3I7OA 4K3JB 1R5MA 4K3ID 3OTTA 1XHMA 3OKYB 4CC9A 5FKRA 2PM9A 4O45A 1RI6A 2P9LC 3I7LA 5HYNB 5EAMA 5TF2A 2CNXA 3NVNA 4GZ8A 4FAVD 4ERQA 3UVMA 4PNKB 5GMKn 3OKWA 3EI1B 3JAMg 4GGAA 3EWEA 1B9YA 4PBZA 3AL8B 1NEXB 4J87A 4BL0A 1K32A 4FA5D 2P9SC 3NVQA 4GGCA 2OJYA 5FLXg 4A0BA 3B7FA 5EARA 1XKSA 4XYHA 3CFVA 2B5MA 3PXWD 3UR4A 5AJAA 3C75H 4J8GA 2PM9B 4O3TB 4BH6A 3MKSB 3PXSD 4CY3A 4ZOXA 3SVWD 3KRXB 4J79A 2HXCA 3C99A 4GMBA 1JMZB 4ZOYA 1XIPA 2HJBA 3DXKC 4J78A 4PSWB 2Z2PA 4J77A 4NSXA 2IWFA 2AH1A 3C5MA 3FGBA 4L3HD 5EMMB 4IA9A 2I3TA 2XL3A 3W15A 3SFZA 2HJ4A 4A2MA 2IWKA 3DSMA 4O1QD 3UVKA 2UZXB 4FWWA 1MG2A 3JZGA 2AQ5A 3EU7A 4A0BB 2IUQA 2Z2OA 4J0WA 5FKTA 4OZUA 2YNOA 3AL9A 1A0RB 4PC0A 2H9LA 3RFHA 3I89A 4H5JA 1NR0A 4D6VA 1GOTB 2I0TA 2IUPA 1SQJA 4JSVC 4N14A 3RMZD 5TEEA 3PVWB 1QNIA 4E54A 3PSCB 4O3UB 3V5WB 4GM9A 3VGZA 5IJ7E 1GXRA 5HE3B 1P22A
chains in the Genus database with same CATH superfamily
4XEIC 5M5TA 3L4MD 3E0CA 5M5VA 3MUNA 2P9UC 4U1EI 2PM6B 4J84A 2B5NA 2XDWA 5A2Qg 4CZYA 3ORVD 3N0EA 2BCJB 3SBPA 3P4FA 3OL2A 4G1EA 3IJ1A 5I5MA 3A0FA 2EIBA 3EQ9A 1OMWB 5KDOB 4IMMA 3AFCA 4UM8A 3ODTA 2G9AA 3SLED 4G56B 4U7AA 4LG8A 2P9NC 2HESX 2VZ3A 4WK2A 5EAPA 3NIGA 2EIDA 2IUVA 3SHFA 5FQDA 4I79A 2H68A 4E54B 4L3GD 4L9OA 4AMZA 2WQ8A 3RSEC 2H6QA 3SMRA 5AFU3 4FA4D 2EBSA 2HKMA 3IJCA 4A09B 3KRWB 3FM0A 3MMYA 2HKRA 2B4EA 5IJ8E 2P9IC 3IJEA 2I0RA 1N6EA 2H14A 3NIDA 4JSNC 4YVDA 5EMJB 3IURA 3O4HA 4A11A 3U4YA 1U4CA 5IT9g 1VZ2A 3OL2B 3IUJA 3SJLD 2QR5A 3RFGA 4MMZA 4BP8A 1TBGA 2AGWA 1MDAH 1VZ3A 4G1MA 2OVPB 1PEVA 2H6NA 5FA5B 3SWSD 2OK6A 1C9LA 2UZYB 4GQBB 3RN0D 4BCCA 5E6RA 2EICA 3I7NA 5EALA 3MZKA 5C9ZB 1UOQA 3SBQA 4DNWA 4J8BA 2IURA 3SCYA 3NVXA 5IGQA 2CN3A 1H2ZA 4X63B 1TYQC 5HQGA 1BPOA 2IAAA 4CI3A 1JOFA 4JHPC 5GXIA 4FA1D 2XL2A 4QT8A 1PBYB 3CFSB 2CO0C 3K72A 4JSXC 2VDOA 3AH8B 4A11B 4ERYA 3EG6A 4D0KA 4QRJA 4A08A 2CN2A 2W18A 4AOWA 4DNVA 2B5LA 1Q47A 3FRXA 1GP2B 4WJKA 5EMLB 3MXXA 2AGXA 1E5TA 4X61B 3JROA 3I2NA 4D9SA 1GG2B 2G99A 1JJUB 4GQ1A 4J81A 5B4WA 2AH0A 5SXMA 4LG9A 5IC7A 5EM2A 3JRPA 4MK0B 2VZ1A 4MMYA 4ZOVA 2O9KA 3PE7A 3IKOA 1L5GA 3IUQA 3V9FA 2I0SA 3EI3A 4FA9D 1PI6A 2OIZA 4J82A 5E6SA 3V4PA 1O6GA 3ZDZA 1U8CA 3F3PA 2P9KC 4A08B 1K8KC 5CYKA 4A09A 5THAA 2OVRB 1SQ9A 4GM8A 3ZE0A 3J81g 4JT5C 2TRCB 2VDRA 1S4UX 5K19A 1YFQA 2CE8A 2AGLA 3IUMA 4A0AA 4G55A 3I8CA 2J57G 3IULA 3GFCA 5HE0B 5EM2B 1B9XA 3O4JA 3PSLA 1JMXB 4CY5A 3EI2A 3GD1I 4EWRA 4FHLA 2XZGA 3JZHA 5C2WB 2H9PA 4GQ2P 4ES0A 3L4OD 3EI3B 2BBKH 4AEZA 1N6DA 4CY2A 2H9MA 4Y7RA 3VH0A 4J73A 4Y5RD 4Z8LA 4HDJA 5FFGA 5CYKB 4Z7OA 3BG0A 3I7HA 3ULEC 4CY1A 4BUJC 3RN1D 2H6KA 4IRZA 5I5JA 1H2YA 4AN1A 4CI2A 3BG1A 3UKRC 4ZN4A 1E8NA 2CE9A 2VDPA 4J86A 5FKQA 5HE2B 3MVDK 5H17A 4E5ZA 4L1QD 4UI9R 4AX4A 3UVNA 2AGZA 3JZNA 4A0AB 3OF7A 5FXYA 2MTAH 5GSAA 3K6SA 5TEFA 2J55H 3JPXA 4A7JA 4FAND 1I2MB 2VDMA 3BWSA 3EI2B 2QXVA 4JSPC 3ZWLB 1GOFA 3IUNA 5EMKB 3ZE2A 3QI0A 5C2VB 4CZVA 5M5RA 2H9NA 3VI3A 2OK4A 4CI8A 5CXCA 4X3EA 4RE6A 3DM0A 3EI4A 5CXBA 5JWZA 4WK4A 3V7DB 5H1MA 5I5IA 3JB9L 4A2LA 3F3GA 3UVOA 2GC7A 3DXMC 3DWLC 2BKLA 3OKTA 3J80g 4BCBA 3PVUB 2VDKA 2VDLA 4E5ZB 3OW8A 3PXTD 3V4VA 2QZPA 4FB1D 4RE5A 3IIYA 1GOGA 1VE7A 5AMSA 5IGOA 2H3XA 2YB8B 1L0QA 2XU7A 3IIWA 4J0XA 2VDQA 3I8EA 2HU5A 4PSXB 4CZXA 4JT6C 4XYIA 1M1XA 4Z7NA 4H5IA 4UM9A 2GNQA 1JTDB 4NBMA 1H2XA 2JKXA 4R7AB 4TZ4A 4JD2C 3ZDYA 3K71A 4Z7QA 1OLZA 2YMUA 3RRMC 4WK0A 5CXCB 2PBIB 2AGYA 3EMHA 3EQ7A 3EI4B 4MMXA 5CXBB 2PM7B 3HFQA 2OVQB 3VI4A 3EQ8A 5C92A 4JHNA 5K1CC 4O9DA 2CO0A 3RLMD 4OWRA 3K26A 4QQEA 1GOHA 4GM3A 4AMYA 3MZLA 4ERZA 2YNPA 4JXMA 2XYIA 3C9CA 1PGUA 3NIFA 5H14A 2QC5A 2Z2NA 1ERJA 4GGDA 4CI1A 3MKQA 3UKUC 3N0DA 1O6FA 1UOOA 1N6FA 2H13A 3I7KA 1SHYB 2J56H 4LGNA 2YNNA 3FCSA 3OKYA 2I3SA 3K27A 2P9PC 5GXHA 1VYHC 3SXTD 1C9IA 3F3FA 1U2VC 1VE6A 4KFMB 5HE1B 3UVLA 3SBRA 1E8MA 4ZOZA 3MUOA 3KCIA 3VA6A 1FWXA 3CIKB 4PXWA 4X60B 5TDHB 4PBYA 1MG3A 3EI1A 3QHYB 4O02A 3T3PA 3IJ0A 3AL8A 2H47A 3GREA 4ESGA 3SN6B 1QFMA 4QL1A 3I7PA 2YBAA 5FKSA 2GC4A 2Q7QA 5M5SA 2HYEA 3I7OA 4K3JB 1R5MA 4K3ID 3OTTA 1XHMA 3OKYB 2HU7A 5FKRA 4CC9A 4QAMA 3IVMA 2PM9A 4BCDA 4O45A 1RI6A 1UTCA 2P9LC 3I7LA 5HYNB 5EAMA 5TF2A 2CNXA 3NVNA 4GZ8A 4FAVD 3ZDXA 2EIEA 4ERQA 3UVMA 4AN0A 3DDUA 4BP9A 3T3MA 4PNKB 5GMKn 3OKWA 3EI1B 3JAMg 1UOPA 4GGAA 3EWEA 1B9YA 4PBZA 3AL8B 2VDNA 1NEXB 4J87A 4BL0A 1K32A 2VC2A 4FA5D 2P9SC 3NVQA 4GGCA 3ZE1A 2OJYA 5FLXg 4A0BA 5M61A 1K3IA 3B7FA 5EARA 1XKSA 4XYHA 3CFVA 2B5MA 3PXWD 3UR4A 5AJAA 3C75H 4J8GA 5C86A 2PM9B 4O3TB 1JV2A 4BH6A 3MKSB 3PXSD 4CY3A 4ZOXA 3SVWD 3KRXB 3FCUA 1T2XA 4J79A 2HXCA 3C99A 4GMBA 1JMZB 4ZOYA 5M5UA 1XIPA 2HJBA 3DXKC 4J78A 4PSWB 2Z2PA 3O4IA 5E6UA 4J77A 4O2WA 4NSXA 2IWFA 2AH1A 3C5MA 4L1MA 3FGBA 4L3HD 5EMMB 1H2WA 2I3TA 2XL3A 4IA9A 3W15A 3SFZA 2HJ4A 1QFSA 4A2MA 2IWKA 5FFOA 3DSMA 4O1QD 3UVKA 2UZXB 1TYEA 4FWWA 1MG2A 3JZGA 2AQ5A 3EU7A 4A0BB 2IUQA 2Z2OA 4J0WA 5FKTA 3O4GA 2YNOA 3AL9A 1A0RB 4NAAA 4OZUA 4PC0A 4NENA 2HU8A 2H9LA 3RFHA 3I89A 4H5JA 1NR0A 5HDBA 4D6VA 1GOTB 2I0TA 2IUPA 1YR2A 4NC4A 1SQJA 4JSVC 4N14A 4DNUA 1A12A 3RMZD 5TEEA 3PVWB 1QNIA 4E54A 3PSCB 4O3UB 3V5WB 4GM9A 3GC3B 3VGZA 2XE4A 5IJ7E 1GXRA 5HE3B 1P22A
chains in the Genus database with same CATH topology
4XEIC 3L4MD 3E0CA 2P9UC 4U1EI 2PM6B 4J84A 2B5NA 5A2Qg 4CZYA 3ORVD 3N0EA 2BCJB 3SBPA 3P4FA 3OL2A 3IJ1A 5I5MA 3A0FA 1OMWB 5KDOB 4IMMA 3AFCA 3ODTA 2G9AA 3SLED 4G56B 4U7AA 4LG8A 2P9NC 2HESX 5EAPA 2IUVA 3SHFA 5FQDA 4I79A 2H68A 4E54B 4L3GD 4L9OA 3RSEC 2H6QA 3SMRA 5AFU3 4FA4D 2EBSA 2HKMA 3IJCA 4A09B 3KRWB 3FM0A 3MMYA 2HKRA 2B4EA 5IJ8E 2P9IC 2I0RA 1N6EA 2H14A 4JSNC 4YVDA 5EMJB 4A11A 3U4YA 1U4CA 5IT9g 3OL2B 3SJLD 3RFGA 1TBGA 2AGWA 1MDAH 2OVPB 1PEVA 2H6NA 5FA5B 3SWSD 2OK6A 2UZYB 4GQBB 3RN0D 3I7NA 5EALA 3MZKA 5C9ZB 3SBQA 4J8BA 2IURA 3SCYA 3NVXA 5IGQA 2CN3A 4X63B 1TYQC 5HQGA 2IAAA 4CI3A 1JOFA 5GXIA 4FA1D 2XL2A 4QT8A 1PBYB 3CFSB 2CO0C 4JSXC 3AH8B 4A11B 4ERYA 3EG6A 4D0KA 4QRJA 4A08A 2CN2A 2W18A 4AOWA 2B5LA 1Q47A 3FRXA 1GP2B 5EMLB 3MXXA 2AGXA 4X61B 3JROA 3I2NA 1GG2B 2G99A 1JJUB 4GQ1A 4J81A 5B4WA 2AH0A 5SXMA 4LG9A 5IC7A 5EM2A 3JRPA 4MK0B 4ZOVA 2O9KA 3PE7A 3IKOA 3V9FA 2I0SA 3EI3A 4FA9D 1PI6A 2OIZA 4J82A 3F3PA 2P9KC 4A08B 1K8KC 5CYKA 4A09A 5THAA 2OVRB 1SQ9A 4GM8A 3J81g 4JT5C 2TRCB 1S4UX 5K19A 1YFQA 2CE8A 2AGLA 4A0AA 3I8CA 2J57G 3GFCA 5HE0B 5EM2B 1B9XA 3PSLA 1JMXB 4CY5A 3EI2A 4EWRA 4FHLA 3JZHA 5C2WB 2H9PA 4GQ2P 4ES0A 3L4OD 3EI3B 2BBKH 4AEZA 1N6DA 4CY2A 2H9MA 4Y7RA 3VH0A 4J73A 4Y5RD 4Z8LA 4HDJA 5CYKB 3BG0A 3I7HA 3ULEC 4CY1A 4BUJC 3RN1D 2H6KA 5I5JA 4CI2A 3BG1A 3UKRC 4ZN4A 2CE9A 4J86A 5FKQA 5HE2B 5H17A 4E5ZA 4L1QD 4UI9R 3UVNA 2AGZA 3JZNA 4A0AB 5FXYA 2MTAH 5GSAA 5TEFA 2J55H 3JPXA 4A7JA 4FAND 3BWSA 3EI2B 2QXVA 4JSPC 3ZWLB 5EMKB 5C2VB 4CZVA 2H9NA 2OK4A 4CI8A 5CXCA 4X3EA 3DM0A 3EI4A 5CXBA 5JWZA 3V7DB 5H1MA 5I5IA 3JB9L 4A2LA 3F3GA 3UVOA 2GC7A 3DXMC 3DWLC 3OKTA 3J80g 3PVUB 4E5ZB 3OW8A 3PXTD 4FB1D 3IIYA 5AMSA 5IGOA 2H3XA 2YB8B 1L0QA 2XU7A 3IIWA 4J0XA 3I8EA 4PSXB 4CZXA 4JT6C 4XYIA 4H5IA 2GNQA 4R7AB 4TZ4A 4JD2C 1OLZA 2YMUA 3RRMC 5CXCB 2PBIB 2AGYA 3EMHA 3EI4B 5CXBB 2PM7B 3HFQA 2OVQB 5K1CC 4O9DA 2CO0A 3RLMD 4OWRA 3K26A 4QQEA 4GM3A 3MZLA 4ERZA 2YNPA 4JXMA 2XYIA 3C9CA 1PGUA 5H14A 2QC5A 2Z2NA 1ERJA 4GGDA 4CI1A 3MKQA 3UKUC 3N0DA 1N6FA 2H13A 3I7KA 1SHYB 2J56H 4LGNA 2YNNA 3OKYA 2I3SA 3K27A 2P9PC 5GXHA 1VYHC 3SXTD 3F3FA 1U2VC 4KFMB 5HE1B 3UVLA 3SBRA 4ZOZA 3VA6A 1FWXA 3CIKB 4PXWA 4X60B 5TDHB 4PBYA 1MG3A 3EI1A 3IJ0A 3AL8A 2H47A 3GREA 4ESGA 3SN6B 4QL1A 3I7PA 2YBAA 5FKSA 2GC4A 2Q7QA 2HYEA 3I7OA 4K3JB 1R5MA 4K3ID 3OTTA 1XHMA 3OKYB 4CC9A 5FKRA 2PM9A 4O45A 1RI6A 2P9LC 3I7LA 5HYNB 5EAMA 5TF2A 2CNXA 3NVNA 4GZ8A 4FAVD 4ERQA 3UVMA 4PNKB 5GMKn 3OKWA 3EI1B 3JAMg 4GGAA 3EWEA 1B9YA 4PBZA 3AL8B 1NEXB 4J87A 4BL0A 1K32A 4FA5D 2P9SC 3NVQA 4GGCA 2OJYA 5FLXg 4A0BA 3B7FA 5EARA 1XKSA 4XYHA 3CFVA 2B5MA 3PXWD 3UR4A 5AJAA 3C75H 4J8GA 2PM9B 4O3TB 4BH6A 3MKSB 3PXSD 4CY3A 4ZOXA 3SVWD 3KRXB 4J79A 2HXCA 3C99A 4GMBA 1JMZB 4ZOYA 1XIPA 2HJBA 3DXKC 4J78A 4PSWB 2Z2PA 4J77A 4NSXA 2IWFA 2AH1A 3C5MA 3FGBA 4L3HD 5EMMB 4IA9A 2I3TA 2XL3A 3W15A 3SFZA 2HJ4A 4A2MA 2IWKA 3DSMA 4O1QD 3UVKA 2UZXB 4FWWA 1MG2A 3JZGA 2AQ5A 3EU7A 4A0BB 2IUQA 2Z2OA 4J0WA 5FKTA 4OZUA 2YNOA 3AL9A 1A0RB 4PC0A 2H9LA 3RFHA 3I89A 4H5JA 1NR0A 4D6VA 1GOTB 2I0TA 2IUPA 1SQJA 4JSVC 4N14A 3RMZD 5TEEA 3PVWB 1QNIA 4E54A 3PSCB 4O3UB 3V5WB 4GM9A 3VGZA 5IJ7E 1GXRA 5HE3B 1P22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEI C;  3L4M D;  3E0C A;  2P9U C;  4U1E I;  2PM6 B;  4J84 A;  2B5N A;  5A2Q g;  4CZY A;  3ORV D;  3N0E A;  2BCJ B;  3SBP A;  3P4F A;  3OL2 A;  3IJ1 A;  5I5M A;  3A0F A;  1OMW B;  5KDO B;  4IMM A;  3AFC A;  3ODT A;  2G9A A;  3SLE D;  4G56 B;  4U7A A;  4LG8 A;  2P9N C;  2HES X;  5EAP A;  2IUV A;  3SHF A;  5FQD A;  4I79 A;  2H68 A;  4E54 B;  4L3G D;  4L9O A;  3RSE C;  2H6Q A;  3SMR A;  5AFU 3;  4FA4 D;  2EBS A;  2HKM A;  3IJC A;  4A09 B;  3KRW B;  3FM0 A;  3MMY A;  2HKR A;  2B4E A;  5IJ8 E;  2P9I C;  2I0R A;  1N6E A;  2H14 A;  4JSN C;  4YVD A;  5EMJ B;  4A11 A;  3U4Y A;  1U4C A;  5IT9 g;  3OL2 B;  3SJL D;  3RFG A;  1TBG A;  2AGW A;  1MDA H;  2OVP B;  1PEV A;  2H6N A;  5FA5 B;  3SWS D;  2OK6 A;  2UZY B;  4GQB B;  3RN0 D;  3I7N A;  5EAL A;  3MZK A;  5C9Z B;  3SBQ A;  4J8B A;  2IUR A;  3SCY A;  3NVX A;  5IGQ A;  2CN3 A;  4X63 B;  1TYQ C;  5HQG A;  2IAA A;  4CI3 A;  1JOF A;  5GXI A;  4FA1 D;  2XL2 A;  4QT8 A;  1PBY B;  3CFS B;  2CO0 C;  4JSX C;  3AH8 B;  4A11 B;  4ERY A;  3EG6 A;  4D0K A;  4QRJ A;  4A08 A;  2CN2 A;  2W18 A;  4AOW A;  2B5L A;  1Q47 A;  3FRX A;  1GP2 B;  5EML B;  3MXX A;  2AGX A;  4X61 B;  3JRO A;  3I2N A;  1GG2 B;  2G99 A;  1JJU B;  4GQ1 A;  4J81 A;  5B4W A;  2AH0 A;  5SXM A;  4LG9 A;  5IC7 A;  5EM2 A;  3JRP A;  4MK0 B;  4ZOV A;  2O9K A;  3PE7 A;  3IKO A;  3V9F A;  2I0S A;  3EI3 A;  4FA9 D;  1PI6 A;  2OIZ A;  4J82 A;  3F3P A;  2P9K C;  4A08 B;  1K8K C;  5CYK A;  4A09 A;  5THA A;  2OVR B;  1SQ9 A;  4GM8 A;  3J81 g;  4JT5 C;  2TRC B;  1S4U X;  5K19 A;  1YFQ A;  2CE8 A;  2AGL A;  4A0A A;  3I8C A;  2J57 G;  3GFC A;  5HE0 B;  5EM2 B;  1B9X A;  3PSL A;  1JMX B;  4CY5 A;  3EI2 A;  4EWR A;  4FHL A;  3JZH A;  5C2W B;  2H9P A;  4GQ2 P;  4ES0 A;  3L4O D;  3EI3 B;  2BBK H;  4AEZ A;  1N6D A;  4CY2 A;  2H9M A;  4Y7R A;  3VH0 A;  4J73 A;  4Y5R D;  4Z8L A;  4HDJ A;  5CYK B;  3BG0 A;  3I7H A;  3ULE C;  4CY1 A;  4BUJ C;  3RN1 D;  2H6K A;  5I5J A;  4CI2 A;  3BG1 A;  3UKR C;  4ZN4 A;  2CE9 A;  4J86 A;  5FKQ A;  5HE2 B;  5H17 A;  4E5Z A;  4L1Q D;  4UI9 R;  3UVN A;  2AGZ A;  3JZN A;  4A0A B;  5FXY A;  2MTA H;  5GSA A;  5TEF A;  2J55 H;  3JPX A;  4A7J A;  4FAN D;  3BWS A;  3EI2 B;  2QXV A;  4JSP C;  3ZWL B;  5EMK B;  5C2V B;  4CZV A;  2H9N A;  2OK4 A;  4CI8 A;  5CXC A;  4X3E A;  3DM0 A;  3EI4 A;  5CXB A;  5JWZ A;  3V7D B;  5H1M A;  5I5I A;  3JB9 L;  4A2L A;  3F3G A;  3UVO A;  2GC7 A;  3DXM C;  3DWL C;  3OKT A;  3J80 g;  3PVU B;  4E5Z B;  3OW8 A;  3PXT D;  4FB1 D;  3IIY A;  5AMS A;  5IGO A;  2H3X A;  2YB8 B;  1L0Q A;  2XU7 A;  3IIW A;  4J0X A;  3I8E A;  4PSX B;  4CZX A;  4JT6 C;  4XYI A;  4H5I A;  2GNQ A;  4R7A B;  4TZ4 A;  4JD2 C;  1OLZ A;  2YMU A;  3RRM C;  5CXC B;  2PBI B;  2AGY A;  3EMH A;  3EI4 B;  5CXB B;  2PM7 B;  3HFQ A;  2OVQ B;  5K1C C;  4O9D A;  2CO0 A;  3RLM D;  4OWR A;  3K26 A;  4QQE A;  4GM3 A;  3MZL A;  4ERZ A;  2YNP A;  4JXM A;  2XYI A;  3C9C A;  1PGU A;  5H14 A;  2QC5 A;  2Z2N A;  1ERJ A;  4GGD A;  4CI1 A;  3MKQ A;  3UKU C;  3N0D A;  1N6F A;  2H13 A;  3I7K A;  1SHY B;  2J56 H;  4LGN A;  2YNN A;  3OKY A;  2I3S A;  3K27 A;  2P9P C;  5GXH A;  1VYH C;  3SXT D;  3F3F A;  1U2V C;  4KFM B;  5HE1 B;  3UVL A;  3SBR A;  4ZOZ A;  3VA6 A;  1FWX A;  3CIK B;  4PXW A;  4X60 B;  5TDH B;  4PBY A;  1MG3 A;  3EI1 A;  3IJ0 A;  3AL8 A;  2H47 A;  3GRE A;  4ESG A;  3SN6 B;  4QL1 A;  3I7P A;  2YBA A;  5FKS A;  2GC4 A;  2Q7Q A;  2HYE A;  3I7O A;  4K3J B;  1R5M A;  4K3I D;  3OTT A;  1XHM A;  3OKY B;  4CC9 A;  5FKR A;  2PM9 A;  4O45 A;  1RI6 A;  2P9L C;  3I7L A;  5HYN B;  5EAM A;  5TF2 A;  2CNX A;  3NVN A;  4GZ8 A;  4FAV D;  4ERQ A;  3UVM A;  4PNK B;  5GMK n;  3OKW A;  3EI1 B;  3JAM g;  4GGA A;  3EWE A;  1B9Y A;  4PBZ A;  3AL8 B;  1NEX B;  4J87 A;  4BL0 A;  1K32 A;  4FA5 D;  2P9S C;  3NVQ A;  4GGC A;  2OJY A;  5FLX g;  4A0B A;  3B7F A;  5EAR A;  1XKS A;  4XYH A;  3CFV A;  2B5M A;  3PXW D;  3UR4 A;  5AJA A;  3C75 H;  4J8G A;  2PM9 B;  4O3T B;  4BH6 A;  3MKS B;  3PXS D;  4CY3 A;  4ZOX A;  3SVW D;  3KRX B;  4J79 A;  2HXC A;  3C99 A;  4GMB A;  1JMZ B;  4ZOY A;  1XIP A;  2HJB A;  3DXK C;  4J78 A;  4PSW B;  2Z2P A;  4J77 A;  4NSX A;  2IWF A;  2AH1 A;  3C5M A;  3FGB A;  4L3H D;  5EMM B;  4IA9 A;  2I3T A;  2XL3 A;  3W15 A;  3SFZ A;  2HJ4 A;  4A2M A;  2IWK A;  3DSM A;  4O1Q D;  3UVK A;  2UZX B;  4FWW A;  1MG2 A;  3JZG A;  2AQ5 A;  3EU7 A;  4A0B B;  2IUQ A;  2Z2O A;  4J0W A;  5FKT A;  4OZU A;  2YNO A;  3AL9 A;  1A0R B;  4PC0 A;  2H9L A;  3RFH A;  3I89 A;  4H5J A;  1NR0 A;  4D6V A;  1GOT B;  2I0T A;  2IUP A;  1SQJ A;  4JSV C;  4N14 A;  3RMZ D;  5TEE A;  3PVW B;  1QNI A;  4E54 A;  3PSC B;  4O3U B;  3V5W B;  4GM9 A;  3VGZ A;  5IJ7 E;  1GXR A;  5HE3 B;  1P22 A; 
#chains in the Genus database with same CATH topology
 4XEI C;  5M5T A;  3L4M D;  3E0C A;  5M5V A;  3MUN A;  2P9U C;  4U1E I;  2PM6 B;  4J84 A;  2B5N A;  2XDW A;  5A2Q g;  4CZY A;  3ORV D;  3N0E A;  2BCJ B;  3SBP A;  3P4F A;  3OL2 A;  4G1E A;  3IJ1 A;  5I5M A;  3A0F A;  2EIB A;  3EQ9 A;  1OMW B;  5KDO B;  4IMM A;  3AFC A;  4UM8 A;  3ODT A;  2G9A A;  3SLE D;  4G56 B;  4U7A A;  4LG8 A;  2P9N C;  2HES X;  2VZ3 A;  4WK2 A;  5EAP A;  3NIG A;  2EID A;  2IUV A;  3SHF A;  5FQD A;  4I79 A;  2H68 A;  4E54 B;  4L3G D;  4L9O A;  4AMZ A;  2WQ8 A;  3RSE C;  2H6Q A;  3SMR A;  5AFU 3;  4FA4 D;  2EBS A;  2HKM A;  3IJC A;  4A09 B;  3KRW B;  3FM0 A;  3MMY A;  2HKR A;  2B4E A;  5IJ8 E;  2P9I C;  3IJE A;  2I0R A;  1N6E A;  2H14 A;  3NID A;  4JSN C;  4YVD A;  5EMJ B;  3IUR A;  3O4H A;  4A11 A;  3U4Y A;  1U4C A;  5IT9 g;  1VZ2 A;  3OL2 B;  3IUJ A;  3SJL D;  2QR5 A;  3RFG A;  4MMZ A;  4BP8 A;  1TBG A;  2AGW A;  1MDA H;  1VZ3 A;  4G1M A;  2OVP B;  1PEV A;  2H6N A;  5FA5 B;  3SWS D;  2OK6 A;  1C9L A;  2UZY B;  4GQB B;  3RN0 D;  4BCC A;  5E6R A;  2EIC A;  3I7N A;  5EAL A;  3MZK A;  5C9Z B;  1UOQ A;  3SBQ A;  4DNW A;  4J8B A;  2IUR A;  3SCY A;  3NVX A;  5IGQ A;  2CN3 A;  1H2Z A;  4X63 B;  1TYQ C;  5HQG A;  1BPO A;  2IAA A;  4CI3 A;  1JOF A;  4JHP C;  5GXI A;  4FA1 D;  2XL2 A;  4QT8 A;  1PBY B;  3CFS B;  2CO0 C;  3K72 A;  4JSX C;  2VDO A;  3AH8 B;  4A11 B;  4ERY A;  3EG6 A;  4D0K A;  4QRJ A;  4A08 A;  2CN2 A;  2W18 A;  4AOW A;  4DNV A;  2B5L A;  1Q47 A;  3FRX A;  1GP2 B;  4WJK A;  5EML B;  3MXX A;  2AGX A;  1E5T A;  4X61 B;  3JRO A;  3I2N A;  4D9S A;  1GG2 B;  2G99 A;  1JJU B;  4GQ1 A;  4J81 A;  5B4W A;  2AH0 A;  5SXM A;  4LG9 A;  5IC7 A;  5EM2 A;  3JRP A;  4MK0 B;  2VZ1 A;  4MMY A;  4ZOV A;  2O9K A;  3PE7 A;  3IKO A;  1L5G A;  3IUQ A;  3V9F A;  2I0S A;  3EI3 A;  4FA9 D;  1PI6 A;  2OIZ A;  4J82 A;  5E6S A;  3V4P A;  1O6G A;  3ZDZ A;  1U8C A;  3F3P A;  2P9K C;  4A08 B;  1K8K C;  5CYK A;  4A09 A;  5THA A;  2OVR B;  1SQ9 A;  4GM8 A;  3ZE0 A;  3J81 g;  4JT5 C;  2TRC B;  2VDR A;  1S4U X;  5K19 A;  1YFQ A;  2CE8 A;  2AGL A;  3IUM A;  4A0A A;  4G55 A;  3I8C A;  2J57 G;  3IUL A;  3GFC A;  5HE0 B;  5EM2 B;  1B9X A;  3O4J A;  3PSL A;  1JMX B;  4CY5 A;  3EI2 A;  3GD1 I;  4EWR A;  4FHL A;  2XZG A;  3JZH A;  5C2W B;  2H9P A;  4GQ2 P;  4ES0 A;  3L4O D;  3EI3 B;  2BBK H;  4AEZ A;  1N6D A;  4CY2 A;  2H9M A;  4Y7R A;  3VH0 A;  4J73 A;  4Y5R D;  4Z8L A;  4HDJ A;  5FFG A;  5CYK B;  4Z7O A;  3BG0 A;  3I7H A;  3ULE C;  4CY1 A;  4BUJ C;  3RN1 D;  2H6K A;  4IRZ A;  5I5J A;  1H2Y A;  4AN1 A;  4CI2 A;  3BG1 A;  3UKR C;  4ZN4 A;  1E8N A;  2CE9 A;  2VDP A;  4J86 A;  5FKQ A;  5HE2 B;  3MVD K;  5H17 A;  4E5Z A;  4L1Q D;  4UI9 R;  4AX4 A;  3UVN A;  2AGZ A;  3JZN A;  4A0A B;  3OF7 A;  5FXY A;  2MTA H;  5GSA A;  3K6S A;  5TEF A;  2J55 H;  3JPX A;  4A7J A;  4FAN D;  1I2M B;  2VDM A;  3BWS A;  3EI2 B;  2QXV A;  4JSP C;  3ZWL B;  1GOF A;  3IUN A;  5EMK B;  3ZE2 A;  3QI0 A;  5C2V B;  4CZV A;  5M5R A;  2H9N A;  3VI3 A;  2OK4 A;  4CI8 A;  5CXC A;  4X3E A;  4RE6 A;  3DM0 A;  3EI4 A;  5CXB A;  5JWZ A;  4WK4 A;  3V7D B;  5H1M A;  5I5I A;  3JB9 L;  4A2L A;  3F3G A;  3UVO A;  2GC7 A;  3DXM C;  3DWL C;  2BKL A;  3OKT A;  3J80 g;  4BCB A;  3PVU B;  2VDK A;  2VDL A;  4E5Z B;  3OW8 A;  3PXT D;  3V4V A;  2QZP A;  4FB1 D;  4RE5 A;  3IIY A;  1GOG A;  1VE7 A;  5AMS A;  5IGO A;  2H3X A;  2YB8 B;  1L0Q A;  2XU7 A;  3IIW A;  4J0X A;  2VDQ A;  3I8E A;  2HU5 A;  4PSX B;  4CZX A;  4JT6 C;  4XYI A;  1M1X A;  4Z7N A;  4H5I A;  4UM9 A;  2GNQ A;  1JTD B;  4NBM A;  1H2X A;  2JKX A;  4R7A B;  4TZ4 A;  4JD2 C;  3ZDY A;  3K71 A;  4Z7Q A;  1OLZ A;  2YMU A;  3RRM C;  4WK0 A;  5CXC B;  2PBI B;  2AGY A;  3EMH A;  3EQ7 A;  3EI4 B;  4MMX A;  5CXB B;  2PM7 B;  3HFQ A;  2OVQ B;  3VI4 A;  3EQ8 A;  5C92 A;  4JHN A;  5K1C C;  4O9D A;  2CO0 A;  3RLM D;  4OWR A;  3K26 A;  4QQE A;  1GOH A;  4GM3 A;  4AMY A;  3MZL A;  4ERZ A;  2YNP A;  4JXM A;  2XYI A;  3C9C A;  1PGU A;  3NIF A;  5H14 A;  2QC5 A;  2Z2N A;  1ERJ A;  4GGD A;  4CI1 A;  3MKQ A;  3UKU C;  3N0D A;  1O6F A;  1UOO A;  1N6F A;  2H13 A;  3I7K A;  1SHY B;  2J56 H;  4LGN A;  2YNN A;  3FCS A;  3OKY A;  2I3S A;  3K27 A;  2P9P C;  5GXH A;  1VYH C;  3SXT D;  1C9I A;  3F3F A;  1U2V C;  1VE6 A;  4KFM B;  5HE1 B;  3UVL A;  3SBR A;  1E8M A;  4ZOZ A;  3MUO A;  3KCI A;  3VA6 A;  1FWX A;  3CIK B;  4PXW A;  4X60 B;  5TDH B;  4PBY A;  1MG3 A;  3EI1 A;  3QHY B;  4O02 A;  3T3P A;  3IJ0 A;  3AL8 A;  2H47 A;  3GRE A;  4ESG A;  3SN6 B;  1QFM A;  4QL1 A;  3I7P A;  2YBA A;  5FKS A;  2GC4 A;  2Q7Q A;  5M5S A;  2HYE A;  3I7O A;  4K3J B;  1R5M A;  4K3I D;  3OTT A;  1XHM A;  3OKY B;  2HU7 A;  5FKR A;  4CC9 A;  4QAM A;  3IVM A;  2PM9 A;  4BCD A;  4O45 A;  1RI6 A;  1UTC A;  2P9L C;  3I7L A;  5HYN B;  5EAM A;  5TF2 A;  2CNX A;  3NVN A;  4GZ8 A;  4FAV D;  3ZDX A;  2EIE A;  4ERQ A;  3UVM A;  4AN0 A;  3DDU A;  4BP9 A;  3T3M A;  4PNK B;  5GMK n;  3OKW A;  3EI1 B;  3JAM g;  1UOP A;  4GGA A;  3EWE A;  1B9Y A;  4PBZ A;  3AL8 B;  2VDN A;  1NEX B;  4J87 A;  4BL0 A;  1K32 A;  2VC2 A;  4FA5 D;  2P9S C;  3NVQ A;  4GGC A;  3ZE1 A;  2OJY A;  5FLX g;  4A0B A;  5M61 A;  1K3I A;  3B7F A;  5EAR A;  1XKS A;  4XYH A;  3CFV A;  2B5M A;  3PXW D;  3UR4 A;  5AJA A;  3C75 H;  4J8G A;  5C86 A;  2PM9 B;  4O3T B;  1JV2 A;  4BH6 A;  3MKS B;  3PXS D;  4CY3 A;  4ZOX A;  3SVW D;  3KRX B;  3FCU A;  1T2X A;  4J79 A;  2HXC A;  3C99 A;  4GMB A;  1JMZ B;  4ZOY A;  5M5U A;  1XIP A;  2HJB A;  3DXK C;  4J78 A;  4PSW B;  2Z2P A;  3O4I A;  5E6U A;  4J77 A;  4O2W A;  4NSX A;  2IWF A;  2AH1 A;  3C5M A;  4L1M A;  3FGB A;  4L3H D;  5EMM B;  1H2W A;  2I3T A;  2XL3 A;  4IA9 A;  3W15 A;  3SFZ A;  2HJ4 A;  1QFS A;  4A2M A;  2IWK A;  5FFO A;  3DSM A;  4O1Q D;  3UVK A;  2UZX B;  1TYE A;  4FWW A;  1MG2 A;  3JZG A;  2AQ5 A;  3EU7 A;  4A0B B;  2IUQ A;  2Z2O A;  4J0W A;  5FKT A;  3O4G A;  2YNO A;  3AL9 A;  1A0R B;  4NAA A;  4OZU A;  4PC0 A;  4NEN A;  2HU8 A;  2H9L A;  3RFH A;  3I89 A;  4H5J A;  1NR0 A;  5HDB A;  4D6V A;  1GOT B;  2I0T A;  2IUP A;  1YR2 A;  4NC4 A;  1SQJ A;  4JSV C;  4N14 A;  4DNU A;  1A12 A;  3RMZ D;  5TEE A;  3PVW B;  1QNI A;  4E54 A;  3PSC B;  4O3U B;  3V5W B;  4GM9 A;  3GC3 B;  3VGZ A;  2XE4 A;  5IJ7 E;  1GXR A;  5HE3 B;  1P22 A; 
#chains in the Genus database with same CATH homology
 4XEI C;  3L4M D;  3E0C A;  2P9U C;  4U1E I;  2PM6 B;  4J84 A;  2B5N A;  5A2Q g;  4CZY A;  3ORV D;  3N0E A;  2BCJ B;  3SBP A;  3P4F A;  3OL2 A;  3IJ1 A;  5I5M A;  3A0F A;  1OMW B;  5KDO B;  4IMM A;  3AFC A;  3ODT A;  2G9A A;  3SLE D;  4G56 B;  4U7A A;  4LG8 A;  2P9N C;  2HES X;  5EAP A;  2IUV A;  3SHF A;  5FQD A;  4I79 A;  2H68 A;  4E54 B;  4L3G D;  4L9O A;  3RSE C;  2H6Q A;  3SMR A;  5AFU 3;  4FA4 D;  2EBS A;  2HKM A;  3IJC A;  4A09 B;  3KRW B;  3FM0 A;  3MMY A;  2HKR A;  2B4E A;  5IJ8 E;  2P9I C;  2I0R A;  1N6E A;  2H14 A;  4JSN C;  4YVD A;  5EMJ B;  4A11 A;  3U4Y A;  1U4C A;  5IT9 g;  3OL2 B;  3SJL D;  3RFG A;  1TBG A;  2AGW A;  1MDA H;  2OVP B;  1PEV A;  2H6N A;  5FA5 B;  3SWS D;  2OK6 A;  2UZY B;  4GQB B;  3RN0 D;  3I7N A;  5EAL A;  3MZK A;  5C9Z B;  3SBQ A;  4J8B A;  2IUR A;  3SCY A;  3NVX A;  5IGQ A;  2CN3 A;  4X63 B;  1TYQ C;  5HQG A;  2IAA A;  4CI3 A;  1JOF A;  5GXI A;  4FA1 D;  2XL2 A;  4QT8 A;  1PBY B;  3CFS B;  2CO0 C;  4JSX C;  3AH8 B;  4A11 B;  4ERY A;  3EG6 A;  4D0K A;  4QRJ A;  4A08 A;  2CN2 A;  2W18 A;  4AOW A;  2B5L A;  1Q47 A;  3FRX A;  1GP2 B;  5EML B;  3MXX A;  2AGX A;  4X61 B;  3JRO A;  3I2N A;  1GG2 B;  2G99 A;  1JJU B;  4GQ1 A;  4J81 A;  5B4W A;  2AH0 A;  5SXM A;  4LG9 A;  5IC7 A;  5EM2 A;  3JRP A;  4MK0 B;  4ZOV A;  2O9K A;  3PE7 A;  3IKO A;  3V9F A;  2I0S A;  3EI3 A;  4FA9 D;  1PI6 A;  2OIZ A;  4J82 A;  3F3P A;  2P9K C;  4A08 B;  1K8K C;  5CYK A;  4A09 A;  5THA A;  2OVR B;  1SQ9 A;  4GM8 A;  3J81 g;  4JT5 C;  2TRC B;  1S4U X;  5K19 A;  1YFQ A;  2CE8 A;  2AGL A;  4A0A A;  3I8C A;  2J57 G;  3GFC A;  5HE0 B;  5EM2 B;  1B9X A;  3PSL A;  1JMX B;  4CY5 A;  3EI2 A;  4EWR A;  4FHL A;  3JZH A;  5C2W B;  2H9P A;  4GQ2 P;  4ES0 A;  3L4O D;  3EI3 B;  2BBK H;  4AEZ A;  1N6D A;  4CY2 A;  2H9M A;  4Y7R A;  3VH0 A;  4J73 A;  4Y5R D;  4Z8L A;  4HDJ A;  5CYK B;  3BG0 A;  3I7H A;  3ULE C;  4CY1 A;  4BUJ C;  3RN1 D;  2H6K A;  5I5J A;  4CI2 A;  3BG1 A;  3UKR C;  4ZN4 A;  2CE9 A;  4J86 A;  5FKQ A;  5HE2 B;  5H17 A;  4E5Z A;  4L1Q D;  4UI9 R;  3UVN A;  2AGZ A;  3JZN A;  4A0A B;  5FXY A;  2MTA H;  5GSA A;  5TEF A;  2J55 H;  3JPX A;  4A7J A;  4FAN D;  3BWS A;  3EI2 B;  2QXV A;  4JSP C;  3ZWL B;  5EMK B;  5C2V B;  4CZV A;  2H9N A;  2OK4 A;  4CI8 A;  5CXC A;  4X3E A;  3DM0 A;  3EI4 A;  5CXB A;  5JWZ A;  3V7D B;  5H1M A;  5I5I A;  3JB9 L;  4A2L A;  3F3G A;  3UVO A;  2GC7 A;  3DXM C;  3DWL C;  3OKT A;  3J80 g;  3PVU B;  4E5Z B;  3OW8 A;  3PXT D;  4FB1 D;  3IIY A;  5AMS A;  5IGO A;  2H3X A;  2YB8 B;  1L0Q A;  2XU7 A;  3IIW A;  4J0X A;  3I8E A;  4PSX B;  4CZX A;  4JT6 C;  4XYI A;  4H5I A;  2GNQ A;  4R7A B;  4TZ4 A;  4JD2 C;  1OLZ A;  2YMU A;  3RRM C;  5CXC B;  2PBI B;  2AGY A;  3EMH A;  3EI4 B;  5CXB B;  2PM7 B;  3HFQ A;  2OVQ B;  5K1C C;  4O9D A;  2CO0 A;  3RLM D;  4OWR A;  3K26 A;  4QQE A;  4GM3 A;  3MZL A;  4ERZ A;  2YNP A;  4JXM A;  2XYI A;  3C9C A;  1PGU A;  5H14 A;  2QC5 A;  2Z2N A;  1ERJ A;  4GGD A;  4CI1 A;  3MKQ A;  3UKU C;  3N0D A;  1N6F A;  2H13 A;  3I7K A;  1SHY B;  2J56 H;  4LGN A;  2YNN A;  3OKY A;  2I3S A;  3K27 A;  2P9P C;  5GXH A;  1VYH C;  3SXT D;  3F3F A;  1U2V C;  4KFM B;  5HE1 B;  3UVL A;  3SBR A;  4ZOZ A;  3VA6 A;  1FWX A;  3CIK B;  4PXW A;  4X60 B;  5TDH B;  4PBY A;  1MG3 A;  3EI1 A;  3IJ0 A;  3AL8 A;  2H47 A;  3GRE A;  4ESG A;  3SN6 B;  4QL1 A;  3I7P A;  2YBA A;  5FKS A;  2GC4 A;  2Q7Q A;  2HYE A;  3I7O A;  4K3J B;  1R5M A;  4K3I D;  3OTT A;  1XHM A;  3OKY B;  4CC9 A;  5FKR A;  2PM9 A;  4O45 A;  1RI6 A;  2P9L C;  3I7L A;  5HYN B;  5EAM A;  5TF2 A;  2CNX A;  3NVN A;  4GZ8 A;  4FAV D;  4ERQ A;  3UVM A;  4PNK B;  5GMK n;  3OKW A;  3EI1 B;  3JAM g;  4GGA A;  3EWE A;  1B9Y A;  4PBZ A;  3AL8 B;  1NEX B;  4J87 A;  4BL0 A;  1K32 A;  4FA5 D;  2P9S C;  3NVQ A;  4GGC A;  2OJY A;  5FLX g;  4A0B A;  3B7F A;  5EAR A;  1XKS A;  4XYH A;  3CFV A;  2B5M A;  3PXW D;  3UR4 A;  5AJA A;  3C75 H;  4J8G A;  2PM9 B;  4O3T B;  4BH6 A;  3MKS B;  3PXS D;  4CY3 A;  4ZOX A;  3SVW D;  3KRX B;  4J79 A;  2HXC A;  3C99 A;  4GMB A;  1JMZ B;  4ZOY A;  1XIP A;  2HJB A;  3DXK C;  4J78 A;  4PSW B;  2Z2P A;  4J77 A;  4NSX A;  2IWF A;  2AH1 A;  3C5M A;  3FGB A;  4L3H D;  5EMM B;  4IA9 A;  2I3T A;  2XL3 A;  3W15 A;  3SFZ A;  2HJ4 A;  4A2M A;  2IWK A;  3DSM A;  4O1Q D;  3UVK A;  2UZX B;  4FWW A;  1MG2 A;  3JZG A;  2AQ5 A;  3EU7 A;  4A0B B;  2IUQ A;  2Z2O A;  4J0W A;  5FKT A;  4OZU A;  2YNO A;  3AL9 A;  1A0R B;  4PC0 A;  2H9L A;  3RFH A;  3I89 A;  4H5J A;  1NR0 A;  4D6V A;  1GOT B;  2I0T A;  2IUP A;  1SQJ A;  4JSV C;  4N14 A;  3RMZ D;  5TEE A;  3PVW B;  1QNI A;  4E54 A;  3PSC B;  4O3U B;  3V5W B;  4GM9 A;  3VGZ A;  5IJ7 E;  1GXR A;  5HE3 B;  1P22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...