4GM9A

Crystal structure of human wd repeat domain 5 with compound mm-401
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
309
Chain Sequence
TQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human WD repeat domain 5 with compound MM-401
rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords WD repeat-containing protein 5
total genus 99
structure length 309
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gm9A00
4E5ZA 4J73A 5TEFA 1U4CA 5TDHB 5EAPA 5KDOB 3SVWD 4J86A 5I5IA 3SHFA 4E54A 4FWWA 3I7LA 5HQGA 4Z8LA 3VH0A 3U4YA 4GGCA 3I8CA 4OZUA 5EMJB 4ZOXA 2CN2A 4CY3A 4LG8A 3K27A 5C2WB 4GM3A 3DXMC 2XYIA 4JT6C 3EI2A 2AH0A 2GNQA 4ESGA 4J84A 1ERJA 2BCJB 4A08B 1XHMA 3SFZA 4ERQA 2CE8A 2PM6B 4CZXA 2GC7A 2OIZA 3SBRA 5C2VB 1S4UX 5THAA 3OKTA 3CFSB 1SHYB 2H9PA 2AGZA 1N6FA 5EM2A 3MZLA 3EWEA 5AJAA 3UVNA 4J81A 3PVUB 1N6DA 1K32A 3AH8B 3AFCA 3MKQA 4J77A 5H14A 2IURA 4J8GA 2I3TA 4R7AB 2P9PC 4PNKB 4O45A 4XYIA 2PBIB 3EI1B 2YNPA 2OVQB 4BUJC 4AEZA 4J0XA 4O3UB 3OKWA 2AQ5A 3C75H 2W18A 1FWXA 4LG9A 2IUPA 1VYHC 4CZVA 4D0KA 1OMWB 2UZYB 5IC7A 5EMMB 2CO0C 3IJ1A 5JWZA 3AL8A 4OWRA 1GG2B 4XYHA 3PE7A 3B7FA 1JMZB 3UVOA 2PM7B 1RI6A 3N0DA 3BWSA 4NSXA 4EWRA 5FLXg 2HXCA 3I7KA 3IIWA 3A0FA 4J78A 2OK6A 3RN1D 5CXCB 2B5MA 4CC9A 5GMKn 4A7JA 4L9OA 3UVKA 4CI2A 3VGZA 3OKYA 3AL9A 4X61B 2HKMA 4FHLA 4U1EI 3UVLA 2BBKH 4JT5C 2CN3A 5CYKA 3ULEC 3AL8B 1PEVA 2G99A 5EM2B 3KRXB 5SXMA 5CXBB 3VA6A 3FM0A 5IGOA 3RFHA 4GQ2P 3ODTA 2HYEA 3UR4A 5EALA 5B4WA 2H3XA 2B5NA 3C9CA 4PBYA 4J0WA 1Q47A 4JSPC 5H17A 4A08A 3BG0A 3L4OD 3OKYB 2AGLA 4FAVD 4PXWA 3PSLA 4GM8A 5AMSA 4ZOYA 5HE3B 1YFQA 2QC5A 2I0TA 2G9AA 3FGBA 4E54B 4XEIC 2XL3A 4K3JB 4QRJA 4A0AA 1B9XA 3SCYA 2GC4A 4GM9A 3EI4A 4A11A 1K8KC 4CI1A 2OK4A 3KRWB 3OL2A 4FA5D 4JSXC 3EG6A 2EBSA 3MMYA 4GQBB 3IIYA 3GREA 1JOFA 1GXRA 1TYQC 4QQEA 4E5ZB 4Y7RA 1TBGA 2J56H 1JMXB 4X3EA 4J82A 2J57G 3JZGA 2PM9A 5FXYA 4FA9D 4GGDA 4D6VA 4Y5RD 1MG3A 3V5WB 4O3TB 5C9ZB 2IWFA 3I2NA 5IJ7E 3ORVD 4PSXB 2CO0A 2YMUA 4CY1A 4ES0A 5K1CC 2XL2A 4FA4D 4CY5A 5A2Qg 3JZHA 4H5JA 2B5LA 4H5IA 3PXSD 4ZOZA 2TRCB 3DM0A 4I79A 5I5MA 3SBQA 5FKSA 3NVXA 2HKRA 4PSWB 4J87A 2IUVA 3ZWLB 3V7DB 2AGYA 1XIPA 4AOWA 3BG1A 1NR0A 4A2MA 1QNIA 3DSMA 3JZNA 3OW8A 2IWKA 2OJYA 3SXTD 2AH1A 2O9KA 3PXWD 1GOTB 3IJ0A 2QXVA 3IKOA 2YBAA 4CY2A 4O9DA 2H6QA 2HESX 3RN0D 3JB9L 3OL2B 3CFVA 5HE0B 1R5MA 2HJ4A 5GXHA 5EMLB 1SQJA 3JRPA 3J80g 2J55H 3P4FA 1JJUB 2HJBA 5TEEA 3JPXA 2H9NA 5TF2A 3UVMA 4FAND 5IT9g 2XU7A 4JSNC 4PC0A 3I8EA 3FRXA 3JROA 4IA9A 5GXIA 3W15A 2P9IC 3EU7A 3SLED 3SN6B 2IUQA 3EI2B 4J8BA 5FKQA 4ERYA 5EMKB 4A0BA 5FKTA 2H9LA 4QT8A 5HE1B 1XKSA 3UKRC 3I7PA 4A09A 2MTAH 2P9UC 3I89A 4HDJA 2PM9B 3OTTA 4IMMA 3J81g 3NVNA 4JSVC 2H6KA 4L3GD 1B9YA 4CI8A 4FB1D 3EMHA 3I7HA 4TZ4A 4L1QD 5K19A 5FKRA 1GP2B 1P22A 4X63B 2I3SA 5GSAA 4L3HD 2YB8B 3I7OA 5HYNB 2Z2NA 3UKUC 3SMRA 4UI9R 5EAMA 3I7NA 4A11B 2H6NA 3NVQA 3EI1A 3F3FA 2AGXA 2H14A 4G56B 2P9LC 4GZ8A 5CXCA 4YVDA 4J79A 1MG2A 3EI3A 5FQDA 4PBZA 4BH6A 1A0RB 4BL0A 2Z2PA 3F3PA 2I0SA 4ERZA 2AGWA 4GGAA 3MKSB 3SJLD 2H13A 4CZYA 4KFMB 3PXTD 3L4MD 3N0EA 3IJCA 3V9FA 4N14A 5CYKB 5IGQA 2UZXB 3E0CA 2I0RA 2IAAA 4GMBA 4ZOVA 3EI4B 4JXMA 2H9MA 2CNXA 4GQ1A 4O1QD 2P9KC 1OLZA 3CIKB 3F3GA 3SBPA 4CI3A 3SWSD 1U2VC 4MK0B 3PVWB 3MXXA 3PSCB 1NEXB 1PI6A 4A09B 3DXKC 3EI3B 5IJ8E 2Z2OA 2OVRB 2CE9A 3RRMC 2OVPB 1PBYB 2P9NC 2YNNA 4U7AA 4ZN4A 5H1MA 2H47A 2B4EA 3DWLC 1N6EA 3RLMD 3RFGA 4LGNA 4K3ID 3RMZD 1MDAH 3C99A 5AFU3 4FA1D 1L0QA 2Q7QA 1PGUA 3GFCA 2H68A 3K26A 5CXBA 5HE2B 4A2LA 4A0AB 5EARA 3RSEC 5FA5B 1SQ9A 2P9SC 3C5MA 3MZKA 3HFQA 4QL1A 4A0BB 4JD2C 2YNOA 5I5JA 4X60B 3JAMg
chains in the Genus database with same CATH superfamily
1E5TA 4E5ZA 4J73A 4AX4A 5TEFA 5M5SA 1U4CA 5TDHB 3V4VA 5EAPA 3IJEA 3IURA 5KDOB 3SVWD 4J86A 5I5IA 3SHFA 4E54A 5FFOA 4FWWA 3I7LA 5HQGA 4Z8LA 3VH0A 4NAAA 3U4YA 4GGCA 2XDWA 3I8CA 4OZUA 5EMJB 4ZOXA 2CN2A 4CY3A 4LG8A 3K27A 5C2WB 4GM3A 3DXMC 2XYIA 4JT6C 3EI2A 1UOOA 3ZDYA 2AH0A 2GNQA 4ESGA 4J84A 1L5GA 1ERJA 2BCJB 4A08B 1XHMA 3SFZA 4ERQA 3IUNA 2CE8A 2PM6B 4CZXA 2GC7A 2OIZA 3SBRA 5C2VB 1S4UX 4MMXA 5THAA 3OKTA 3CFSB 1SHYB 2H9PA 2AGZA 1N6FA 5EM2A 2BKLA 3MZLA 3EWEA 5AJAA 3UVNA 4J81A 3PVUB 1N6DA 1K32A 3AH8B 3AFCA 3MKQA 4G1EA 4J77A 5H14A 1E8MA 2IURA 2I3TA 4J8GA 1QFSA 4O2WA 4R7AB 2P9PC 4PNKB 4O45A 1UOQA 4XYIA 2PBIB 3EI1B 2YNPA 3ZE2A 2OVQB 4BUJC 4DNWA 4AEZA 4J0XA 4AN0A 4O3UB 3OKWA 2AQ5A 2HU8A 3C75H 2W18A 1FWXA 4LG9A 5M5UA 1UOPA 2IUPA 3T3PA 1VYHC 4CZVA 4D0KA 1OMWB 2UZYB 1O6FA 5IC7A 5EMMB 4WK4A 2VZ3A 2VZ1A 2CO0C 3IJ1A 5JWZA 3AL8A 4OWRA 1GG2B 4XYHA 3PE7A 3B7FA 1JMZB 3UVOA 2PM7B 1RI6A 4BCCA 3N0DA 3BWSA 5M5RA 4NSXA 4QAMA 4EWRA 5FLXg 2HXCA 3IULA 3I7KA 3IIWA 3A0FA 4J78A 2OK6A 3RN1D 5CXCB 2B5MA 4CC9A 1JTDB 3MUOA 4A7JA 5GMKn 4L9OA 3UVKA 4CI2A 3VGZA 3OKYA 3AL9A 4WK0A 4X61B 2HKMA 4FHLA 4U1EI 3UVLA 2BBKH 4JT5C 2EIBA 2CN3A 5CYKA 3ULEC 3AL8B 1PEVA 2G99A 5EM2B 3VI3A 3KRXB 4WK2A 5SXMA 5CXBB 4BCDA 4NBMA 3VA6A 3FM0A 5IGOA 3RFHA 1UTCA 4GQ2P 3ODTA 2HYEA 3UR4A 3GC3B 5EALA 4NENA 5B4WA 4L1MA 3V4PA 2H3XA 3NIDA 2B5NA 3C9CA 4NC4A 4J0WA 4PBYA 4DNUA 1Q47A 4JSPC 5H17A 4A08A 3BG0A 3L4OD 3OKYB 2AGLA 4DNVA 4FAVD 4PXWA 3PSLA 4GM8A 5AMSA 4ZOYA 5HE3B 1YFQA 2QC5A 2I0TA 3EQ7A 2G9AA 3FGBA 4E54B 4XEIC 2XL3A 4K3JB 4G1MA 3KCIA 4QRJA 4A0AA 1B9XA 3SCYA 2GC4A 4GM9A 3EI4A 4A11A 1K8KC 1TYEA 4D9SA 4CI1A 2OK4A 3KRWB 4Z7QA 3OL2A 4FA5D 4JSXC 3EG6A 2EBSA 3MMYA 4GQBB 3IIYA 2VDLA 3GREA 4RE6A 3ZDXA 1JOFA 1GXRA 1TYQC 4QQEA 5FFGA 4E5ZB 4Y7RA 1TBGA 2J56H 4JHPC 1JMXB 4X3EA 4J82A 2J57G 2WQ8A 3JZGA 2PM9A 5FXYA 4RE5A 4FA9D 4GGDA 4D6VA 4Y5RD 1MG3A 3V5WB 4O3TB 5C9ZB 2IWFA 3I2NA 2VDPA 3O4HA 2VDKA 5IJ7E 3ORVD 4PSXB 2CO0A 2YMUA 3ZE0A 4CY1A 4ES0A 3MUNA 3O4GA 2XL2A 5K1CC 3T3MA 4FA4D 4CY5A 5A2Qg 2VDNA 3JZHA 4H5JA 2B5LA 4H5IA 3PXSD 4ZOZA 3VI4A 2TRCB 3DM0A 4AN1A 2VDRA 4I79A 3QI0A 4AMYA 1H2ZA 5I5MA 3SBQA 5FKSA 3NIFA 3EQ8A 2JKXA 3NVXA 2HKRA 4PSWB 3GD1I 4J87A 2IUVA 1H2YA 3ZWLB 3IVMA 4BP9A 3V7DB 2AGYA 3IUMA 1XIPA 4AOWA 3BG1A 1NR0A 4A2MA 1O6GA 3QHYB 1QNIA 3DSMA 3EQ9A 3JZNA 3OW8A 2IWKA 4JHNA 2OJYA 3SXTD 2AH1A 2HU7A 2O9KA 3PXWD 1GOTB 3IJ0A 2QXVA 3IKOA 2YBAA 4CY2A 1C9LA 2QZPA 4O9DA 2H6QA 2HESX 3RN0D 3JB9L 3OL2B 3CFVA 3DDUA 5M5TA 5HE0B 1R5MA 2HJ4A 5GXHA 1JV2A 5EMLB 1SQJA 3IUQA 3JRPA 1H2WA 3J80g 4O02A 1H2XA 2J55H 3P4FA 1U8CA 1JJUB 2XZGA 1YR2A 1VZ2A 2HJBA 5E6RA 5TEEA 2XE4A 3JPXA 2H9NA 5TF2A 3UVMA 1I2MB 4FAND 5IT9g 2XU7A 5M61A 4JSNC 4PC0A 3I8EA 3FRXA 3JROA 4IA9A 5GXIA 3W15A 2VDQA 2P9IC 3EU7A 1K3IA 3SLED 3SN6B 2IUQA 3EI2B 4J8BA 5FKQA 4ERYA 4Z7NA 5EMKB 2VDOA 4A0BA 5FKTA 4MMZA 3ZE1A 2H9LA 4QT8A 5HE1B 1XKSA 3UKRC 3I7PA 4A09A 2MTAH 2P9UC 3I89A 3ZDZA 3O4JA 4BCBA 4HDJA 2PM9B 3OTTA 4IMMA 3J81g 3NVNA 4JSVC 2H6KA 4L3GD 2VC2A 1B9YA 1VZ3A 4CI8A 4FB1D 3FCUA 3EMHA 3I7HA 2HU5A 2EIDA 4TZ4A 4L1QD 5K19A 5FKRA 1E8NA 1GP2B 1P22A 4X63B 2I3SA 5GSAA 4L3HD 2YB8B 3I7OA 5HYNB 5E6SA 2Z2NA 1VE6A 3UKUC 3SMRA 4UI9R 5E6UA 5EAMA 5HDBA 3I7NA 4A11B 1M1XA 2H6NA 1GOGA 2VDMA 3NVQA 3EI1A 3F3FA 1QFMA 2AGXA 2H14A 4G56B 2P9LC 3FCSA 4G55A 4GZ8A 5CXCA 4YVDA 4J79A 1MG2A 3EI3A 5FQDA 4PBZA 4BH6A 1A0RB 1A12A 4BL0A 2Z2PA 3F3PA 2EIEA 2I0SA 4ERZA 2AGWA 4GGAA 3K6SA 3MKSB 4IRZA 3SJLD 2H13A 4CZYA 4KFMB 3PXTD 3L4MD 3N0EA 3IJCA 4UM8A 4N14A 3V9FA 5CYKB 5IGQA 2UZXB 3E0CA 1GOFA 2I0RA 2EICA 2IAAA 4GMBA 4ZOVA 3EI4B 4JXMA 2H9MA 1VE7A 2CNXA 5C92A 4GQ1A 4O1QD 2P9KC 1OLZA 3OF7A 3CIKB 3F3GA 3SBPA 4CI3A 3SWSD 1U2VC 1BPOA 4MK0B 3PVWB 2QR5A 3IUJA 4WJKA 3MXXA 3K72A 4BP8A 3PSCB 1NEXB 1PI6A 4A09B 3DXKC 3EI3B 5IJ8E 2Z2OA 3O4IA 2OVRB 2CE9A 3RRMC 2OVPB 1PBYB 2P9NC 2YNNA 4U7AA 4ZN4A 5H1MA 2H47A 2B4EA 5C86A 3DWLC 1N6EA 3RLMD 3RFGA 4K3ID 4LGNA 3RMZD 1MDAH 3C99A 3K71A 5AFU3 4FA1D 1L0QA 2Q7QA 1PGUA 3GFCA 2H68A 3K26A 3NIGA 5M5VA 5CXBA 5HE2B 4A2LA 4A0AB 4Z7OA 4UM9A 5EARA 3RSEC 5FA5B 1SQ9A 2P9SC 3C5MA 3MZKA 1C9IA 1GOHA 4MMYA 3HFQA 4AMZA 4QL1A 4A0BB 1T2XA 4JD2C 2YNOA 5I5JA 4X60B 3JAMg 3MVDK
chains in the Genus database with same CATH topology
4E5ZA 4J73A 5TEFA 1U4CA 5TDHB 5EAPA 5KDOB 3SVWD 4J86A 5I5IA 3SHFA 4E54A 4FWWA 3I7LA 5HQGA 4Z8LA 3VH0A 3U4YA 4GGCA 3I8CA 4OZUA 5EMJB 4ZOXA 2CN2A 4CY3A 4LG8A 3K27A 5C2WB 4GM3A 3DXMC 2XYIA 4JT6C 3EI2A 2AH0A 2GNQA 4ESGA 4J84A 1ERJA 2BCJB 4A08B 1XHMA 3SFZA 4ERQA 2CE8A 2PM6B 4CZXA 2GC7A 2OIZA 3SBRA 5C2VB 1S4UX 5THAA 3OKTA 3CFSB 1SHYB 2H9PA 2AGZA 1N6FA 5EM2A 3MZLA 3EWEA 5AJAA 3UVNA 4J81A 3PVUB 1N6DA 1K32A 3AH8B 3AFCA 3MKQA 4J77A 5H14A 2IURA 4J8GA 2I3TA 4R7AB 2P9PC 4PNKB 4O45A 4XYIA 2PBIB 3EI1B 2YNPA 2OVQB 4BUJC 4AEZA 4J0XA 4O3UB 3OKWA 2AQ5A 3C75H 2W18A 1FWXA 4LG9A 2IUPA 1VYHC 4CZVA 4D0KA 1OMWB 2UZYB 5IC7A 5EMMB 2CO0C 3IJ1A 5JWZA 3AL8A 4OWRA 1GG2B 4XYHA 3PE7A 3B7FA 1JMZB 3UVOA 2PM7B 1RI6A 3N0DA 3BWSA 4NSXA 4EWRA 5FLXg 2HXCA 3I7KA 3IIWA 3A0FA 4J78A 2OK6A 3RN1D 5CXCB 2B5MA 4CC9A 5GMKn 4A7JA 4L9OA 3UVKA 4CI2A 3VGZA 3OKYA 3AL9A 4X61B 2HKMA 4FHLA 4U1EI 3UVLA 2BBKH 4JT5C 2CN3A 5CYKA 3ULEC 3AL8B 1PEVA 2G99A 5EM2B 3KRXB 5SXMA 5CXBB 3VA6A 3FM0A 5IGOA 3RFHA 4GQ2P 3ODTA 2HYEA 3UR4A 5EALA 5B4WA 2H3XA 2B5NA 3C9CA 4PBYA 4J0WA 1Q47A 4JSPC 5H17A 4A08A 3BG0A 3L4OD 3OKYB 2AGLA 4FAVD 4PXWA 3PSLA 4GM8A 5AMSA 4ZOYA 5HE3B 1YFQA 2QC5A 2I0TA 2G9AA 3FGBA 4E54B 4XEIC 2XL3A 4K3JB 4QRJA 4A0AA 1B9XA 3SCYA 2GC4A 4GM9A 3EI4A 4A11A 1K8KC 4CI1A 2OK4A 3KRWB 3OL2A 4FA5D 4JSXC 3EG6A 2EBSA 3MMYA 4GQBB 3IIYA 3GREA 1JOFA 1GXRA 1TYQC 4QQEA 4E5ZB 4Y7RA 1TBGA 2J56H 1JMXB 4X3EA 4J82A 2J57G 3JZGA 2PM9A 5FXYA 4FA9D 4GGDA 4D6VA 4Y5RD 1MG3A 3V5WB 4O3TB 5C9ZB 2IWFA 3I2NA 5IJ7E 3ORVD 4PSXB 2CO0A 2YMUA 4CY1A 4ES0A 5K1CC 2XL2A 4FA4D 4CY5A 5A2Qg 3JZHA 4H5JA 2B5LA 4H5IA 3PXSD 4ZOZA 2TRCB 3DM0A 4I79A 5I5MA 3SBQA 5FKSA 3NVXA 2HKRA 4PSWB 4J87A 2IUVA 3ZWLB 3V7DB 2AGYA 1XIPA 4AOWA 3BG1A 1NR0A 4A2MA 1QNIA 3DSMA 3JZNA 3OW8A 2IWKA 2OJYA 3SXTD 2AH1A 2O9KA 3PXWD 1GOTB 3IJ0A 2QXVA 3IKOA 2YBAA 4CY2A 4O9DA 2H6QA 2HESX 3RN0D 3JB9L 3OL2B 3CFVA 5HE0B 1R5MA 2HJ4A 5GXHA 5EMLB 1SQJA 3JRPA 3J80g 2J55H 3P4FA 1JJUB 2HJBA 5TEEA 3JPXA 2H9NA 5TF2A 3UVMA 4FAND 5IT9g 2XU7A 4JSNC 4PC0A 3I8EA 3FRXA 3JROA 4IA9A 5GXIA 3W15A 2P9IC 3EU7A 3SLED 3SN6B 2IUQA 3EI2B 4J8BA 5FKQA 4ERYA 5EMKB 4A0BA 5FKTA 2H9LA 4QT8A 5HE1B 1XKSA 3UKRC 3I7PA 4A09A 2MTAH 2P9UC 3I89A 4HDJA 2PM9B 3OTTA 4IMMA 3J81g 3NVNA 4JSVC 2H6KA 4L3GD 1B9YA 4CI8A 4FB1D 3EMHA 3I7HA 4TZ4A 4L1QD 5K19A 5FKRA 1GP2B 1P22A 4X63B 2I3SA 5GSAA 4L3HD 2YB8B 3I7OA 5HYNB 2Z2NA 3UKUC 3SMRA 4UI9R 5EAMA 3I7NA 4A11B 2H6NA 3NVQA 3EI1A 3F3FA 2AGXA 2H14A 4G56B 2P9LC 4GZ8A 5CXCA 4YVDA 4J79A 1MG2A 3EI3A 5FQDA 4PBZA 4BH6A 1A0RB 4BL0A 2Z2PA 3F3PA 2I0SA 4ERZA 2AGWA 4GGAA 3MKSB 3SJLD 2H13A 4CZYA 4KFMB 3PXTD 3L4MD 3N0EA 3IJCA 3V9FA 4N14A 5CYKB 5IGQA 2UZXB 3E0CA 2I0RA 2IAAA 4GMBA 4ZOVA 3EI4B 4JXMA 2H9MA 2CNXA 4GQ1A 4O1QD 2P9KC 1OLZA 3CIKB 3F3GA 3SBPA 4CI3A 3SWSD 1U2VC 4MK0B 3PVWB 3MXXA 3PSCB 1NEXB 1PI6A 4A09B 3DXKC 3EI3B 5IJ8E 2Z2OA 2OVRB 2CE9A 3RRMC 2OVPB 1PBYB 2P9NC 2YNNA 4U7AA 4ZN4A 5H1MA 2H47A 2B4EA 3DWLC 1N6EA 3RLMD 3RFGA 4LGNA 4K3ID 3RMZD 1MDAH 3C99A 5AFU3 4FA1D 1L0QA 2Q7QA 1PGUA 3GFCA 2H68A 3K26A 5CXBA 5HE2B 4A2LA 4A0AB 5EARA 3RSEC 5FA5B 1SQ9A 2P9SC 3C5MA 3MZKA 3HFQA 4QL1A 4A0BB 4JD2C 2YNOA 5I5JA 4X60B 3JAMg
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E5Z A;  4J73 A;  5TEF A;  1U4C A;  5TDH B;  5EAP A;  5KDO B;  3SVW D;  4J86 A;  5I5I A;  3SHF A;  4E54 A;  4FWW A;  3I7L A;  5HQG A;  4Z8L A;  3VH0 A;  3U4Y A;  4GGC A;  3I8C A;  4OZU A;  5EMJ B;  4ZOX A;  2CN2 A;  4CY3 A;  4LG8 A;  3K27 A;  5C2W B;  4GM3 A;  3DXM C;  2XYI A;  4JT6 C;  3EI2 A;  2AH0 A;  2GNQ A;  4ESG A;  4J84 A;  1ERJ A;  2BCJ B;  4A08 B;  1XHM A;  3SFZ A;  4ERQ A;  2CE8 A;  2PM6 B;  4CZX A;  2GC7 A;  2OIZ A;  3SBR A;  5C2V B;  1S4U X;  5THA A;  3OKT A;  3CFS B;  1SHY B;  2H9P A;  2AGZ A;  1N6F A;  5EM2 A;  3MZL A;  3EWE A;  5AJA A;  3UVN A;  4J81 A;  3PVU B;  1N6D A;  1K32 A;  3AH8 B;  3AFC A;  3MKQ A;  4J77 A;  5H14 A;  2IUR A;  4J8G A;  2I3T A;  4R7A B;  2P9P C;  4PNK B;  4O45 A;  4XYI A;  2PBI B;  3EI1 B;  2YNP A;  2OVQ B;  4BUJ C;  4AEZ A;  4J0X A;  4O3U B;  3OKW A;  2AQ5 A;  3C75 H;  2W18 A;  1FWX A;  4LG9 A;  2IUP A;  1VYH C;  4CZV A;  4D0K A;  1OMW B;  2UZY B;  5IC7 A;  5EMM B;  2CO0 C;  3IJ1 A;  5JWZ A;  3AL8 A;  4OWR A;  1GG2 B;  4XYH A;  3PE7 A;  3B7F A;  1JMZ B;  3UVO A;  2PM7 B;  1RI6 A;  3N0D A;  3BWS A;  4NSX A;  4EWR A;  5FLX g;  2HXC A;  3I7K A;  3IIW A;  3A0F A;  4J78 A;  2OK6 A;  3RN1 D;  5CXC B;  2B5M A;  4CC9 A;  5GMK n;  4A7J A;  4L9O A;  3UVK A;  4CI2 A;  3VGZ A;  3OKY A;  3AL9 A;  4X61 B;  2HKM A;  4FHL A;  4U1E I;  3UVL A;  2BBK H;  4JT5 C;  2CN3 A;  5CYK A;  3ULE C;  3AL8 B;  1PEV A;  2G99 A;  5EM2 B;  3KRX B;  5SXM A;  5CXB B;  3VA6 A;  3FM0 A;  5IGO A;  3RFH A;  4GQ2 P;  3ODT A;  2HYE A;  3UR4 A;  5EAL A;  5B4W A;  2H3X A;  2B5N A;  3C9C A;  4PBY A;  4J0W A;  1Q47 A;  4JSP C;  5H17 A;  4A08 A;  3BG0 A;  3L4O D;  3OKY B;  2AGL A;  4FAV D;  4PXW A;  3PSL A;  4GM8 A;  5AMS A;  4ZOY A;  5HE3 B;  1YFQ A;  2QC5 A;  2I0T A;  2G9A A;  3FGB A;  4E54 B;  4XEI C;  2XL3 A;  4K3J B;  4QRJ A;  4A0A A;  1B9X A;  3SCY A;  2GC4 A;  4GM9 A;  3EI4 A;  4A11 A;  1K8K C;  4CI1 A;  2OK4 A;  3KRW B;  3OL2 A;  4FA5 D;  4JSX C;  3EG6 A;  2EBS A;  3MMY A;  4GQB B;  3IIY A;  3GRE A;  1JOF A;  1GXR A;  1TYQ C;  4QQE A;  4E5Z B;  4Y7R A;  1TBG A;  2J56 H;  1JMX B;  4X3E A;  4J82 A;  2J57 G;  3JZG A;  2PM9 A;  5FXY A;  4FA9 D;  4GGD A;  4D6V A;  4Y5R D;  1MG3 A;  3V5W B;  4O3T B;  5C9Z B;  2IWF A;  3I2N A;  5IJ7 E;  3ORV D;  4PSX B;  2CO0 A;  2YMU A;  4CY1 A;  4ES0 A;  5K1C C;  2XL2 A;  4FA4 D;  4CY5 A;  5A2Q g;  3JZH A;  4H5J A;  2B5L A;  4H5I A;  3PXS D;  4ZOZ A;  2TRC B;  3DM0 A;  4I79 A;  5I5M A;  3SBQ A;  5FKS A;  3NVX A;  2HKR A;  4PSW B;  4J87 A;  2IUV A;  3ZWL B;  3V7D B;  2AGY A;  1XIP A;  4AOW A;  3BG1 A;  1NR0 A;  4A2M A;  1QNI A;  3DSM A;  3JZN A;  3OW8 A;  2IWK A;  2OJY A;  3SXT D;  2AH1 A;  2O9K A;  3PXW D;  1GOT B;  3IJ0 A;  2QXV A;  3IKO A;  2YBA A;  4CY2 A;  4O9D A;  2H6Q A;  2HES X;  3RN0 D;  3JB9 L;  3OL2 B;  3CFV A;  5HE0 B;  1R5M A;  2HJ4 A;  5GXH A;  5EML B;  1SQJ A;  3JRP A;  3J80 g;  2J55 H;  3P4F A;  1JJU B;  2HJB A;  5TEE A;  3JPX A;  2H9N A;  5TF2 A;  3UVM A;  4FAN D;  5IT9 g;  2XU7 A;  4JSN C;  4PC0 A;  3I8E A;  3FRX A;  3JRO A;  4IA9 A;  5GXI A;  3W15 A;  2P9I C;  3EU7 A;  3SLE D;  3SN6 B;  2IUQ A;  3EI2 B;  4J8B A;  5FKQ A;  4ERY A;  5EMK B;  4A0B A;  5FKT A;  2H9L A;  4QT8 A;  5HE1 B;  1XKS A;  3UKR C;  3I7P A;  4A09 A;  2MTA H;  2P9U C;  3I89 A;  4HDJ A;  2PM9 B;  3OTT A;  4IMM A;  3J81 g;  3NVN A;  4JSV C;  2H6K A;  4L3G D;  1B9Y A;  4CI8 A;  4FB1 D;  3EMH A;  3I7H A;  4TZ4 A;  4L1Q D;  5K19 A;  5FKR A;  1GP2 B;  1P22 A;  4X63 B;  2I3S A;  5GSA A;  4L3H D;  2YB8 B;  3I7O A;  5HYN B;  2Z2N A;  3UKU C;  3SMR A;  4UI9 R;  5EAM A;  3I7N A;  4A11 B;  2H6N A;  3NVQ A;  3EI1 A;  3F3F A;  2AGX A;  2H14 A;  4G56 B;  2P9L C;  4GZ8 A;  5CXC A;  4YVD A;  4J79 A;  1MG2 A;  3EI3 A;  5FQD A;  4PBZ A;  4BH6 A;  1A0R B;  4BL0 A;  2Z2P A;  3F3P A;  2I0S A;  4ERZ A;  2AGW A;  4GGA A;  3MKS B;  3SJL D;  2H13 A;  4CZY A;  4KFM B;  3PXT D;  3L4M D;  3N0E A;  3IJC A;  3V9F A;  4N14 A;  5CYK B;  5IGQ A;  2UZX B;  3E0C A;  2I0R A;  2IAA A;  4GMB A;  4ZOV A;  3EI4 B;  4JXM A;  2H9M A;  2CNX A;  4GQ1 A;  4O1Q D;  2P9K C;  1OLZ A;  3CIK B;  3F3G A;  3SBP A;  4CI3 A;  3SWS D;  1U2V C;  4MK0 B;  3PVW B;  3MXX A;  3PSC B;  1NEX B;  1PI6 A;  4A09 B;  3DXK C;  3EI3 B;  5IJ8 E;  2Z2O A;  2OVR B;  2CE9 A;  3RRM C;  2OVP B;  1PBY B;  2P9N C;  2YNN A;  4U7A A;  4ZN4 A;  5H1M A;  2H47 A;  2B4E A;  3DWL C;  1N6E A;  3RLM D;  3RFG A;  4LGN A;  4K3I D;  3RMZ D;  1MDA H;  3C99 A;  5AFU 3;  4FA1 D;  1L0Q A;  2Q7Q A;  1PGU A;  3GFC A;  2H68 A;  3K26 A;  5CXB A;  5HE2 B;  4A2L A;  4A0A B;  5EAR A;  3RSE C;  5FA5 B;  1SQ9 A;  2P9S C;  3C5M A;  3MZK A;  3HFQ A;  4QL1 A;  4A0B B;  4JD2 C;  2YNO A;  5I5J A;  4X60 B;  3JAM g; 
#chains in the Genus database with same CATH topology
 1E5T A;  4E5Z A;  4J73 A;  4AX4 A;  5TEF A;  5M5S A;  1U4C A;  5TDH B;  3V4V A;  5EAP A;  3IJE A;  3IUR A;  5KDO B;  3SVW D;  4J86 A;  5I5I A;  3SHF A;  4E54 A;  5FFO A;  4FWW A;  3I7L A;  5HQG A;  4Z8L A;  3VH0 A;  4NAA A;  3U4Y A;  4GGC A;  2XDW A;  3I8C A;  4OZU A;  5EMJ B;  4ZOX A;  2CN2 A;  4CY3 A;  4LG8 A;  3K27 A;  5C2W B;  4GM3 A;  3DXM C;  2XYI A;  4JT6 C;  3EI2 A;  1UOO A;  3ZDY A;  2AH0 A;  2GNQ A;  4ESG A;  4J84 A;  1L5G A;  1ERJ A;  2BCJ B;  4A08 B;  1XHM A;  3SFZ A;  4ERQ A;  3IUN A;  2CE8 A;  2PM6 B;  4CZX A;  2GC7 A;  2OIZ A;  3SBR A;  5C2V B;  1S4U X;  4MMX A;  5THA A;  3OKT A;  3CFS B;  1SHY B;  2H9P A;  2AGZ A;  1N6F A;  5EM2 A;  2BKL A;  3MZL A;  3EWE A;  5AJA A;  3UVN A;  4J81 A;  3PVU B;  1N6D A;  1K32 A;  3AH8 B;  3AFC A;  3MKQ A;  4G1E A;  4J77 A;  5H14 A;  1E8M A;  2IUR A;  2I3T A;  4J8G A;  1QFS A;  4O2W A;  4R7A B;  2P9P C;  4PNK B;  4O45 A;  1UOQ A;  4XYI A;  2PBI B;  3EI1 B;  2YNP A;  3ZE2 A;  2OVQ B;  4BUJ C;  4DNW A;  4AEZ A;  4J0X A;  4AN0 A;  4O3U B;  3OKW A;  2AQ5 A;  2HU8 A;  3C75 H;  2W18 A;  1FWX A;  4LG9 A;  5M5U A;  1UOP A;  2IUP A;  3T3P A;  1VYH C;  4CZV A;  4D0K A;  1OMW B;  2UZY B;  1O6F A;  5IC7 A;  5EMM B;  4WK4 A;  2VZ3 A;  2VZ1 A;  2CO0 C;  3IJ1 A;  5JWZ A;  3AL8 A;  4OWR A;  1GG2 B;  4XYH A;  3PE7 A;  3B7F A;  1JMZ B;  3UVO A;  2PM7 B;  1RI6 A;  4BCC A;  3N0D A;  3BWS A;  5M5R A;  4NSX A;  4QAM A;  4EWR A;  5FLX g;  2HXC A;  3IUL A;  3I7K A;  3IIW A;  3A0F A;  4J78 A;  2OK6 A;  3RN1 D;  5CXC B;  2B5M A;  4CC9 A;  1JTD B;  3MUO A;  4A7J A;  5GMK n;  4L9O A;  3UVK A;  4CI2 A;  3VGZ A;  3OKY A;  3AL9 A;  4WK0 A;  4X61 B;  2HKM A;  4FHL A;  4U1E I;  3UVL A;  2BBK H;  4JT5 C;  2EIB A;  2CN3 A;  5CYK A;  3ULE C;  3AL8 B;  1PEV A;  2G99 A;  5EM2 B;  3VI3 A;  3KRX B;  4WK2 A;  5SXM A;  5CXB B;  4BCD A;  4NBM A;  3VA6 A;  3FM0 A;  5IGO A;  3RFH A;  1UTC A;  4GQ2 P;  3ODT A;  2HYE A;  3UR4 A;  3GC3 B;  5EAL A;  4NEN A;  5B4W A;  4L1M A;  3V4P A;  2H3X A;  3NID A;  2B5N A;  3C9C A;  4NC4 A;  4J0W A;  4PBY A;  4DNU A;  1Q47 A;  4JSP C;  5H17 A;  4A08 A;  3BG0 A;  3L4O D;  3OKY B;  2AGL A;  4DNV A;  4FAV D;  4PXW A;  3PSL A;  4GM8 A;  5AMS A;  4ZOY A;  5HE3 B;  1YFQ A;  2QC5 A;  2I0T A;  3EQ7 A;  2G9A A;  3FGB A;  4E54 B;  4XEI C;  2XL3 A;  4K3J B;  4G1M A;  3KCI A;  4QRJ A;  4A0A A;  1B9X A;  3SCY A;  2GC4 A;  4GM9 A;  3EI4 A;  4A11 A;  1K8K C;  1TYE A;  4D9S A;  4CI1 A;  2OK4 A;  3KRW B;  4Z7Q A;  3OL2 A;  4FA5 D;  4JSX C;  3EG6 A;  2EBS A;  3MMY A;  4GQB B;  3IIY A;  2VDL A;  3GRE A;  4RE6 A;  3ZDX A;  1JOF A;  1GXR A;  1TYQ C;  4QQE A;  5FFG A;  4E5Z B;  4Y7R A;  1TBG A;  2J56 H;  4JHP C;  1JMX B;  4X3E A;  4J82 A;  2J57 G;  2WQ8 A;  3JZG A;  2PM9 A;  5FXY A;  4RE5 A;  4FA9 D;  4GGD A;  4D6V A;  4Y5R D;  1MG3 A;  3V5W B;  4O3T B;  5C9Z B;  2IWF A;  3I2N A;  2VDP A;  3O4H A;  2VDK A;  5IJ7 E;  3ORV D;  4PSX B;  2CO0 A;  2YMU A;  3ZE0 A;  4CY1 A;  4ES0 A;  3MUN A;  3O4G A;  2XL2 A;  5K1C C;  3T3M A;  4FA4 D;  4CY5 A;  5A2Q g;  2VDN A;  3JZH A;  4H5J A;  2B5L A;  4H5I A;  3PXS D;  4ZOZ A;  3VI4 A;  2TRC B;  3DM0 A;  4AN1 A;  2VDR A;  4I79 A;  3QI0 A;  4AMY A;  1H2Z A;  5I5M A;  3SBQ A;  5FKS A;  3NIF A;  3EQ8 A;  2JKX A;  3NVX A;  2HKR A;  4PSW B;  3GD1 I;  4J87 A;  2IUV A;  1H2Y A;  3ZWL B;  3IVM A;  4BP9 A;  3V7D B;  2AGY A;  3IUM A;  1XIP A;  4AOW A;  3BG1 A;  1NR0 A;  4A2M A;  1O6G A;  3QHY B;  1QNI A;  3DSM A;  3EQ9 A;  3JZN A;  3OW8 A;  2IWK A;  4JHN A;  2OJY A;  3SXT D;  2AH1 A;  2HU7 A;  2O9K A;  3PXW D;  1GOT B;  3IJ0 A;  2QXV A;  3IKO A;  2YBA A;  4CY2 A;  1C9L A;  2QZP A;  4O9D A;  2H6Q A;  2HES X;  3RN0 D;  3JB9 L;  3OL2 B;  3CFV A;  3DDU A;  5M5T A;  5HE0 B;  1R5M A;  2HJ4 A;  5GXH A;  1JV2 A;  5EML B;  1SQJ A;  3IUQ A;  3JRP A;  1H2W A;  3J80 g;  4O02 A;  1H2X A;  2J55 H;  3P4F A;  1U8C A;  1JJU B;  2XZG A;  1YR2 A;  1VZ2 A;  2HJB A;  5E6R A;  5TEE A;  2XE4 A;  3JPX A;  2H9N A;  5TF2 A;  3UVM A;  1I2M B;  4FAN D;  5IT9 g;  2XU7 A;  5M61 A;  4JSN C;  4PC0 A;  3I8E A;  3FRX A;  3JRO A;  4IA9 A;  5GXI A;  3W15 A;  2VDQ A;  2P9I C;  3EU7 A;  1K3I A;  3SLE D;  3SN6 B;  2IUQ A;  3EI2 B;  4J8B A;  5FKQ A;  4ERY A;  4Z7N A;  5EMK B;  2VDO A;  4A0B A;  5FKT A;  4MMZ A;  3ZE1 A;  2H9L A;  4QT8 A;  5HE1 B;  1XKS A;  3UKR C;  3I7P A;  4A09 A;  2MTA H;  2P9U C;  3I89 A;  3ZDZ A;  3O4J A;  4BCB A;  4HDJ A;  2PM9 B;  3OTT A;  4IMM A;  3J81 g;  3NVN A;  4JSV C;  2H6K A;  4L3G D;  2VC2 A;  1B9Y A;  1VZ3 A;  4CI8 A;  4FB1 D;  3FCU A;  3EMH A;  3I7H A;  2HU5 A;  2EID A;  4TZ4 A;  4L1Q D;  5K19 A;  5FKR A;  1E8N A;  1GP2 B;  1P22 A;  4X63 B;  2I3S A;  5GSA A;  4L3H D;  2YB8 B;  3I7O A;  5HYN B;  5E6S A;  2Z2N A;  1VE6 A;  3UKU C;  3SMR A;  4UI9 R;  5E6U A;  5EAM A;  5HDB A;  3I7N A;  4A11 B;  1M1X A;  2H6N A;  1GOG A;  2VDM A;  3NVQ A;  3EI1 A;  3F3F A;  1QFM A;  2AGX A;  2H14 A;  4G56 B;  2P9L C;  3FCS A;  4G55 A;  4GZ8 A;  5CXC A;  4YVD A;  4J79 A;  1MG2 A;  3EI3 A;  5FQD A;  4PBZ A;  4BH6 A;  1A0R B;  1A12 A;  4BL0 A;  2Z2P A;  3F3P A;  2EIE A;  2I0S A;  4ERZ A;  2AGW A;  4GGA A;  3K6S A;  3MKS B;  4IRZ A;  3SJL D;  2H13 A;  4CZY A;  4KFM B;  3PXT D;  3L4M D;  3N0E A;  3IJC A;  4UM8 A;  4N14 A;  3V9F A;  5CYK B;  5IGQ A;  2UZX B;  3E0C A;  1GOF A;  2I0R A;  2EIC A;  2IAA A;  4GMB A;  4ZOV A;  3EI4 B;  4JXM A;  2H9M A;  1VE7 A;  2CNX A;  5C92 A;  4GQ1 A;  4O1Q D;  2P9K C;  1OLZ A;  3OF7 A;  3CIK B;  3F3G A;  3SBP A;  4CI3 A;  3SWS D;  1U2V C;  1BPO A;  4MK0 B;  3PVW B;  2QR5 A;  3IUJ A;  4WJK A;  3MXX A;  3K72 A;  4BP8 A;  3PSC B;  1NEX B;  1PI6 A;  4A09 B;  3DXK C;  3EI3 B;  5IJ8 E;  2Z2O A;  3O4I A;  2OVR B;  2CE9 A;  3RRM C;  2OVP B;  1PBY B;  2P9N C;  2YNN A;  4U7A A;  4ZN4 A;  5H1M A;  2H47 A;  2B4E A;  5C86 A;  3DWL C;  1N6E A;  3RLM D;  3RFG A;  4K3I D;  4LGN A;  3RMZ D;  1MDA H;  3C99 A;  3K71 A;  5AFU 3;  4FA1 D;  1L0Q A;  2Q7Q A;  1PGU A;  3GFC A;  2H68 A;  3K26 A;  3NIG A;  5M5V A;  5CXB A;  5HE2 B;  4A2L A;  4A0A B;  4Z7O A;  4UM9 A;  5EAR A;  3RSE C;  5FA5 B;  1SQ9 A;  2P9S C;  3C5M A;  3MZK A;  1C9I A;  1GOH A;  4MMY A;  3HFQ A;  4AMZ A;  4QL1 A;  4A0B B;  1T2X A;  4JD2 C;  2YNO A;  5I5J A;  4X60 B;  3JAM g;  3MVD K; 
#chains in the Genus database with same CATH homology
 4E5Z A;  4J73 A;  5TEF A;  1U4C A;  5TDH B;  5EAP A;  5KDO B;  3SVW D;  4J86 A;  5I5I A;  3SHF A;  4E54 A;  4FWW A;  3I7L A;  5HQG A;  4Z8L A;  3VH0 A;  3U4Y A;  4GGC A;  3I8C A;  4OZU A;  5EMJ B;  4ZOX A;  2CN2 A;  4CY3 A;  4LG8 A;  3K27 A;  5C2W B;  4GM3 A;  3DXM C;  2XYI A;  4JT6 C;  3EI2 A;  2AH0 A;  2GNQ A;  4ESG A;  4J84 A;  1ERJ A;  2BCJ B;  4A08 B;  1XHM A;  3SFZ A;  4ERQ A;  2CE8 A;  2PM6 B;  4CZX A;  2GC7 A;  2OIZ A;  3SBR A;  5C2V B;  1S4U X;  5THA A;  3OKT A;  3CFS B;  1SHY B;  2H9P A;  2AGZ A;  1N6F A;  5EM2 A;  3MZL A;  3EWE A;  5AJA A;  3UVN A;  4J81 A;  3PVU B;  1N6D A;  1K32 A;  3AH8 B;  3AFC A;  3MKQ A;  4J77 A;  5H14 A;  2IUR A;  4J8G A;  2I3T A;  4R7A B;  2P9P C;  4PNK B;  4O45 A;  4XYI A;  2PBI B;  3EI1 B;  2YNP A;  2OVQ B;  4BUJ C;  4AEZ A;  4J0X A;  4O3U B;  3OKW A;  2AQ5 A;  3C75 H;  2W18 A;  1FWX A;  4LG9 A;  2IUP A;  1VYH C;  4CZV A;  4D0K A;  1OMW B;  2UZY B;  5IC7 A;  5EMM B;  2CO0 C;  3IJ1 A;  5JWZ A;  3AL8 A;  4OWR A;  1GG2 B;  4XYH A;  3PE7 A;  3B7F A;  1JMZ B;  3UVO A;  2PM7 B;  1RI6 A;  3N0D A;  3BWS A;  4NSX A;  4EWR A;  5FLX g;  2HXC A;  3I7K A;  3IIW A;  3A0F A;  4J78 A;  2OK6 A;  3RN1 D;  5CXC B;  2B5M A;  4CC9 A;  5GMK n;  4A7J A;  4L9O A;  3UVK A;  4CI2 A;  3VGZ A;  3OKY A;  3AL9 A;  4X61 B;  2HKM A;  4FHL A;  4U1E I;  3UVL A;  2BBK H;  4JT5 C;  2CN3 A;  5CYK A;  3ULE C;  3AL8 B;  1PEV A;  2G99 A;  5EM2 B;  3KRX B;  5SXM A;  5CXB B;  3VA6 A;  3FM0 A;  5IGO A;  3RFH A;  4GQ2 P;  3ODT A;  2HYE A;  3UR4 A;  5EAL A;  5B4W A;  2H3X A;  2B5N A;  3C9C A;  4PBY A;  4J0W A;  1Q47 A;  4JSP C;  5H17 A;  4A08 A;  3BG0 A;  3L4O D;  3OKY B;  2AGL A;  4FAV D;  4PXW A;  3PSL A;  4GM8 A;  5AMS A;  4ZOY A;  5HE3 B;  1YFQ A;  2QC5 A;  2I0T A;  2G9A A;  3FGB A;  4E54 B;  4XEI C;  2XL3 A;  4K3J B;  4QRJ A;  4A0A A;  1B9X A;  3SCY A;  2GC4 A;  4GM9 A;  3EI4 A;  4A11 A;  1K8K C;  4CI1 A;  2OK4 A;  3KRW B;  3OL2 A;  4FA5 D;  4JSX C;  3EG6 A;  2EBS A;  3MMY A;  4GQB B;  3IIY A;  3GRE A;  1JOF A;  1GXR A;  1TYQ C;  4QQE A;  4E5Z B;  4Y7R A;  1TBG A;  2J56 H;  1JMX B;  4X3E A;  4J82 A;  2J57 G;  3JZG A;  2PM9 A;  5FXY A;  4FA9 D;  4GGD A;  4D6V A;  4Y5R D;  1MG3 A;  3V5W B;  4O3T B;  5C9Z B;  2IWF A;  3I2N A;  5IJ7 E;  3ORV D;  4PSX B;  2CO0 A;  2YMU A;  4CY1 A;  4ES0 A;  5K1C C;  2XL2 A;  4FA4 D;  4CY5 A;  5A2Q g;  3JZH A;  4H5J A;  2B5L A;  4H5I A;  3PXS D;  4ZOZ A;  2TRC B;  3DM0 A;  4I79 A;  5I5M A;  3SBQ A;  5FKS A;  3NVX A;  2HKR A;  4PSW B;  4J87 A;  2IUV A;  3ZWL B;  3V7D B;  2AGY A;  1XIP A;  4AOW A;  3BG1 A;  1NR0 A;  4A2M A;  1QNI A;  3DSM A;  3JZN A;  3OW8 A;  2IWK A;  2OJY A;  3SXT D;  2AH1 A;  2O9K A;  3PXW D;  1GOT B;  3IJ0 A;  2QXV A;  3IKO A;  2YBA A;  4CY2 A;  4O9D A;  2H6Q A;  2HES X;  3RN0 D;  3JB9 L;  3OL2 B;  3CFV A;  5HE0 B;  1R5M A;  2HJ4 A;  5GXH A;  5EML B;  1SQJ A;  3JRP A;  3J80 g;  2J55 H;  3P4F A;  1JJU B;  2HJB A;  5TEE A;  3JPX A;  2H9N A;  5TF2 A;  3UVM A;  4FAN D;  5IT9 g;  2XU7 A;  4JSN C;  4PC0 A;  3I8E A;  3FRX A;  3JRO A;  4IA9 A;  5GXI A;  3W15 A;  2P9I C;  3EU7 A;  3SLE D;  3SN6 B;  2IUQ A;  3EI2 B;  4J8B A;  5FKQ A;  4ERY A;  5EMK B;  4A0B A;  5FKT A;  2H9L A;  4QT8 A;  5HE1 B;  1XKS A;  3UKR C;  3I7P A;  4A09 A;  2MTA H;  2P9U C;  3I89 A;  4HDJ A;  2PM9 B;  3OTT A;  4IMM A;  3J81 g;  3NVN A;  4JSV C;  2H6K A;  4L3G D;  1B9Y A;  4CI8 A;  4FB1 D;  3EMH A;  3I7H A;  4TZ4 A;  4L1Q D;  5K19 A;  5FKR A;  1GP2 B;  1P22 A;  4X63 B;  2I3S A;  5GSA A;  4L3H D;  2YB8 B;  3I7O A;  5HYN B;  2Z2N A;  3UKU C;  3SMR A;  4UI9 R;  5EAM A;  3I7N A;  4A11 B;  2H6N A;  3NVQ A;  3EI1 A;  3F3F A;  2AGX A;  2H14 A;  4G56 B;  2P9L C;  4GZ8 A;  5CXC A;  4YVD A;  4J79 A;  1MG2 A;  3EI3 A;  5FQD A;  4PBZ A;  4BH6 A;  1A0R B;  4BL0 A;  2Z2P A;  3F3P A;  2I0S A;  4ERZ A;  2AGW A;  4GGA A;  3MKS B;  3SJL D;  2H13 A;  4CZY A;  4KFM B;  3PXT D;  3L4M D;  3N0E A;  3IJC A;  3V9F A;  4N14 A;  5CYK B;  5IGQ A;  2UZX B;  3E0C A;  2I0R A;  2IAA A;  4GMB A;  4ZOV A;  3EI4 B;  4JXM A;  2H9M A;  2CNX A;  4GQ1 A;  4O1Q D;  2P9K C;  1OLZ A;  3CIK B;  3F3G A;  3SBP A;  4CI3 A;  3SWS D;  1U2V C;  4MK0 B;  3PVW B;  3MXX A;  3PSC B;  1NEX B;  1PI6 A;  4A09 B;  3DXK C;  3EI3 B;  5IJ8 E;  2Z2O A;  2OVR B;  2CE9 A;  3RRM C;  2OVP B;  1PBY B;  2P9N C;  2YNN A;  4U7A A;  4ZN4 A;  5H1M A;  2H47 A;  2B4E A;  3DWL C;  1N6E A;  3RLM D;  3RFG A;  4LGN A;  4K3I D;  3RMZ D;  1MDA H;  3C99 A;  5AFU 3;  4FA1 D;  1L0Q A;  2Q7Q A;  1PGU A;  3GFC A;  2H68 A;  3K26 A;  5CXB A;  5HE2 B;  4A2L A;  4A0A B;  5EAR A;  3RSE C;  5FA5 B;  1SQ9 A;  2P9S C;  3C5M A;  3MZK A;  3HFQ A;  4QL1 A;  4A0B B;  4JD2 C;  2YNO A;  5I5J A;  4X60 B;  3JAM g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...